{
  "algorithm": {
    "$id": "http://example.com/example.json",
    "type": "object",
    "properties": {
      "name": {
        "$id": "/properties/name",
        "type": "string",
        "description": "name of the program use for alignmnet algorithm.",
        "examples": ["CLUSTALO"]
      },
      "url": {
        "$id": "/properties/url",
        "type": "string",
        "description": "url of the program use for alignmnet algorithm.",
        "examples": ["https://www.genome.jp/tools-bin/ete"]
      },
      "parameter": {
        "$id": "/properties/url",
        "type": "string",
        "description": "parameter used of the program use for alignmnet algorithm.",
        "examples": [
          "The default transition matrix is Gonnet, gap opening penalty is 6 bits, gap extension is 1 bit. Clustal-Omega uses the HHalign algorithm and its default settings as its core alignment engine. The algorithm is described in Söding, J. (2005) 'Protein homology detection by HMM–HMM comparison'. Bioinformatics 21, 951-960"
        ]
      }
    }
  },
  "date": {
    "$id": "/properties/url",
    "type": "string",
    "description": "date of the program use for alignmnet algorithm.",
    "examples": ["2019-06-13"]
  },

  "protein name": {
    "$id": "/properties/protein name",
    "type": "string",
    "description": "ID of the protein using Uniprot entry name.",
    "examples": ["SHBG_HUMAN"]
  },
  "uniprot_canonical_ac": {
    "$id": "/properties/uniprot_canonical_ac",
    "type": "string",
    "description": "Accession ID of the protein using Uniprot entry ID",
    "examples": ["P04278"]
  },
  "sequences": {
    "$id": "/properties/sequences",
    "type": "array",
    "description": "List of sequences objects.",
    "items": {
      "$id": "/properties/sequences/items",
      "type": "object",
      "description": "sequences object that stores the uniprot name, uniprot ac and sequence. The objects refers to an entry on another database that provided this taxonomical annotation.",
      "properties": {
        "protein name": {
          "$id": "/properties/protein name",
          "type": "string",
          "description": "ID of the protein using Uniprot entry name.",
          "examples": ["SHBG_HUMAN"]
        },
        "uniprot_canonical_ac": {
          "$id": "/properties/uniprot_canonical_ac",
          "type": "string",
          "description": "Accession ID of the protein using Uniprot entry ID",
          "examples": ["P04278"]
        },
        "sequence":{
            "$id":"/properties/sequence/properties/sequence",
            "type":"string",
            "description":"Amino acid sequence of the protein.",
            "default":"",
            "examples":[
               "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQ"
            ]
         }
      }
    }
  },
  "alignment": {
    "$id": "/properties/alignment",
    "type": "string",
    "description": "aligned sequence of the program use for alignmnet algorithm.",
    "examples": ["***********************************************************************************************************************************************"
        ]
  },
  "identical position": {
    "$id": "/properties/identical position",
    "type": "number",
    "description": "identical position in % of seq using the program  alignmnet algorithm.",
    "examples": [141]
  },
  "identity": {
    "$id": "/properties/iidentity",
    "type": "string",
    "description": "identity of position in % of seq using the program  alignmnet algorithm.",
    "examples": ["48.621%"]
  },
  "similar position": {
    "$id": "/properties/similar position",
    "type": "number",
    "description": "similar position of the program use for alignmnet algorithm.",
    "examples": [0]
  }

}