{ "batchid": 32, "recordid": "pubmed.37074911", "recordtype": "publication", "sections": { "glycosylation": [ { "glytoucan_ac": "G53075ES", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101001.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G55132BD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G56518TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001101000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G56770VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G60967DT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G63040RU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G64751KD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G66537LK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G67164EE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G69521XL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000010000001101000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G70888PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000001100001.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G71463BG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001101000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G72951AH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G73430PD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G74381CZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0000100.1110100000.000000000011100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G76868JS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G77547TA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101001.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G80479JV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010011000011111100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G80669SJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G81637OR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G82443XX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000100000001001000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G84225JN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G85282JO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G85554PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G86880BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G87123QX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000011000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G87389XI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001101001.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G93718GY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G94390IS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000000000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G94665LC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G99668VU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QDQCIYnTTYLNVQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000001100000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G11101UV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ACLMAAFSVGTAMnASSYSAEMTEPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 15, "start_aa": "Asn", "end_pos": 15, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn15", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010000000001100000.00100.01001", "uniprot_canonical_ac": "P45844-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPDLSnCTSHWVNQLAQK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPDLSnCTSHWVNQLAQK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLGQFLSTEnATIK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 731, "start_aa": "Asn", "end_pos": 731, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn731", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLGQFLSTENATIK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 731, "start_aa": "Asn", "end_pos": 731, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn731", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLGQFLSTEnATIK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 731, "start_aa": "Asn", "end_pos": 731, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn731", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLGQFLSTEnATIK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 731, "start_aa": "Asn", "end_pos": 731, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn731", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLGQFLSTEnATIK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 731, "start_aa": "Asn", "end_pos": 731, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn731", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLGQFLSTEnATIK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 731, "start_aa": "Asn", "end_pos": 731, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn731", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLGQFLSTEnATIK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 731, "start_aa": "Asn", "end_pos": 731, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn731", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95490-1" }, { "glytoucan_ac": "G00273SJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "26791533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26791533" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G01160VV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G01485JJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G01521EA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G03644CB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000011111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G04854VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G05962QB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G07246CJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011000001111001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010011000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G08609CW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10819WX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10846ZT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G15664MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010000000011111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G19918RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000000000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G22572EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001110001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G26330YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000100000001100000.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000011110101.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G28622IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000001000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G29299MO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G29545VG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G30248BL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G30521DU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0000100.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G30740WO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G30970QQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010011000001111001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G33416PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010000000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G34029GR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001100100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010001000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G35253PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000010000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G36442WJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001100000.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010000000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37509XX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010011000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37692EO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37995HC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40206WX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001100100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G41840AI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000011101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G43769HG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G46503DX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G47644PP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G49018RC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G49589RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010000000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G49906RN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G51653BI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G54010QB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G56307ZW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001100000.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G56518TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001101000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G56770VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G58087IP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010000010011111010.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G58954YZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G59324HL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.011001010011111010.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G63040RU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G63980BQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G68490OW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70223PD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70888PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000001100001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G72197KC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LSSWVLLMKYLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G75006KF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0000100.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G75568BH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G77547TA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G77669RF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G78787DI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G81637OR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G84225JN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G84862VB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G85269DF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001110001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G85554PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G86880BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G87123QX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000011000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G87389XI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001101001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G89045VA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G92551JA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000001000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G94390IS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000000000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G94470IW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G95046LV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G98129XB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G99668VU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "YLGnATAIFFLPDEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01009@N70", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N70" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G01485JJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G04854VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G07246CJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010011000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001101000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10819WX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10846ZT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G12261QD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G15127JD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100000000.000000000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G20528HD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000001101101.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G22572EH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001110001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G26330YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000100000001100000.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G27915IV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G28622IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000001000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G30740WO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G33416PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010000000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G34029GR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001100100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010001000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G35253PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000010000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G35541EV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010000000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37509XX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010011000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37692EO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G37995HC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40206WX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001100100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000011101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G43734MM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000001100100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G43769HG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G49589RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010000000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G49642SA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010010000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G51653BI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G54010QB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G55132BD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G56307ZW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001100000.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G56518TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001101000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G58087IP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010000010011111010.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G58954YZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001111000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G59324HL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.011001010011111010.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "P01009@N70", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N70" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001110000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G63041LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G63136LV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.010000000001101000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G63980BQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G69521XL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000010000001101000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70223PD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G70888PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000001100001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G72197KC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G75418YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G75568BH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000000000001101100.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G76868JS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G77669RF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G78649WQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G78787DI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G84225JN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G85282JO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G85554PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G86880BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G87123QX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000011000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G87389XI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001101001.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G89045VA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G90734RJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000011000001100100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G92275SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G92551JA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000001000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G94390IS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110000000.000000000000000000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G94470IW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G98129XB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001101100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G99668VU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QLAHQSnSTNIFFSPVSIATAFAMLSLGTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000001100000.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTLYLRPGQAAAFnVTFR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G49755GI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTLYLRPGQAAAFnVTFR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTLYLRPGQAAAFnVTFR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "PGQAAAFNVTFR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTLYLRPGQAAAFnVTFR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G05962QB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G35541EV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G46503DX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G51653BI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001000000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G60834IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001101000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G81637OR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTNNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G93718GY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LTnNSNQFQTEVGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DnNSIICSGLGDCVCGQCLCHTSDVPGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 501, "start_aa": "Asn", "end_pos": 501, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn501", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G02528FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G05962QB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G09831WQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000011100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G32788FZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000011100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G35541EV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LNFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G93718GY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LnFTGPGDPDSIR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G41840AI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G46503DX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111001.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G47644PP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G59924QI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001101000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G63041LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101001.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G65000LJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000011000001100000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001110000.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G96091TT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nCSAACPGLQLSNNPVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111001.00100.01001", "uniprot_canonical_ac": "P05107-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000011101100.00010.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G51653BI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001000000.00100.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SIInATDP", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 207, "start_aa": "Asn", "end_pos": 207, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn207", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P35625-1" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SPAnGSLGPTLNLSSGESR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1549, "start_aa": "Asn", "end_pos": 1549, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1549", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SPAnGSLGPTLNLSSGESR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1549, "start_aa": "Asn", "end_pos": 1549, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1549", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVTGDILTDITGHnVSEYLLFTSDR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1677, "start_aa": "Asn", "end_pos": 1677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1677", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVTGDILTDITGHnVSEYLLFTSDR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1677, "start_aa": "Asn", "end_pos": 1677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1677", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G46503DX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GNPAAYGITVTNHPMnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1775, "start_aa": "Asn", "end_pos": 1775, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1775", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000000000001100000.00100.01001", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GNPAAYGITVTNHPMNK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1775, "start_aa": "Asn", "end_pos": 1775, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1775", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGnMSSLGFTSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGnMSSLGFTSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GNMSSLGFTSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QnSSFTEK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 628, "start_aa": "Asn", "end_pos": 628, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn628", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QnSSFTEK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 628, "start_aa": "Asn", "end_pos": 628, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn628", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QNSSFTEK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 628, "start_aa": "Asn", "end_pos": 628, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn628", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IRQnSSFTEK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 628, "start_aa": "Asn", "end_pos": 628, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn628", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BZC7-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFQTFnASYDTINLHVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1675, "start_aa": "Asn", "end_pos": 1675, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1675", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P14410-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFQTFnASYDTINLHVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1675, "start_aa": "Asn", "end_pos": 1675, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1675", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P14410-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G84862VB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SnDSGVYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G07246CJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G27915IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G68490OW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G87123QX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVYVHAnQTGYPDPSSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P16112-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G29545VG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G50282JC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G66537LK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G84349RE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G90575OW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G90734RJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G92275SC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G96430BV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G98129XB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LEnLSSSEMGYTATLTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G04854VP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G18647XP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G49906RN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVENMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G94470IW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QVVEnMTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "P10253@N470", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10253@N470" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G30970QQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G36442WJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "P10253@N470", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10253@N470" }, { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G43769HG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G46503DX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G49018RC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVFITnETGQPLIGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 470, "start_aa": "Asn", "end_pos": 470, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn470", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G47644PP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G50282JC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nNTIVNELVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G92275SC", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G23719VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G29299MO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G47644PP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G47950XN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G59324HL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSNFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G92275SC", "type": "N-linked;o-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VTVLGVATAPQQVLSNGVPVSnFTYSPDTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 925, "start_aa": "Asn", "end_pos": 925, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn925", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P10253-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G15664MX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "34089345", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34089345" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://doi.org/10.1007/s00018-021-03863-1" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ASQNITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G85282JO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LMSTEASQnITYHCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P02452-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10819WX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G23719VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G36379GD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSNTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G47702MW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G64409MC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G77669RF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G90734RJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92551JA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G95177YH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NLHQSnTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1755, "start_aa": "Asn", "end_pos": 1755, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1755", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LPQVSPADSGEYVCRVEnGSGPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2121, "start_aa": "Asn", "end_pos": 2121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2121", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LPQVSPADSGEYVCRVEnGSGPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2121, "start_aa": "Asn", "end_pos": 2121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2121", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LPQVSPADSGEYVCRVEnGSGPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2121, "start_aa": "Asn", "end_pos": 2121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2121", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G00273SJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02528FI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G04854VP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10819WX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10846ZT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G12341GU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G15664MX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G17208MA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G18647XP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G23719VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G29184RN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G29299MO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G31028YV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G35253PZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G36379GD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G37509XX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40206WX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41840AI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G46503DX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G47644PP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G47702MW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G47950XN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G50856PC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G59924QI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G63041LO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G64409MC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G68490OW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G72747WU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G73430PD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G77547TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVNGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G84349RE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G85554PZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G87389XI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G88891KO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G95177YH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G96091TT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SLTQGSLIVGDLAPVnGTSQGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3780, "start_aa": "Asn", "end_pos": 3780, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3780", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G00273SJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G01485JJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G04854VP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G08918WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10846ZT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G17208MA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G22572EH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G37995HC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43734MM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G60834IK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G61256FT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G63041LO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G75418YA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G77669RF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G84862VB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G85554PZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G86880BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G87123QX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G87389XI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G89045VA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92135MA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G92551JA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G94470IW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G95177YH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IQGEEIVFHDLnLTAHGISHCPTCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3836, "start_aa": "Asn", "end_pos": 3836, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3836", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02528FI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G07246CJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G26330YA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40574BA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G43769HG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G49906RN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVNFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G68490OW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G69521XL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70223PD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G84225JN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G99668VU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ALVnFTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98160-1" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFQTFnASYDTINLHVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1675, "start_aa": "Asn", "end_pos": 1675, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1675", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P14410-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFQTFnASYDTINLHVR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1675, "start_aa": "Asn", "end_pos": 1675, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1675", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P14410-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G28622IK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GLRGPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G86880BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GLRGPnLTSPASITFTTGLEAPR", "relation": "attached", "comment": "reported site N3918 is on non-canonical isoform P22105-1 which maps to canonical isoform site P22105-3:3920", "icn3d_view": {}, "start_pos": 3920, "start_aa": "Asn", "end_pos": 3920, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3920", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P22105-3" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LLSTAGTPEnGSEPESR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 621, "start_aa": "Asn", "end_pos": 621, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn621", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P98161-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G10488MI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G20706XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G49589RB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G59324HL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G60834IK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G63980BQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G77669RF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G86880BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RGQFESVAPSQnFSDSSESDTHPFVIAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nTTDTLITLDTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1663, "start_aa": "Asn", "end_pos": 1663, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1663", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "nTTDTLITLDTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1663, "start_aa": "Asn", "end_pos": 1663, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1663", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G07246CJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G16125XL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G27915IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G68490OW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G80479JV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAENITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G87123QX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G93718GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VVAEnITQTSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G32788FZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVTADGFPTVSVMLPLHSEQnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVTADGFPTVSVMLPLHSEQnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVTADGFPTVSVMLPLHSEQnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G69521XL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVTADGFPTVSVMLPLHSEQnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G70232NH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVTADGFPTVSVMLPLHSEQnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G80075MS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVTADGFPTVSVMLPLHSEQnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G95046LV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVTADGFPTVSVMLPLHSEQnK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G04657PL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G05049YU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G07246CJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G07755XJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G08290VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G10819WX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G11314AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G14972EH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G17208MA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G27058EU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TLYRFEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G34029GR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G34989PA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G41071NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G42124LM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TLYRFEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G43223CG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G45395BF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G46691LC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G47644PP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G57776ZS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G59324HL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FENQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G63041LO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G70441OD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G70619PT", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G73968GN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TLYRFEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G76295SF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G79666IR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G87661QW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G90382BL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G90659AW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" }, { "glytoucan_ac": "G92406TI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FEnQTGFPPPDSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "uniprot_canonical_ac": "P13611-1" } ], "glycan_expression": [ { "glytoucan_ac": "G27126ED", "abundance": "14.52951186", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05417077", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13258898", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.63331453", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82090337", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14924799", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.46695663", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82676631", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.43830047", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91016923", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13109321", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15334887", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64924713", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.67551238", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.22594171", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8895181", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.63959411", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.22970518", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37186253", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11949044", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19202272", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.22275469", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.97516813", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.31738826", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.50826796", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71886111", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57002318", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19891445", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.31529932", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.13904117", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10653216", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05685165", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.34029352", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.62582895", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.31939019", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "12.64497845", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99683417", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88074955", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.04321828", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15476523", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.72744513", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81591647", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.49297577", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13563168", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.65903627", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15603552", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.62051354", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.1894861", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.93710534", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.49775619", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18332931", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55575651", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.46282397", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "15.30377493", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8490822", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.41538111", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71926815", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3369011", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.20366164", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64406532", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76136987", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.54900872", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10721241", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.59708214", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07092315", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.73106736", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99918455", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.17682885", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07675228", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.52984342", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.4805994", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14277975", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95061691", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.83997454", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41482912", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.76445643", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94786071", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53701197", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "12.96932948", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42855278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "11.27501518", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.3895641", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82717819", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85378762", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96788924", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.38358125", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.38573778", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "12.91796927", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.09546314", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.47162586", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.50871008", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.25486937", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84576788", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6014785", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.34596714", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42405929", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14347216", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.89451018", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.01239074", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77603126", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.1138359", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.10834984", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76813052", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "14.00519523", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.92506484", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.22194851", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78806938", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.46647443", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "12.93703535", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.59393674", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81232299", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.28320642", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81155951", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "13.66700869", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "11.28316826", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "11.50767489", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "12.36101342", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "11.50716485", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "11.46427133", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "11.72716184", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "10.42913976", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "11.81316351", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "11.91695701", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q8N6C5-1", "residue": "Asn", "start_pos": 1223, "end_pos": 1223 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48280622", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33174373", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08718665", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3888959", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.2965688", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19970612", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21654028", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "14.02623149", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82808981", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 531, "end_pos": 531 }, { "glytoucan_ac": "G27126ED", "abundance": "13.24963078", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49782322", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96993756", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.66101572", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.09024061", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.04387775", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.28231064", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73149276", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15537452", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42231322", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.43485775", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.41693031", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64996043", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.59529682", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.52561663", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53100604", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "12.72279888", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.0183823", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.97099437", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06123245", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.0750207", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.66216366", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27503152", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.85026862", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.46365871", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.43893464", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.90868404", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.67453068", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.34576435", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76737414", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.87252723", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82537834", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79324552", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75232647", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.00982691", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05584187", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81857655", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80567012", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.62228566", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.36405602", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.49975929", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80006826", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40447646", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.90282125", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42612156", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.68983609", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.57226076", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.22657101", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05640444", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77940708", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.90107948", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49917636", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8900252", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60013732", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80158804", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88281562", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7782884", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.5535612", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71945185", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79010076", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.20639029", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.09736874", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8787273", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31180796", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05708805", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.62355076", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14409958", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94455518", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42308849", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.19754189", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31229086", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64957863", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75324087", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45914354", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81887811", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.21678858", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94260157", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11726757", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41968916", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.59579945", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08870376", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.16580392", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.26320253", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82379892", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21220654", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3133583", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.89537171", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19837175", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81548934", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91571261", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74029369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05046376", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.30544331", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76387432", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.86701248", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95927658", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99143142", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79337175", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.47176938", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.9760646", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.33492996", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.3609537", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.0614512", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49655429", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.57173963", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98739018", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05189335", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42927615", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.70217312", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37567859", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84657506", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73140088", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.69262888", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74093141", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91959267", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.65912322", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79520602", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8726312", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8864188", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64301675", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82964476", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8630551", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.40670356", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95249704", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37411441", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73459715", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "14.35789554", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45622686", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P25311-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14148085", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77895252", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.29835779", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.2730309", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.89508721", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.12293936", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19999318", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88061779", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.1016302", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27936403", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.35064807", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "12.99924852", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49466486", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75160182", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77540699", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82889664", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91072028", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.17869345", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98420786", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.90783379", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07445674", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03188056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14727492", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.74416045", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3957023", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88687029", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57183408", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95844996", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.1185278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96259075", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.53302801", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.1111188", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.17877971", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23377267", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.02954786", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06754448", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.35606958", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.90268305", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.86361622", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03953699", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.34057894", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.02104241", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71386476", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11125493", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88987361", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91262328", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7725685", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14160386", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81620962", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.2092049", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8558881", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6226801", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.12014067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.52811371", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "13.60873409", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05441078", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.2543177", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.28573544", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23304227", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.01761896", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15361615", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "14.51856728", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "14.74670052", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08468766", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "14.88776397", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57766048", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "15.11756527", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "14.96335464", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "15.44781295", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q99715-1", "residue": "Asn", "start_pos": 2679, "end_pos": 2679 }, { "glytoucan_ac": "G27126ED", "abundance": "13.46320557", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "13.34921348", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07843021", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78172796", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33651737", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "14.776073", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91911687", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03877649", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42210789", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1366, "end_pos": 1366 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.00382114", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.25301285", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45331225", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.21019065", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.50588252", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91860583", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.35891742", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.18752564", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.91123962", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.5972987", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.70713612", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.79308066", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.97973593", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.70110099", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.15233555", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.49892764", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44465524", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.66190282", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.39842928", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73065514", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.10600732", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.58024491", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.45622116", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42504727", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.97448278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88946129", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.24100266", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.32074972", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.61745906", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "12.95979834", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.54176658", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.48226165", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45863067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "13.29018548", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21367295", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1107, "end_pos": 1107 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.24489402", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "14.88533826", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.60138897", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.50389643", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.46494343", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.38503879", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.99136932", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.38827513", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "15.91967856", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G27126ED", "abundance": "13.05936667", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82811525", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10087161", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.39321103", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.06902014", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.9560882", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "16.02702305", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.20346881", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.65907718", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.1848219", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18468066", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "12.48895835", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.0315206", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.12102414", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.66930701", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.68333093", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "12.75740685", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.70210681", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.17484239", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37889885", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88093111", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.58900581", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95230246", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.63509027", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08265171", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.39872874", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.47868843", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.25605559", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.83840227", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76075678", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.14234557", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.50884446", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.57731201", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08437899", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.54747191", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.02920582", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6574746", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.47357155", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.98605339", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.99189963", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.97349373", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.58792419", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.09865211", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78112558", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31371677", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.06787922", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.44273845", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "16.0168972", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.72073699", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.54032574", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.63268969", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85179509", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.54135895", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91927657", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.44139967", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57608536", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "15.38653087", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3625286", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "14.61060046", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q7Z6M3-1", "residue": "Asn", "start_pos": 182, "end_pos": 182 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "15.07074654", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "15.20913082", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6103809", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.84487047", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "15.01372226", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.89551729", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.7780165", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78671804", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.5195392", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.38773", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.76489447", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.76891234", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55375764", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31519619", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.74586714", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.43930581", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41245762", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q15149-1", "residue": "Asn", "start_pos": 787, "end_pos": 787 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.42048395", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.54003759", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.03645459", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.65632147", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.30739986", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.4817018", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.56238431", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96430704", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.53569583", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.64916805", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "16.15913516", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60890963", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.36691333", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.84951545", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.51255509", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.67874937", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "16.27592348", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21502908", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.3393369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.1081704", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.88379817", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.31491898", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.75818302", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.40807957", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70573563", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41736481", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "16.10695265", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.51434867", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07340535", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.07755969", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.2337537", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.29830391", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.80117142", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.88981792", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.84314924", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.68478891", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.81970979", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.47047", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.36871312", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82886396", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.75634365", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.05651067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.05068169", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.91059027", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.52172199", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.71812985", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.85413401", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70858425", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "15.00039242", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.24310654", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.87362485", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82014964", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q92896-1", "residue": "Asn", "start_pos": 165, "end_pos": 165 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "11.78021234", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "15.07335108", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "11.77034924", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "10.6045521", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "11.72346881", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "10.55369207", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "12.39855491", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "11.777708", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "12.29999264", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2635, "end_pos": 2635 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40347237", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78099274", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37261613", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "15.328739", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.93753729", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "15.34693256", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.9453288", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.20319787", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85086085", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "15.16539944", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.59685864", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57536817", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.97554153", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.54578047", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82768362", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.61057601", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "13.86948262", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08886917", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23684394", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.16414298", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.16392308", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23288049", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19997384", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.00842372", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13199824", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77013641", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 430, "end_pos": 430 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42240495", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.36800637", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72438605", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.24694495", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42395886", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.47503324", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95231518", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.2901129", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "13.56462756", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G27126ED", "abundance": "16.26428515", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "16.76862957", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.3449024", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.03811729", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.70723856", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.80849853", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.82402305", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.27807732", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.35036094", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.00743706", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.47352599", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.33169153", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.2433261", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.38390394", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.37265026", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.71124979", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.4562531", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.61906879", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.27299482", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.66005965", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.65863847", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.21214528", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.18333579", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.57214364", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.66189315", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.85913813", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.69573793", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.44631305", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.31733784", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.02752566", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.42091059", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.69462039", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.73238281", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.38173493", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.32936728", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.64198539", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.56402287", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.1359043", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.87268549", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.82984833", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.25554832", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.23155226", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.92025189", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.19680175", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.86148104", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.33597318", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.3725421", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.26351547", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.84940254", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.41594145", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.66213078", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.74354946", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.81592494", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.84536653", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.74354846", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.75554999", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.90952506", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.05543565", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.1716884", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.39794083", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.4144304", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.67212821", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.46824197", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.57665167", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.14100672", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.47930461", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.68977893", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.80189143", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.31732862", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "19.2472025", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.86019606", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.89445685", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.7821761", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.47566747", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.62106359", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.51498549", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.64157011", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.488729", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.79894872", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.78874728", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.07596997", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.69595647", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.4518597", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.100958", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.11725506", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.72336083", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.11310403", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.84668147", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.31341369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.84555511", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.625171", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.0297517", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.42513455", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.55894494", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "19.05037946", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.26667116", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.2301388", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.74501605", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "16.96365821", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.78446829", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.04153179", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.83241381", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.47065189", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.72337495", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.66928402", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.86999386", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.18851515", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.82857359", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.94804699", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.35886875", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.02438479", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.81765374", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.63756636", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.40100023", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.1725056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.03516471", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.30946884", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.49748382", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.43305826", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.07165132", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.0544336", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.96721005", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.94343693", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.12734962", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.68997021", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.77055401", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.40423801", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.02704059", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.72332065", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.81781829", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.77697557", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.73680569", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.59654429", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.89464413", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "16.97203002", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.8666571", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.22427068", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.83720056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.01402516", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.18343588", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.35298511", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.84634885", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "16.79135359", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.10265593", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.1096478", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.33049518", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "16.85892987", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.66145839", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.34097002", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.66124151", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.40198273", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.33299487", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.92828508", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.97569947", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.59048893", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.35907633", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.69595399", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.52887211", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.66656356", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.84169433", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.59093913", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.53547667", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.93762158", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.88862602", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.07586044", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.86978785", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.79105197", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.80387087", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.46348978", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.68533609", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.3262698", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.52246951", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.90981567", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.09470549", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.46789388", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.86445643", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.22568995", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.77114232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.09742785", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.59546282", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.42994314", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.44584033", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.93223805", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.44578844", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.04016708", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.48363126", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.9078624", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.10305687", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.78004727", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.12754049", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.8179559", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.67299777", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "18.36099853", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "17.80221438", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G27126ED", "abundance": "16.86250877", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.26435172", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.94317807", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.88435259", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.57601453", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.64673944", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.82492234", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.90080852", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.05459096", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.76960289", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.86016536", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.10360632", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.61947422", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.57650655", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.30238676", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.73877615", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.86492731", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.70496727", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.83881902", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.15274837", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.95939127", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.4267155", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.0675595", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.64252695", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.443485", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.13229846", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.13296766", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.00124168", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.5257836", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.89863081", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.70511769", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.71288887", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.82249336", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.68394144", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.8671057", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.08237299", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.90738507", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.70051109", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.45828705", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.78782009", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.87306114", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.82662652", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.72138191", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.86481343", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.12022399", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.0191408", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.66744558", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.63321083", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.83078434", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.89977231", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.81359406", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.24863812", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.9466416", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.53047562", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.0843702", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.74210054", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.05681405", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.5542273", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.02317376", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.35296049", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.93135679", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.90931949", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.71948355", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.64181457", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.4201969", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.44491235", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.02523925", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.96777701", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.7726201", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.03180614", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.47376983", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.40955428", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.53727372", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.4306078", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.34649564", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.96944057", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.25952302", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.76781291", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.41852259", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.00954667", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.31344918", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.91992173", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.43361873", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.02884067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.17822956", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.9587973", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.6585315", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.02049425", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.63459419", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.82860108", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.83440947", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.20622755", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.0107774", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.16256668", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.55443291", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.11026371", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.6794979", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.1985369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.13952365", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.08355483", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.75859312", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.81314494", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.50316262", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.45124872", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.83077992", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.66202915", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.7879232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.06683116", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.88199368", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.82850451", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.94730904", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.76070148", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.009178", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.71346467", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.07688372", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.63886045", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.07898668", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.8697191", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.88186914", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.48420487", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.04488765", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.12983841", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.1270059", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.10449284", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.37718568", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.78698365", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.6486216", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.36692108", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.5159673", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.65731788", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.89729714", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.53211586", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.45584033", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.70100644", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.34477497", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.23465058", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.83591025", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.61035248", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.16256536", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.4868892", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.87661907", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.79091706", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.04959308", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.03091834", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.74197499", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.27340638", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.73681365", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.75820178", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.51705966", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.13614404", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.46609326", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.0790463", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.25307353", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.01828487", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.68827435", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.4953174", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.53258526", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.39906809", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.68788432", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.75948776", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.66916346", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.38482533", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.08948616", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.6298733", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.90942488", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.96497336", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.01223833", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.29952515", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.92492395", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.89497577", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.52983854", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.62564446", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.58940773", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.12239079", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.70295254", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.76555798", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.84141026", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.47806837", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.52820959", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.73083789", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.25936956", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.32101079", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.66328371", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "17.15023319", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.97322621", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.99641023", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.62154942", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.88896763", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.89308446", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.51440301", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.85116145", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.73002288", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.87626843", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "16.66064743", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11279-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G27126ED", "abundance": "14.95025802", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.9960297", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.63006612", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.13005961", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.23301916", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.36530493", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75235418", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.12616431", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.98843316", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "10.32853064", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.50734629", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.81072427", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.369056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.01880317", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.80754231", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.54949255", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.10587657", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.51699033", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76625855", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "10.82119515", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41817122", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.63166136", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.97534443", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.24435796", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.10492782", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53831483", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.41426586", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "10.92631616", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.25033034", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.2147756", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.71848727", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.50303081", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.80175964", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "1.281827631", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "2.043009496", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.7697168", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78860434", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70352823", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82625504", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.530629", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.91701681", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71407158", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.97275878", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.88484731", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.14135415", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.52725731", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.03777135", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "18.67442834", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "18.57990862", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "16.23063866", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.12678641", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53516839", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45061665", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77759591", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.80243041", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42727698", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.33473393", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.90544163", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.46060413", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "10.936412", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.06697393", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.6184172", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.60631501", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.40808432", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "10.79183926", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.09489146", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.26418175", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.94306017", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.34055565", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.21409834", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94642589", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.69239821", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.69593927", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06060576", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.46913524", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.88953195", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.16295454", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.17694139", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.01970408", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.89607019", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.02683946", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.29294263", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.55773519", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.84054086", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.62611636", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.174571", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.27909242", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.50432573", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.65799987", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.90795166", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.45623682", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.41708342", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.44862635", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.94379788", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.08968239", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.75547455", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.7110023", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.28103482", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.60436331", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.23187405", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.02790171", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.71343064", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.97290401", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33121353", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.0409387", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3851874", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.44747904", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "15.97431689", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.50258492", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.16383217", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.31979207", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.26644392", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.9429051", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.67602132", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.55178069", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.22053728", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81794823", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "11.66388133", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.65701421", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.6086705", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.69035387", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.50601867", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41579119", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.90588352", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "12.85092921", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "14.75513465", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07996-1", "residue": "Asn", "start_pos": 360, "end_pos": 360 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.55443703", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.49564311", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90583156", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.27523278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.4730955", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94797685", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.55504525", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.41923422", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85849975", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.30816511", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.04255364", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.77412884", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "16.39486194", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.96410683", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.26261494", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60476259", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.23568278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.25562453", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.93207588", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.24358443", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.35008012", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.14434974", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.50891726", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.48741689", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.16900314", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.15030762", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.77420079", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.92178841", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.93977645", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.14626237", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.69099525", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.9724492", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.72347543", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.6332134", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22948168", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.35335534", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.50263022", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.28891265", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.59180051", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.25740881", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.99730785", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.28229949", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.8439185", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79236199", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.02152193", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6372989", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.18781118", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22556382", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.73405724", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.46169656", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.10539651", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.1037097", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.29841762", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.53561009", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22029071", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.61313849", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.97850765", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "13.55955987", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "13.26689667", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80848503", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75253148", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07235157", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "12.94022158", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.30126609", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8644609", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.18116364", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48053569", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90431204", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82573988", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.10080437", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08023386", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.4622625", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.42363507", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.13561066", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.07555674", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.30056816", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71108358", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.06282633", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.02240625", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "15.33768081", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "14.92581867", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "18.33782493", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07339-1", "residue": "Asn", "start_pos": 263, "end_pos": 263 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "14.8180897", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "15.21080865", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "15.14970243", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "14.62902551", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82807014", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "14.83577239", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "15.35265426", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "15.41820242", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "15.52836236", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 315, "end_pos": 315 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08424872", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6665665", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.64806089", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84839638", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98715903", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.29633786", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40079034", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45939744", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60749447", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27730484", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.89493281", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.25462507", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72423833", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94453979", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.64801517", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "14.26706336", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "13.87524063", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q08722-1", "residue": "Asn", "start_pos": 73, "end_pos": 73 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71460049", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.56288623", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84011513", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44073117", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.63096556", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.32863624", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93180371", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.50380302", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.318352", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.08017175", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96428989", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84295264", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42180675", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.70808937", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.02263342", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77144306", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7039825", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.32428845", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.38843771", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "12.84139549", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.17799303", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.66156038", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.68201955", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74575722", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.56361025", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49444382", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02745-1", "residue": "Asn", "start_pos": 146, "end_pos": 146 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88704907", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.38607384", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.53635395", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.10532901", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.31759659", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.15144115", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.47104341", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.5878068", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71375448", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78251978", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.88002805", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.02750036", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.15202217", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.06259596", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.74548965", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.25786116", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.683532", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.28752668", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.75640915", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08987924", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90389287", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41646278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.40683581", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.38140587", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22986258", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82361643", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18122637", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70225563", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.02282044", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.03368709", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79126701", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6004692", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.57034719", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.51430361", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.80983568", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.44273326", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.51555138", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.77146108", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41716959", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.614301", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.20222924", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.56063429", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.04458649", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.36842912", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.69249307", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.97655053", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.37685124", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.55610632", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.48362256", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.14380161", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.51128881", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.32120113", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.04389742", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6761902", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.29621103", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.53926185", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.03125595", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.58618035", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.34292196", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.49322506", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.38673934", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.96360118", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.25440974", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "16.07869465", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.3745509", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.36060467", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.67801127", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.7775054", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.23441851", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.36040657", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.75632785", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.8082191", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.8035601", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.98113309", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.66355086", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3632229", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.1759851", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.45839783", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.50991517", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.84507489", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.02814059", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.44421739", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.27280837", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.85794871", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.83665959", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.73912279", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55656385", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37405116", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60374712", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.46795975", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.75632942", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.74713498", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85576579", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05547855", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08514187", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23648516", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.69205374", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.00963952", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15583932", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "13.08808071", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.33006361", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.574803", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.92424882", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.48644151", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.72808278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.14312586", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.59998234", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90333085", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.97261232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.67105613", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.58996683", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82842841", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.99423265", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.4367401", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.00889758", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6355675", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.96015608", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.6234241", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.28176453", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23592873", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.31478533", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.52885866", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18075169", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19785765", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78992672", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60911643", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70518537", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.47972033", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57415382", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.96208345", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71783412", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.01916036", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.60132109", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06314166", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.63642579", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85976637", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.25726723", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94365014", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.67980407", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.10734376", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.19188521", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.77708138", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.00205475", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.57935124", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08236767", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71757908", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.15548652", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79506613", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.91558494", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.25662928", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.03827596", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.49297661", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22797258", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.91832226", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.30297745", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22206841", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.38290517", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "16.03977686", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.4619781", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94260268", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79082743", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.72963758", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.67917712", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.40329324", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.7266169", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22447697", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.75468355", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.16173054", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.19486613", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.69243051", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94114596", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.48797419", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "15.5375621", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85364262", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.98184066", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.44832129", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "14.73007486", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.04559817", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.69357657", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.75444821", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81942649", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.35387369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27817431", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.51327665", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27921752", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53744962", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.81157422", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96126386", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.40961931", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64960804", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.24463443", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27775944", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.06946609", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.13543447", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.06919802", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.00043264", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.2392083", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.0982438", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.32939481", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.85050961", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82143215", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.51274728", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.98487587", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80979028", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53548307", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49023579", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.84363921", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.60907235", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.5064421", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.38333192", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44038993", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.40669232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11303513", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.08246654", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.39813029", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44272533", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "15.12177035", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.11161599", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.92090627", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73782686", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.63894481", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.35266035", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40311934", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95960802", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.28460685", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "14.4689507", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93421482", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.48475514", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.87935554", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78839834", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74365939", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.37726772", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "12.98563797", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44671609", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79479082", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6909678", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.9683654", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7558911", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 1093, "end_pos": 1093 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.66227734", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "13.83084419", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "13.9256935", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.22226615", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45589335", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.34132622", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.26808295", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15352484", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.00312228", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "13.97885328", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.36996225", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.30271317", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.2811543", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "13.97910896", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13678135", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.869681", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.43191152", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78446992", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD2-1", "residue": "Asn", "start_pos": 474, "end_pos": 474 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.38722581", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.41270557", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.89377279", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.69668285", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "12.10177263", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.34103288", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.66189427", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.81117365", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.09656726", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.12589966", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.59909138", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "9.816354688", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.84604663", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.44176105", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "17.97014191", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "22.72952604", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "22.11637805", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "20.19491512", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "23.8087326", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "20.56693257", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "21.61410473", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "22.90251558", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.6150742", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.62119297", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.1265358", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96330278", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "12.82772983", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.59507244", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.60629112", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.17548779", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.59203697", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.00863576", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.4318483", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.59116487", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.27388261", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "10.63628913", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.99619234", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "11.81837067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24821-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03407232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.67375326", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.34571329", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.54110082", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11331725", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48813717", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99592342", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94724921", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74307196", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.29135371", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.59879332", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.06640144", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.43316312", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19547126", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.4396557", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.09221175", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44868426", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31428226", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07324054", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98066282", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03666139", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15293119", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.00549098", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.707872", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.00864513", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.25684581", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.57511339", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79894742", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.37225209", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.16036864", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.9100735", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73742424", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.12377373", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6178352", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77079225", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6203866", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.29621588", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.8442345", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10295246", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71105962", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49715108", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.52168324", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.5827748", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14948498", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.87059494", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73338527", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96048695", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76211408", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81062282", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.67482605", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7801867", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27490597", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42558023", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21806314", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.92581521", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.00205932", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79669359", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.92073867", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.87536021", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45284781", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.61986732", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.14990971", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44883599", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72058157", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.43102906", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.24845625", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.50189736", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94434974", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03860359", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45816198", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.16842262", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88621449", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.00536239", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.04009054", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05486254", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.61036783", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76014571", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93358114", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71291934", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.43758676", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.57104067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.7950726", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03472539", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.85383928", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6725905", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79122765", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.28083583", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.66503287", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.59909463", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.83270444", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64157306", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.04813499", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.81216369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.48792956", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.39726698", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.51904132", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.57688273", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.46321117", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.54584299", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.03490931", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45085198", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40210476", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40096294", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.89851095", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84558388", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.24282612", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96752489", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78549184", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6555237", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45037775", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.55887397", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7773477", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73446155", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.96964296", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84546719", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06108266", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.28754997", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.16704055", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.08195337", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75597696", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80476378", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.08073319", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.67607251", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.62853255", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.2760842", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18714484", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.24019437", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.17118068", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94615178", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78300913", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.67345344", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.30963125", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10692711", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07849468", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93574393", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.92015966", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.04616833", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06749991", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14641354", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78999771", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.43819762", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.96752022", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "11.93337274", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.86673101", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.41322717", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.27523128", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.70399741", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05336265", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "12.8833746", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75643156", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76607929", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64713391", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.47048288", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99590095", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.69429034", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.40405742", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53755736", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.90937721", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96898763", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.47637005", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.66627056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91196429", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.64062912", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10284355", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31395707", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18794966", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33029927", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77054351", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.01044349", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.26365646", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79689664", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05409486", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13449203", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74843934", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98466505", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42247443", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23974822", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.86635947", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.22009223", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.11011742", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.56702589", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6320856", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.97762098", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.82821927", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.2214809", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.50384222", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10159383", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73779214", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.17066664", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.61630359", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13795507", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.68397947", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.90428697", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80949323", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "10.08013575", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "11.54564823", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "11.76368469", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "10.1596067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "10.300539", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "13.18612335", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "12.70842121", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "11.614186", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "10.9356151", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "11.11572629", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "10.79635787", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "12.02430877", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "10.43358623", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "11.55352526", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "11.36221417", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "10.61079512", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "12.82331892", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q16363-1", "residue": "Asn", "start_pos": 104, "end_pos": 104 }, { "glytoucan_ac": "G27126ED", "abundance": "14.5456654", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27089825", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "16.03614209", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.0954322", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "16.45793299", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.03259361", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.39744956", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.34111864", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.99057909", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57649725", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.05443618", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.75312044", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85207291", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.25776785", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85772037", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "17.31913035", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.18127556", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.96395747", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.19631308", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99320522", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "16.37379012", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79634492", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "16.0903318", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11504712", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55277337", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.47783106", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.19467885", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.670299", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.83489695", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.72262887", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94944693", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13762124", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08497183", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90569256", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.98430015", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.98928629", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70301548", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.23001429", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.00551851", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.45943762", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.78091365", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.0902933", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22518933", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "16.75613109", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.80249232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.8545153", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57636748", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.244972", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.38981814", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.56729471", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.83935328", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79639303", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.75833979", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.93064456", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.47281681", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.00191683", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.68812075", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.18503232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48101447", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6169215", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45782926", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.94159233", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.89707125", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79944104", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "18.00264332", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.4640623", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.33258188", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.26603777", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.3574679", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.61546883", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.83211835", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.50474005", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.12867246", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.8888177", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.4581084", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.1790985", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.19753515", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.3399868", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.09127989", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78650276", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.9266101", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.30375294", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33931556", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31905802", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.46075251", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.59977251", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.83865606", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.16655891", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08773148", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.84401068", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.81522352", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05362-1", "residue": "Asn", "start_pos": 406, "end_pos": 406 }, { "glytoucan_ac": "G27126ED", "abundance": "14.30591032", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40990165", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "16.5388514", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33714047", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.88112962", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85267156", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60107895", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.5586057", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41570854", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6442092", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "13.25721496", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "13.62230275", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71775675", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.61862218", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74389008", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31955447", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "15.12818542", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G27126ED", "abundance": "13.08914768", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.73699556", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.6409746", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.24760588", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.62838158", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.05554247", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.32771627", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45717971", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "13.04589652", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13987-1", "residue": "Asn", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10848962", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "14.62326806", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "14.75416336", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93046682", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41584271", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74192409", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75223447", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91111211", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G27126ED", "abundance": "13.50700596", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.315814", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.5348598", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.70533982", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48143631", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.4352846", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.62598682", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.89192464", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.28764581", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95578164", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13676338", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.92168149", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.23526824", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.62157142", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14625465", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7753467", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33959868", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.29300374", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45854043", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.62254815", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.92648693", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.10558265", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.67549295", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64283971", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.15975728", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.61858397", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82599935", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06633752", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.80056787", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.50314563", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84522526", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7416366", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37374448", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.52936994", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.56338946", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64970607", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71070353", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05035498", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.05693666", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27841364", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.69985376", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.30859864", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.45574033", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.04637126", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41318656", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.17168825", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.59737354", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14084818", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06510918", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42402509", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.77077793", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.57245212", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.97357239", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.83524022", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.43314134", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.75354586", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.87948145", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11092759", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.26185375", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.79494855", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42938651", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.46055411", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.01431723", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.69626884", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.67496546", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.56427032", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08387009", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.46108635", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93195486", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21177263", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31371877", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.89140434", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40051371", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11082685", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18707143", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33652872", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98622263", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.23325586", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57965652", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.55793965", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.26085916", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99500891", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.61941232", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.57964776", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72916323", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.78857528", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.97880597", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48044574", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64014793", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.48157747", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.19437725", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.40619735", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15081964", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45038221", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.43754043", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76685557", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.35854073", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "15.07842211", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.50432375", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.9836659", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.4464628", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.57646495", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93667852", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13365843", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95154475", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.21843056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.8620939", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.01033645", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90396262", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.34550939", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94361821", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72602095", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48284957", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57131797", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88731023", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.94467027", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.27259642", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57856416", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.48936882", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98357501", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40484332", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44565248", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81730925", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.67902438", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.85222351", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6016961", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7077409", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.71226062", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.61962628", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.49447396", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.56428845", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.21394523", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.61950199", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.65642297", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "12.27497804", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "13.12811771", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04114-1", "residue": "Asn", "start_pos": 3224, "end_pos": 3224 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.20643283", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.86274207", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.18316314", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91105426", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.63259334", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27199849", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55067912", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.92107272", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.53515883", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14934653", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.48817392", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.36763117", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31040056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.33112125", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.9465673", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14994992", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.02229652", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.77573195", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.31724469", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.9240087", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.29844121", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15025716", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.39240434", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.30328871", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.13781663", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.07458884", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.61463437", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64501388", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.85514106", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.76862671", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.53346649", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.35255119", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.3596587", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.83546613", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "15.36173477", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.47660646", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27862829", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.82174734", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.77294623", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.77708219", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98053742", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.29011034", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55422542", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08261468", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "16.32207319", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.99995656", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.91195529", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "15.25862736", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96313727", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78203698", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.8330719", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.64378177", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78350637", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.08947385", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "14.32778145", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98476643", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "15.50947393", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P07602-1", "residue": "Asn", "start_pos": 332, "end_pos": 332 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "17.17782904", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "4.867694066", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.4980652", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.96444549", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.61454731", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.65142431", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.06800317", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.0030672", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.02064217", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.65570259", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.23525762", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.10450016", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.68341407", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.79158383", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93230279", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.70888555", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "12.41169245", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "12.93176237", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.97750354", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "17.67505634", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.16328457", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.35766997", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.84717411", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.52073934", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.77742782", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.87311433", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.58228058", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.97433157", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.40401117", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.03306681", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7645016", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.5209209", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27554861", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.88477067", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.34573257", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.54820537", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.41586878", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.84176108", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.95080396", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.79838299", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.4594641", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.88233468", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.69329469", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.80032606", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22669605", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.11332471", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.95450695", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71303059", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.44890267", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.91279031", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.30297215", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70646271", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.91853513", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78530249", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.80380938", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.54909642", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.15629108", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.01308735", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.80939277", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.14975687", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.63251065", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.58390369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.06676037", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "13.81027177", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.81647053", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.84470461", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.96897313", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.36732914", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.16086587", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.60620854", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.33640194", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.53799051", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.84986402", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.59824509", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.11254784", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.06910395", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.22803426", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.76222375", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.03553967", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.51236853", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.71579133", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.86618379", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.85452168", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.38001477", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.36527622", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.81275686", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.98871718", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "15.77707066", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "16.11505779", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "14.63103612", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9GZM7-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "15.46162119", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "14.41626243", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "14.72752699", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "13.96631956", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "14.93286097", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "14.95391297", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "15.31358007", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "15.04281866", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08962-1", "residue": "Asn", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45309517", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.12400343", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "12.59695134", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.68796998", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.78582462", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.78197077", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.17972237", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.98901959", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.58466946", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.83097699", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.36572705", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.59446512", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.16815063", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72446031", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "13.29069225", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42293155", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.44020492", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37223854", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P11047-1", "residue": "Asn", "start_pos": 1241, "end_pos": 1241 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "13.93894535", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15399339", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "14.20280339", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "13.70205589", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "13.91655176", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "13.55467717", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "13.80531781", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "14.01124074", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q93070-1", "residue": "Asn", "start_pos": 257, "end_pos": 257 }, { "glytoucan_ac": "G27126ED", "abundance": "17.22997159", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45002004", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.51751851", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "18.31001733", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.27158218", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85758362", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.47867279", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.33525598", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.43482812", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.32285511", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.35551046", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.99686968", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.00553063", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.30341613", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.70132695", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.51427535", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.17353077", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.54683197", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21203968", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.10583653", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "16.02159541", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "17.67129933", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55018769", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08285668", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.59069348", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.7128107", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.68682954", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.72915399", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.01635785", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.7873688", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.32139703", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.74433666", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.08777178", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.53240425", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.37490752", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.57951869", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.63942997", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.91884132", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.34369292", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.51671442", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.75282558", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.42866253", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85463867", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.55092134", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.24022617", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.5627518", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.92363861", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.65172138", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.8882982", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "16.94039641", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.92475568", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.99028075", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.80176002", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.49263917", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.85866881", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.92176379", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "15.06565654", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.21038686", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.95634558", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "13.84996601", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.04079347", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.37124089", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.4889721", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.15656189", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.68866612", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.14717647", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.61466784", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "14.62809788", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "18.85410577", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04275-1", "residue": "Asn", "start_pos": 2546, "end_pos": 2546 }, { "glytoucan_ac": "G27126ED", "abundance": "10.17350469", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "11.75736702", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "12.08251241", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "11.910165", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "13.42772718", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "13.32343064", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "13.01218449", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "13.74142825", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "12.92526246", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 81, "end_pos": 81 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "11.3767027", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "11.45553061", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "11.10226718", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "11.60283513", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "11.69788446", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "12.16344657", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "11.59090855", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "11.28089233", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P98160-1", "residue": "Asn", "start_pos": 1755, "end_pos": 1755 }, { "glytoucan_ac": "G27126ED", "abundance": "13.07502991", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "14.11674523", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.59814088", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "12.89514303", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.87081525", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72727976", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.52868048", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "12.55935942", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.35686008", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.11071691", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.45182063", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.48491165", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.72351056", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.88487369", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.17507479", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "13.89238605", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10619-1", "residue": "Asn", "start_pos": 145, "end_pos": 145 }, { "glytoucan_ac": "G27126ED", "abundance": "14.42115556", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90151342", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.81152188", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.81500273", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.40956656", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.20014894", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.54152547", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.66403004", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.98803226", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.21535306", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.6746578", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.32418735", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.62946488", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.75896722", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.34109869", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.87139433", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.15872707", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.90287241", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.20757243", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.13754759", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.71759931", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.95678363", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.23163753", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.03487166", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "16.36943038", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "16.05529446", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.7891511", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.84173469", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "14.77862492", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G27126ED", "abundance": "15.41289392", "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 } ] } }