[
    {
        "ts": "2020-08-17 00:05:24 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G63337SS"
    }, 
    {
        "ts": "2020-08-17 00:11:31 ", 
        "page": "glycoprotein_search.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 00:11:49 ", 
        "page": "glycoprotein_search.html", 
        "user": "Undecided", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 00:11:50 ", 
        "page": "glycoprotein_search.html", 
        "user": "Undecided", 
        "message": "Advanced Search: no result found for query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPAAAASVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTHHHHHH\"}", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 00:23:11 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 00:23:21 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "Performing Simplified Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 00:23:22 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "Simplified Search: no result found for query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"(HexNAc)1 (Deoxyhexose)1 + (Man)3(GlcNAc)2\",\"term_category\":\"glycan\"}", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 00:29:38 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 00:29:42 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "P25063"
    }, 
    {
        "ts": "2020-08-17 00:29:42 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught ReferenceError: formatSequence is not defined\nurl: https://glygen.org/js/protein_detail.js\nline: 33", 
        "type": "error", 
        "id": "P25063"
    }, 
    {
        "ts": "2020-08-17 00:34:51 ", 
        "page": "glycoprotein_search.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 01:39:09 ", 
        "page": "index.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 01:41:55 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 02:52:05 ", 
        "page": "protein", 
        "user": "vopiirhf2mnuwn4lxzu68cblb1m12s4p", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 02:52:05 ", 
        "page": "protein", 
        "user": "vopiirhf2mnuwn4lxzu68cblb1m12s4p", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 02:52:10 ", 
        "page": "home", 
        "user": "vopiirhf2mnuwn4lxzu68cblb1m12s4p", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 02:52:10 ", 
        "page": "home", 
        "user": "vopiirhf2mnuwn4lxzu68cblb1m12s4p", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 02:53:10 ", 
        "page": "glycan-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 02:53:10 ", 
        "page": "glycan-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 02:55:23 ", 
        "page": "glycan-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 02:55:23 ", 
        "page": "glycan-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 03:23:46 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G86718YQ"
    }, 
    {
        "ts": "2020-08-17 03:33:08 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 03:33:09 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "P20908"
    }, 
    {
        "ts": "2020-08-17 04:04:24 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q92673"
    }, 
    {
        "ts": "2020-08-17 04:10:32 ", 
        "page": "index.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 04:19:52 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 04:19:53 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G22490RY"
    }, 
    {
        "ts": "2020-08-17 04:40:48 ", 
        "page": "protein_detail.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 04:40:49 ", 
        "page": "protein_detail.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "successful response", 
        "type": "user", 
        "id": "P15144"
    }, 
    {
        "ts": "2020-08-17 04:42:34 ", 
        "page": "global_search_result.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 04:42:40 ", 
        "page": "global_search_result.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "successful search", 
        "type": "user", 
        "id": "Q7Z407"
    }, 
    {
        "ts": "2020-08-17 04:42:50 ", 
        "page": "protein_list.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 04:42:50 ", 
        "page": "protein_list.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "660dec33ac3d1617a05f98da27145e0d"
    }, 
    {
        "ts": "2020-08-17 04:43:16 ", 
        "page": "protein_detail.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 04:43:17 ", 
        "page": "protein_detail.html", 
        "user": "rbvei1t0ypoz4ws3exy25m9p39ut0j3d", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q7Z407-1"
    }, 
    {
        "ts": "2020-08-17 04:45:52 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 04:45:52 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G22490RY"
    }, 
    {
        "ts": "2020-08-17 05:13:26 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 05:13:27 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G47203JO"
    }, 
    {
        "ts": "2020-08-17 05:17:23 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G80384UV"
    }, 
    {
        "ts": "2020-08-17 05:17:24 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G80384UV"
    }, 
    {
        "ts": "2020-08-17 05:33:09 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 05:33:12 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "P01876"
    }, 
    {
        "ts": "2020-08-17 05:41:06 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G01378OV"
    }, 
    {
        "ts": "2020-08-17 05:41:07 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G01378OV"
    }, 
    {
        "ts": "2020-08-17 05:42:08 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "Q9Z2Y2"
    }, 
    {
        "ts": "2020-08-17 05:42:09 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q9Z2Y2"
    }, 
    {
        "ts": "2020-08-17 05:44:18 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G68544GH"
    }, 
    {
        "ts": "2020-08-17 05:44:19 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G68544GH"
    }, 
    {
        "ts": "2020-08-17 05:46:48 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:46:49 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "500: non-existent-record", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:47:38 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:47:39 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "500: non-existent-record", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:47:47 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:47:48 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "500: non-existent-record", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:48:04 ", 
        "page": "global_search_result.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:48:09 ", 
        "page": "global_search_result.html", 
        "user": "Undecided", 
        "message": "successful search", 
        "type": "user", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:48:16 ", 
        "page": "protein_list.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 05:48:17 ", 
        "page": "protein_list.html", 
        "user": "Undecided", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "7a12f56c4c823219debdd3eb98721910"
    }, 
    {
        "ts": "2020-08-17 05:48:28 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q6L8S8-1"
    }, 
    {
        "ts": "2020-08-17 05:48:29 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 05:49:51 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "Q6L9W6"
    }, 
    {
        "ts": "2020-08-17 05:49:51 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q6L9W6"
    }, 
    {
        "ts": "2020-08-17 06:31:00 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "P30556"
    }, 
    {
        "ts": "2020-08-17 07:05:33 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 07:05:40 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "Performing Simplified Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 07:05:41 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "Simplified Search: Searched with modified parameters", 
        "type": "user", 
        "id": ">da4a46e9c17f29a221d75b84c7a36fdd"
    }, 
    {
        "ts": "2020-08-17 07:05:46 ", 
        "page": "glycan_list.html", 
        "user": "Undecided", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "da4a46e9c17f29a221d75b84c7a36fdd"
    }, 
    {
        "ts": "2020-08-17 07:05:46 ", 
        "page": "glycan_list.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 07:11:02 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q5DX21"
    }, 
    {
        "ts": "2020-08-17 07:21:11 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 07:21:12 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G99897FQ"
    }, 
    {
        "ts": "2020-08-17 07:21:28 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 07:21:29 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q766D5"
    }, 
    {
        "ts": "2020-08-17 07:21:51 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 07:21:51 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "500: non-existent-record", 
        "type": "error", 
        "id": "A0A1D5RMF7"
    }, 
    {
        "ts": "2020-08-17 07:48:15 ", 
        "page": "index.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 30", 
        "type": "error", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 07:49:03 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Unable to get property 'style' of undefined or null reference\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "Q62351"
    }, 
    {
        "ts": "2020-08-17 07:49:03 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q62351"
    }, 
    {
        "ts": "2020-08-17 08:15:51 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 08:15:52 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G32550BI"
    }, 
    {
        "ts": "2020-08-17 08:18:14 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G75999PF"
    }, 
    {
        "ts": "2020-08-17 08:48:01 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 08:48:01 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G02425YO"
    }, 
    {
        "ts": "2020-08-17 09:24:50 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 09:24:50 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "P07355"
    }, 
    {
        "ts": "2020-08-17 10:26:26 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 10:26:27 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "P31648"
    }, 
    {
        "ts": "2020-08-17 10:27:37 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G30460NZ"
    }, 
    {
        "ts": "2020-08-17 10:40:00 ", 
        "page": "protein_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 10:40:00 ", 
        "page": "protein_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q9NPY3-1"
    }, 
    {
        "ts": "2020-08-17 10:52:54 ", 
        "page": "global_search_result.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "ace2"
    }, 
    {
        "ts": "2020-08-17 10:52:59 ", 
        "page": "global_search_result.html", 
        "user": "Undecided", 
        "message": "successful search", 
        "type": "user", 
        "id": "ace2"
    }, 
    {
        "ts": "2020-08-17 10:53:11 ", 
        "page": "protein_list.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 10:53:12 ", 
        "page": "protein_list.html", 
        "user": "Undecided", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "a027030c3991b84b8a709251b4f5525b"
    }, 
    {
        "ts": "2020-08-17 10:53:24 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "ace2"
    }, 
    {
        "ts": "2020-08-17 10:53:25 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q9BYF1-1"
    }, 
    {
        "ts": "2020-08-17 11:04:26 ", 
        "page": "about.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:06:08 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "Q9BYF1-1"
    }, 
    {
        "ts": "2020-08-17 11:06:09 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q9BYF1-1"
    }, 
    {
        "ts": "2020-08-17 11:08:19 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:08:20 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q9BYF1-1"
    }, 
    {
        "ts": "2020-08-17 11:25:14 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:25:17 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G89719WD"
    }, 
    {
        "ts": "2020-08-17 11:29:09 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:29:10 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q9BXJ8"
    }, 
    {
        "ts": "2020-08-17 11:33:28 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:33:29 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:33:33 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:33:33 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:33:39 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:33:40 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"mass_type\":\"Native\",\"enzyme\":{},\"glytoucan_ac\":\"G17689DH\",\"glycan_type\":\"\",\"glycan_subtype\":\"\",\"protein_identifier\":\"\",\"glycan_motif\":\"\",\"pmid\":\"\"}", 
        "type": "user", 
        "id": ">36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 11:33:41 ", 
        "page": "glycan-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:33:41 ", 
        "page": "glycan-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 11:33:47 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:33:47 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 11:37:07 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 11:37:08 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:37:10 ", 
        "page": "about.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:40:12 ", 
        "page": "glygen_settings.html", 
        "user": "ixahbsgh0byuay5pohbmdv13bn30m92k", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:40:12 ", 
        "page": "glygen_settings.html", 
        "user": "ixahbsgh0byuay5pohbmdv13bn30m92k", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:40:12 ", 
        "page": "glygen_settings.html", 
        "user": "ixahbsgh0byuay5pohbmdv13bn30m92k", 
        "message": "JS Error: TypeError: $(...).reset is not a function\nurl: https://glygen.org/js/glygen_settings.js\nline: 36", 
        "type": "error", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:40:28 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G74840NI"
    }, 
    {
        "ts": "2020-08-17 11:40:31 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G74840NI"
    }, 
    {
        "ts": "2020-08-17 11:40:33 ", 
        "page": "quick_search.html", 
        "user": "ixahbsgh0byuay5pohbmdv13bn30m92k", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:41:20 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:41:20 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 11:41:28 ", 
        "page": "quick_search.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:43:04 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:43:04 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 11:43:30 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G20636FS"
    }, 
    {
        "ts": "2020-08-17 11:43:32 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G20636FS"
    }, 
    {
        "ts": "2020-08-17 11:45:48 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:45:48 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 11:46:34 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:46:34 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 11:47:17 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:47:17 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:47:55 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:47:55 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:47:58 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:47:58 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:17 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:18 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 11:48:18 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 11:48:18 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:22 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:22 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:48:34 ", 
        "page": "Siteview", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:34 ", 
        "page": "Siteview", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:48:44 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:44 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G57789QC"
    }, 
    {
        "ts": "2020-08-17 11:48:49 ", 
        "page": "motif", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:49 ", 
        "page": "motif", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G00030MO"
    }, 
    {
        "ts": "2020-08-17 11:48:57 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:48:57 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G00012RZ"
    }, 
    {
        "ts": "2020-08-17 11:49:17 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:49:17 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:49:22 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:49:23 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 11:49:24 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 11:49:24 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:49:29 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:49:29 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:49:51 ", 
        "page": "alignment", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:49:51 ", 
        "page": "alignment", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:50:00 ", 
        "page": "quick-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:50:01 ", 
        "page": "quick-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:50:14 ", 
        "page": "how-to-cite", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:50:15 ", 
        "page": "how-to-cite", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:50:26 ", 
        "page": "resources", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:50:27 ", 
        "page": "resources", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:04 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:05 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:08 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:09 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:12 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:13 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 11:55:14 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 11:55:14 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:17 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:55:17 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:32 ", 
        "page": "Siteview", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:55:32 ", 
        "page": "Siteview", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:37 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:55:37 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:55:55 ", 
        "page": "alignment", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:55:55 ", 
        "page": "alignment", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:56:06 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:56:06 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:56:14 ", 
        "page": "glycan-search", 
        "user": "u54b4mpu2vwjp5f83wokkee0jxkvx0ht", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:56:14 ", 
        "page": "glycan-search", 
        "user": "u54b4mpu2vwjp5f83wokkee0jxkvx0ht", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:56:15 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 11:56:15 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 11:59:57 ", 
        "page": "global_search_result.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:00:03 ", 
        "page": "global_search_result.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful search", 
        "type": "user", 
        "id": "P0DTC2-1"
    }, 
    {
        "ts": "2020-08-17 12:00:08 ", 
        "page": "protein_list.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:00:10 ", 
        "page": "protein_list.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "f1e212a92eb26c899e19c3179a03f5dc"
    }, 
    {
        "ts": "2020-08-17 12:00:15 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:00:16 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P0DTC2-1"
    }, 
    {
        "ts": "2020-08-17 12:03:00 ", 
        "page": "global_search_result.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:03:04 ", 
        "page": "global_search_result.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful search", 
        "type": "user", 
        "id": "P00533-1"
    }, 
    {
        "ts": "2020-08-17 12:03:29 ", 
        "page": "protein_list.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:03:30 ", 
        "page": "protein_list.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "91d9216230c2d26ea0f9793ab3f9a9fe"
    }, 
    {
        "ts": "2020-08-17 12:03:51 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:03:51 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P00533-1"
    }, 
    {
        "ts": "2020-08-17 12:05:00 ", 
        "page": "global_search_result.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:05:06 ", 
        "page": "global_search_result.html", 
        "user": "Undecided", 
        "message": "successful search", 
        "type": "user", 
        "id": "HIST1H2BE"
    }, 
    {
        "ts": "2020-08-17 12:06:55 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:06:55 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:07:17 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:07:17 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:07:44 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:07:44 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:10:18 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G28330DZ"
    }, 
    {
        "ts": "2020-08-17 12:10:20 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G28330DZ"
    }, 
    {
        "ts": "2020-08-17 12:11:39 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:11:39 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:11:59 ", 
        "page": "Siteview", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:11:59 ", 
        "page": "Siteview", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:12:24 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "G57789QC"
    }, 
    {
        "ts": "2020-08-17 12:12:24 ", 
        "page": "glycan", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:12:34 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:12:34 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:12:36 ", 
        "page": "homolog_alignment.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:12:37 ", 
        "page": "homolog_alignment.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "Longest seq length=1212, Consensus length=1212", 
        "type": "error", 
        "id": "P00533-1"
    }, 
    {
        "ts": "2020-08-17 12:12:51 ", 
        "page": "protVista", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:12:51 ", 
        "page": "protVista", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:12:55 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:12:56 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:12:56 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:12:56 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P00533-1"
    }, 
    {
        "ts": "2020-08-17 12:13:07 ", 
        "page": "isoform_alignment.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:13:08 ", 
        "page": "isoform_alignment.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "Longest seq length=1245, Consensus length=1245", 
        "type": "error", 
        "id": "P00533-1"
    }, 
    {
        "ts": "2020-08-17 12:13:15 ", 
        "page": "protVista", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:13:15 ", 
        "page": "protVista", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:13:52 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:13:52 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:14:19 ", 
        "page": "alignment", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:14:19 ", 
        "page": "alignment", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:14:43 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:14:44 ", 
        "page": "glycan-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:06 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:07 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:07 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:08 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P00533-1"
    }, 
    {
        "ts": "2020-08-17 12:15:15 ", 
        "page": "protein_search.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:21 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:22 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 12:15:23 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 12:15:23 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:33 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:37 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:37 ", 
        "page": "protein-search", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 12:15:38 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 12:15:38 ", 
        "page": "protein-list", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:15:45 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": "P17945-1"
    }, 
    {
        "ts": "2020-08-17 12:15:45 ", 
        "page": "protein", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:17:10 ", 
        "page": "protein_search.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:17:11 ", 
        "page": "protein_list.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:17:12 ", 
        "page": "protein_list.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 12:17:15 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:17:16 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:17:20 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G27030ZC"
    }, 
    {
        "ts": "2020-08-17 12:17:21 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G27030ZC"
    }, 
    {
        "ts": "2020-08-17 12:18:17 ", 
        "page": "site_view.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:18:18 ", 
        "page": "site_view.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:18:59 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:19:00 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:19:17 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "JS Error: ResizeObserver loop completed with undelivered notifications.\nurl: \nline: 0", 
        "type": "error", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:19:20 ", 
        "page": "protein_detail.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "JS Error: ResizeObserver loop completed with undelivered notifications.\nurl: \nline: 0", 
        "type": "error", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:19:27 ", 
        "page": "protvista_index.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "JS Error: NotSupportedError: CustomElementRegistry.define: 'protvista-tooltip' has already been defined as a custom element\nurl: https://cdn.jsdelivr.net/npm/protvista-tooltip@latest/dist/protvista-tooltip.js\nline: 133", 
        "type": "error", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 12:19:27 ", 
        "page": "protvista_index.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "JS Error: NotSupportedError: CustomElementRegistry.define: 'protvista-tooltip' has already been defined as a custom element\nurl: https://cdn.jsdelivr.net/npm/protvista-tooltip@latest/dist/protvista-tooltip.js\nline: 133", 
        "type": "error", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 12:19:27 ", 
        "page": "protvista_index.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "JS Error: NotSupportedError: CustomElementRegistry.define: 'protvista-track' has already been defined as a custom element\nurl: https://cdn.jsdelivr.net/npm/protvista-track@latest/dist/protvista-track.js\nline: 1", 
        "type": "error", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 12:19:27 ", 
        "page": "protvista_index.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:19:28 ", 
        "page": "protvista_index.html", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:25:46 ", 
        "page": "glycan", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:25:46 ", 
        "page": "glycan", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": "G22747ZM"
    }, 
    {
        "ts": "2020-08-17 12:25:57 ", 
        "page": "glycan-search", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:25:58 ", 
        "page": "glycan-search", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:26:19 ", 
        "page": "protein-search", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:26:20 ", 
        "page": "protein-search", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:28:08 ", 
        "page": "protein-search", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:28:09 ", 
        "page": "protein-search", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 12:28:10 ", 
        "page": "protein-list", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:28:10 ", 
        "page": "protein-list", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": "3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 12:28:26 ", 
        "page": "protein", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:28:26 ", 
        "page": "protein", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 12:36:57 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 12:36:58 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "G82348BZ"
    }, 
    {
        "ts": "2020-08-17 12:37:10 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G02152MS"
    }, 
    {
        "ts": "2020-08-17 12:37:13 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G02152MS"
    }, 
    {
        "ts": "2020-08-17 12:49:00 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G80366RR"
    }, 
    {
        "ts": "2020-08-17 12:49:01 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G80366RR"
    }, 
    {
        "ts": "2020-08-17 13:08:28 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:08:28 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G00219VH"
    }, 
    {
        "ts": "2020-08-17 13:23:41 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:23:47 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "0: 0", 
        "type": "error", 
        "id": "G15768VA"
    }, 
    {
        "ts": "2020-08-17 13:26:25 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G22230QR"
    }, 
    {
        "ts": "2020-08-17 13:33:24 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G41107EH"
    }, 
    {
        "ts": "2020-08-17 13:33:24 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G41107EH"
    }, 
    {
        "ts": "2020-08-17 13:34:06 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:34:11 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "0: 0", 
        "type": "error", 
        "id": "G85903ZE"
    }, 
    {
        "ts": "2020-08-17 13:38:28 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G42058RF"
    }, 
    {
        "ts": "2020-08-17 13:38:30 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G42058RF"
    }, 
    {
        "ts": "2020-08-17 13:41:07 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:41:08 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:41:15 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:41:16 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 13:41:17 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:41:17 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 13:41:25 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:41:25 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:41:31 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:41:31 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:41:44 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:41:44 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:41:58 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:42:28 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:42:28 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:42:47 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:42:47 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:43:09 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:43:09 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:43:58 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:43:58 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:44:06 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:44:06 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G92241FG"
    }, 
    {
        "ts": "2020-08-17 13:44:17 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:44:17 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:44:54 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:44:54 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:45:23 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:45:23 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:45:49 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q7Z4J2"
    }, 
    {
        "ts": "2020-08-17 13:49:12 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:49:12 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:49:23 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:49:39 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:49:39 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:49:53 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: null is not an object (evaluating 'track_banner.style')\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "Q9WTS2"
    }, 
    {
        "ts": "2020-08-17 13:49:56 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q9WTS2"
    }, 
    {
        "ts": "2020-08-17 13:50:29 ", 
        "page": "glycan_search.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:50:54 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:50:54 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:50:59 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:00 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:04 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:04 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"mass_type\":\"Native\",\"enzyme\":{},\"glytoucan_ac\":\"G17689DH\",\"glycan_type\":\"\",\"glycan_subtype\":\"\",\"protein_identifier\":\"\",\"glycan_motif\":\"\",\"pmid\":\"\"}", 
        "type": "user", 
        "id": ">36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 13:51:05 ", 
        "page": "glycan-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:05 ", 
        "page": "glycan-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 13:51:08 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 13:51:08 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:25 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:26 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:29 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:51:30 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:51:30 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:43 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:51:43 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:53:15 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:53:17 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "G83009TH"
    }, 
    {
        "ts": "2020-08-17 13:54:14 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:54:14 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "G83009TH"
    }, 
    {
        "ts": "2020-08-17 13:54:14 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:54:15 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G11509RN"
    }, 
    {
        "ts": "2020-08-17 13:54:46 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:54:46 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:54:53 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:54:54 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:55:07 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:55:10 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:55:14 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:55:15 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 13:55:16 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:55:16 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 13:55:18 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 13:55:18 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:57:10 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:57:11 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "G83009TH"
    }, 
    {
        "ts": "2020-08-17 13:57:25 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: track_banner is null\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G99952ON"
    }, 
    {
        "ts": "2020-08-17 13:57:26 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G99952ON"
    }, 
    {
        "ts": "2020-08-17 13:58:04 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:58:05 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:58:09 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:58:10 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:58:42 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:58:43 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:59:17 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 13:59:18 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:00:15 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G65893EZ"
    }, 
    {
        "ts": "2020-08-17 14:00:16 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G65893EZ"
    }, 
    {
        "ts": "2020-08-17 14:01:32 ", 
        "page": "protein_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:01:33 ", 
        "page": "protein_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "Q8WZ75"
    }, 
    {
        "ts": "2020-08-17 14:07:44 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:07:45 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G87293AR"
    }, 
    {
        "ts": "2020-08-17 14:10:39 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: TypeError: null is not an object (evaluating 'track_banner.style')\nurl: https://www.glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "P03956-1#glycosylation"
    }, 
    {
        "ts": "2020-08-17 14:10:40 ", 
        "page": "protein_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "P03956-1"
    }, 
    {
        "ts": "2020-08-17 14:28:20 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:28:20 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:28:22 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:28:22 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:28:27 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:28:27 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 14:28:28 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 14:28:28 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:28:34 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:28:34 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:29:02 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:29:02 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:30:18 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:30:18 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G96599KT"
    }, 
    {
        "ts": "2020-08-17 14:32:38 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:32:38 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:32:45 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:32:49 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:32:49 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:32:54 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:32:59 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:32:59 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:33:15 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:33:19 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:33:19 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:34:44 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G10228OD"
    }, 
    {
        "ts": "2020-08-17 14:37:34 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G24122ZI"
    }, 
    {
        "ts": "2020-08-17 14:37:36 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G24122ZI"
    }, 
    {
        "ts": "2020-08-17 14:39:30 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:39:32 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G20172ET"
    }, 
    {
        "ts": "2020-08-17 14:40:43 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:40:43 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:40:45 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G42668PC"
    }, 
    {
        "ts": "2020-08-17 14:40:46 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G42668PC"
    }, 
    {
        "ts": "2020-08-17 14:40:51 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:40:52 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:40:56 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:40:57 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 14:40:57 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 14:40:58 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:41:00 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:41:00 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:41:22 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "G57789QC"
    }, 
    {
        "ts": "2020-08-17 14:41:22 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:41:33 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:41:52 ", 
        "page": "alignment", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:41:52 ", 
        "page": "alignment", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:42:01 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:45:18 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:45:18 ", 
        "page": "Siteview", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:46:10 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:46:11 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:46:38 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:46:39 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:46:56 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:46:57 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:46:58 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:46:59 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:50:34 ", 
        "page": "protein_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:50:35 ", 
        "page": "protein_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "P08603-1"
    }, 
    {
        "ts": "2020-08-17 14:55:58 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:55:59 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 14:56:00 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 14:56:00 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:56:03 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:56:03 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 14:57:14 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:57:15 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:57:18 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 14:57:18 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:44 ", 
        "page": "home", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:44 ", 
        "page": "home", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:47 ", 
        "page": "protein-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:48 ", 
        "page": "protein-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:57 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:57 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:58 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:02:58 ", 
        "page": "glycan_detail.html", 
        "user": "Anonymous", 
        "message": "successful response", 
        "type": "user", 
        "id": "G94923PG"
    }, 
    {
        "ts": "2020-08-17 15:03:00 ", 
        "page": "quick-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:01 ", 
        "page": "quick-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:01 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:01 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:04 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:05 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:03:06 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:03:06 ", 
        "page": "protein-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:08 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:03:08 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:09 ", 
        "page": "quick-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:03:10 ", 
        "page": "protein", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:03:10 ", 
        "page": "protein", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:12 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:03:12 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:14 ", 
        "page": "protVista", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:14 ", 
        "page": "protVista", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:03:33 ", 
        "page": "home", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:34 ", 
        "page": "home", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:42 ", 
        "page": "glycan-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:03:43 ", 
        "page": "glycan-search", 
        "user": "0uatd6wac6zk1dei5mm5ebxny9xgcmc7", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:04:39 ", 
        "page": "glycan-search", 
        "user": "u54b4mpu2vwjp5f83wokkee0jxkvx0ht", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:04:39 ", 
        "page": "glycan-search", 
        "user": "u54b4mpu2vwjp5f83wokkee0jxkvx0ht", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:10:43 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G04783EJ"
    }, 
    {
        "ts": "2020-08-17 15:10:46 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G04783EJ"
    }, 
    {
        "ts": "2020-08-17 15:13:20 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G17801HD"
    }, 
    {
        "ts": "2020-08-17 15:13:22 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G17801HD"
    }, 
    {
        "ts": "2020-08-17 15:14:51 ", 
        "page": "protein", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:14:51 ", 
        "page": "protein", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:15:51 ", 
        "page": "protein", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:15:51 ", 
        "page": "protein", 
        "user": "kle1ht1fm6dy41m12cwsunzfsjiyghn5", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:21:22 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G12232DG"
    }, 
    {
        "ts": "2020-08-17 15:21:24 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G12232DG"
    }, 
    {
        "ts": "2020-08-17 15:23:57 ", 
        "page": "protein_search.html", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:02 ", 
        "page": "protein_search.html", 
        "user": "NO", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:03 ", 
        "page": "protein_search.html", 
        "user": "NO", 
        "message": "Advanced Search: Searched with modified parameters", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:24:04 ", 
        "page": "protein_list.html", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:04 ", 
        "page": "protein_list.html", 
        "user": "NO", 
        "message": "successful response (page: 1, sort: undefined, dir: asc, limit: 20)", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:24:09 ", 
        "page": "protein_detail.html", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:09 ", 
        "page": "protein_detail.html", 
        "user": "NO", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:24:12 ", 
        "page": "protvista_index.html", 
        "user": "NO", 
        "message": "JS Error: Script error.\nurl: \nline: 0", 
        "type": "error", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:24:12 ", 
        "page": "protvista_index.html", 
        "user": "NO", 
        "message": "JS Error: Script error.\nurl: \nline: 0", 
        "type": "error", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:24:12 ", 
        "page": "protvista_index.html", 
        "user": "NO", 
        "message": "JS Error: Script error.\nurl: \nline: 0", 
        "type": "error", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:24:12 ", 
        "page": "protvista_index.html", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:13 ", 
        "page": "protvista_index.html", 
        "user": "NO", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:24:17 ", 
        "page": "site_view.html", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:18 ", 
        "page": "site_view.html", 
        "user": "NO", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:24:39 ", 
        "page": "site_view.html", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:39 ", 
        "page": "site_view.html", 
        "user": "NO", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:24:41 ", 
        "page": "site_view.html", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:24:42 ", 
        "page": "site_view.html", 
        "user": "NO", 
        "message": "successful response", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:24:50 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "JS Error: Uncaught TypeError: Cannot read property 'style' of null\nurl: https://glygen.org/js/activity_tracker.js\nline: 28", 
        "type": "error", 
        "id": "G38887OA"
    }, 
    {
        "ts": "2020-08-17 15:24:53 ", 
        "page": "glycan_detail.html", 
        "user": "Undecided", 
        "message": "successful response", 
        "type": "user", 
        "id": "G38887OA"
    }, 
    {
        "ts": "2020-08-17 15:27:00 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:00 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:06 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:07 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:22 ", 
        "page": "home", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:23 ", 
        "page": "home", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:23 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:24 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:25 ", 
        "page": "home", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:25 ", 
        "page": "home", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:28 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:28 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:33 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:34 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:36 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:37 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:37 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:27:37 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:38 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:38 ", 
        "page": "protein-list", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 15:27:38 ", 
        "page": "protein-list", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:38 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 15:27:38 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:38 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 15:27:39 ", 
        "page": "protein", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:27:39 ", 
        "page": "protein", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:41 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:41 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "G00318AV"
    }, 
    {
        "ts": "2020-08-17 15:27:42 ", 
        "page": "protVista", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:42 ", 
        "page": "protVista", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:27:45 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:46 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "G90889KG"
    }, 
    {
        "ts": "2020-08-17 15:27:46 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:46 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"mass_type\":\"Native\",\"enzyme\":{},\"glytoucan_ac\":\"G17689DH\",\"glycan_type\":\"\",\"glycan_subtype\":\"\",\"protein_identifier\":\"\",\"glycan_motif\":\"\",\"pmid\":\"\"}", 
        "type": "user", 
        "id": ">36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 15:27:47 ", 
        "page": "glycan-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:47 ", 
        "page": "glycan-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 15:27:47 ", 
        "page": "Siteview", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:47 ", 
        "page": "Siteview", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:27:54 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:54 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:27:59 ", 
        "page": "home", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:00 ", 
        "page": "home", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:01 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 15:28:01 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:08 ", 
        "page": "motif", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:08 ", 
        "page": "motif", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "G00055MO"
    }, 
    {
        "ts": "2020-08-17 15:28:09 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "Disabled Logging", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:14 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:15 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:22 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:22 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "G00056HH"
    }, 
    {
        "ts": "2020-08-17 15:28:51 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:28:51 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:29:03 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:29:03 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:29:07 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:29:07 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:29:07 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:29:10 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:29:10 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:29:28 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:29:28 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:30:04 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:30:04 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:31:47 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:31:48 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:31:55 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:31:56 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:04 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:05 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"mass_type\":\"Native\",\"enzyme\":{},\"glytoucan_ac\":\"G17689DH\",\"glycan_type\":\"\",\"glycan_subtype\":\"\",\"protein_identifier\":\"\",\"glycan_motif\":\"\",\"pmid\":\"\"}", 
        "type": "user", 
        "id": ">36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 15:33:05 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:05 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 15:33:08 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:08 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 15:33:17 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:18 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:19 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:20 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 15:33:20 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 15:33:21 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:24 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:33:24 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:31 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:33:31 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:51 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:33:52 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:00 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:01 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:04 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:04 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 15:34:05 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:05 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 15:34:08 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "G00318AV"
    }, 
    {
        "ts": "2020-08-17 15:34:08 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:13 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "G96921ZU"
    }, 
    {
        "ts": "2020-08-17 15:34:13 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:26 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:26 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:53 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:34:54 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:05 ", 
        "page": "try-me", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:06 ", 
        "page": "try-me", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:17 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:17 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:21 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:35:22 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:35:22 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:36 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:36 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:35:45 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:35:46 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:36:25 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:36:26 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:36:30 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:36:31 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:36:48 ", 
        "page": "try-me", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:36:49 ", 
        "page": "try-me", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:37:08 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:37:09 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:37:31 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "Performing Global Search", 
        "type": "user", 
        "id": "hgf"
    }, 
    {
        "ts": "2020-08-17 15:37:31 ", 
        "page": "global-search-result", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:37:32 ", 
        "page": "global-search-result", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:37:37 ", 
        "page": "global-search-result", 
        "user": "Anonymous", 
        "message": "Global search term=hgf", 
        "type": "user", 
        "id": "hgf"
    }, 
    {
        "ts": "2020-08-17 15:38:14 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:15 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:19 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:20 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:31 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:31 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:46 ", 
        "page": "media", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:46 ", 
        "page": "media", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:52 ", 
        "page": "frameworks", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:53 ", 
        "page": "frameworks", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:56 ", 
        "page": "resources", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:38:57 ", 
        "page": "resources", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:05 ", 
        "page": "how-to-cite", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:06 ", 
        "page": "how-to-cite", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:14 ", 
        "page": "feedback", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:14 ", 
        "page": "feedback", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:16 ", 
        "page": "contact-us", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:17 ", 
        "page": "contact-us", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:37 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:38 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:41 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:39:42 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:40:06 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:40:07 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:57:57 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:57:58 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:58:56 ", 
        "page": "home", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:58:56 ", 
        "page": "home", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:59:07 ", 
        "page": "home", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "Performing Global Search", 
        "type": "user", 
        "id": "P14210"
    }, 
    {
        "ts": "2020-08-17 15:59:07 ", 
        "page": "global-search-result", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:59:07 ", 
        "page": "global-search-result", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:59:12 ", 
        "page": "global-search-result", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "Global search term=P14210", 
        "type": "user", 
        "id": "P14210"
    }, 
    {
        "ts": "2020-08-17 15:59:17 ", 
        "page": "protein-list", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 15:59:17 ", 
        "page": "protein-list", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": "1a36471d641a641ab2ff737ede1c7074"
    }, 
    {
        "ts": "2020-08-17 15:59:20 ", 
        "page": "protein", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 15:59:20 ", 
        "page": "protein", 
        "user": "1gqf9ozb5t6l5bjxybwtr6ciha1q1pqm", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:00:37 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:00:37 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:01:24 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:01:24 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:01:30 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:01:31 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"mass_type\":\"Native\",\"enzyme\":{},\"glytoucan_ac\":\"G17689DH\",\"glycan_type\":\"\",\"glycan_subtype\":\"\",\"protein_identifier\":\"\",\"glycan_motif\":\"\",\"pmid\":\"\"}", 
        "type": "user", 
        "id": ">36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 16:01:31 ", 
        "page": "glycan-list", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:01:31 ", 
        "page": "glycan-list", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": "36f773d3aa4125f3f746af221386e378"
    }, 
    {
        "ts": "2020-08-17 16:01:38 ", 
        "page": "glycan", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": "G17689DH"
    }, 
    {
        "ts": "2020-08-17 16:01:38 ", 
        "page": "glycan", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:05 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:05 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:06 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:06 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:25 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:25 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"mass_type\":\"Native\",\"enzyme\":{},\"glytoucan_ac\":\"G24005JZ,G08606CV,G69616RY,G04437UY,G53916LT,G36220ML,G08835ES,G25570MS,G83385WA,G45395BF,G88374WZ,G42039FI,G64824NL,G50591OC,G17664QO,G45752DS,G81005XV,G08146BT,G22747ZM,G72956NR,G00318AV,G30048DT,G48844XN,G37260VJ,G33052EK,G78779MC,G01726PL\",\"glycan_type\":\"\",\"glycan_subtype\":\"\",\"protein_identifier\":\"\",\"glycan_motif\":\"\",\"pmid\":\"\"}", 
        "type": "user", 
        "id": ">2ae1de86a4541675da9720ee70b8cc1d"
    }, 
    {
        "ts": "2020-08-17 16:04:26 ", 
        "page": "glycan-list", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:26 ", 
        "page": "glycan-list", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": "2ae1de86a4541675da9720ee70b8cc1d"
    }, 
    {
        "ts": "2020-08-17 16:04:38 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:38 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:48 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:48 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:51 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:51 ", 
        "page": "glycan-search", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 16:04:52 ", 
        "page": "glycan-list", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": "adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 16:04:52 ", 
        "page": "glycan-list", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:54 ", 
        "page": "glycan", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:04:54 ", 
        "page": "glycan", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": "G00318AV"
    }, 
    {
        "ts": "2020-08-17 16:05:41 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:05:41 ", 
        "page": "home", 
        "user": "ve9cn5g50nlwm5ozjikvak295oxsl763", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:32:29 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "G40906DZ"
    }, 
    {
        "ts": "2020-08-17 16:32:30 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:36:20 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:36:20 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:05 ", 
        "page": "home", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:05 ", 
        "page": "home", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:07 ", 
        "page": "protein-search", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:07 ", 
        "page": "protein-search", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:09 ", 
        "page": "protein-search", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:10 ", 
        "page": "protein-search", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 16:59:11 ", 
        "page": "protein-list", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 16:59:11 ", 
        "page": "protein-list", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:13 ", 
        "page": "protein", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:13 ", 
        "page": "protein", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 16:59:18 ", 
        "page": "protVista", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:18 ", 
        "page": "protVista", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 16:59:35 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 16:59:35 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:02:08 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:02:08 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:02:16 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:02:16 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:02:26 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:02:26 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:02:38 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:02:38 ", 
        "page": "Siteview", 
        "user": "pip6fml3nzhmpczlp0kz3l640ok7r83v", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:21:50 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:21:50 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:22:42 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:22:43 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:22:56 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:22:57 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 17:22:58 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 17:22:58 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:23:12 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:23:12 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:25:12 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:25:12 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "G77252PU"
    }, 
    {
        "ts": "2020-08-17 17:27:17 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P17050-1"
    }, 
    {
        "ts": "2020-08-17 17:27:17 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:27:52 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P17050-1"
    }, 
    {
        "ts": "2020-08-17 17:27:52 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:30:19 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:30:19 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "G91413ZX"
    }, 
    {
        "ts": "2020-08-17 17:31:15 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:31:16 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:32:23 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:32:24 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:32:51 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:32:51 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:36:28 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:36:29 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:36:32 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:36:33 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 17:36:34 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "3cd22aa308c52c8c709aee045e1c55e3"
    }, 
    {
        "ts": "2020-08-17 17:36:34 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:36:39 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:36:39 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:37:15 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:37:16 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:37:23 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Quick Search Question_5 =/P14210-1 function", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:37:24 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:37:24 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:37:49 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:37:50 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:37:50 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:37:50 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:38:06 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:38:06 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:39:43 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:39:43 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:39:45 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:40:23 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:40:23 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:40:31 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:40:47 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:40:47 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210"
    }, 
    {
        "ts": "2020-08-17 17:41:09 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:41:09 ", 
        "page": "Siteview", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210"
    }, 
    {
        "ts": "2020-08-17 17:41:17 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "Q9HBE5"
    }, 
    {
        "ts": "2020-08-17 17:41:17 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:41:32 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:41:32 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210"
    }, 
    {
        "ts": "2020-08-17 17:41:35 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:41:35 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:41:51 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Try Me Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:41:53 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Try Me Search Question_1 = /9606/G46836GH", 
        "type": "user", 
        "id": "1c3fa9935e8a3372ea7f180376faaa43"
    }, 
    {
        "ts": "2020-08-17 17:41:53 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:41:53 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "1c3fa9935e8a3372ea7f180376faaa43"
    }, 
    {
        "ts": "2020-08-17 17:42:01 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:42:02 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:43:21 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Quick Search", 
        "type": "user", 
        "id": "1c3fa9935e8a3372ea7f180376faaa43"
    }, 
    {
        "ts": "2020-08-17 17:43:23 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Quick Search Question_6 = /10090/P15291-1", 
        "type": "user", 
        "id": "1c3fa9935e8a3372ea7f180376faaa43>c206386ebc720a6f3dbe70d3e623267f"
    }, 
    {
        "ts": "2020-08-17 17:43:24 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:43:24 ", 
        "page": "glycan-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "c206386ebc720a6f3dbe70d3e623267f"
    }, 
    {
        "ts": "2020-08-17 17:43:37 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:43:37 ", 
        "page": "glycan", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "G91413ZX"
    }, 
    {
        "ts": "2020-08-17 17:44:54 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:44:55 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:45:12 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:45:12 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:45:19 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:45:19 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:03 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:03 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:03 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "O08538"
    }, 
    {
        "ts": "2020-08-17 17:46:05 ", 
        "page": "protein-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 17:46:12 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:12 ", 
        "page": "protein-list", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 17:46:23 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:23 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:46:27 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:28 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:31 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:46:31 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "G06186NU"
    }, 
    {
        "ts": "2020-08-17 17:48:43 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:48:44 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:49:02 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:49:02 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 17:49:02 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:49:11 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:49:11 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:50:51 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 17:50:51 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 19:30:12 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 19:30:13 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "G42217SL"
    }, 
    {
        "ts": "2020-08-17 19:31:15 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 19:31:15 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "A7TZE6"
    }, 
    {
        "ts": "2020-08-17 19:44:16 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "G15021LG"
    }, 
    {
        "ts": "2020-08-17 19:44:16 ", 
        "page": "glycan", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 20:24:59 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "O09008"
    }, 
    {
        "ts": "2020-08-17 20:38:39 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "Q99062"
    }, 
    {
        "ts": "2020-08-17 20:49:53 ", 
        "page": "home", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 20:51:56 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 20:51:56 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "P08910"
    }, 
    {
        "ts": "2020-08-17 21:12:41 ", 
        "page": "home", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:12:42 ", 
        "page": "home", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:12:44 ", 
        "page": "home", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "Performing Global Search", 
        "type": "user", 
        "id": "G36191CD"
    }, 
    {
        "ts": "2020-08-17 21:12:45 ", 
        "page": "global-search-result", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:12:45 ", 
        "page": "global-search-result", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:12:50 ", 
        "page": "global-search-result", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "Global search term=G36191CD", 
        "type": "user", 
        "id": "G36191CD"
    }, 
    {
        "ts": "2020-08-17 21:12:54 ", 
        "page": "glycan-list", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": "bf15b6b9c1de1d6c713cb839cea3db18"
    }, 
    {
        "ts": "2020-08-17 21:12:54 ", 
        "page": "glycan-list", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:12:57 ", 
        "page": "glycan", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": "G36191CD"
    }, 
    {
        "ts": "2020-08-17 21:12:57 ", 
        "page": "glycan", 
        "user": "6evj34mj7p9ialj8ogk1atnqpxftfqjf", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:29:31 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:29:31 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "Q13683"
    }, 
    {
        "ts": "2020-08-17 21:47:51 ", 
        "page": "home", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:47:52 ", 
        "page": "home", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:47:54 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:47:54 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:47:57 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "Performing Advanced Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:47:58 ", 
        "page": "protein-search", 
        "user": "NO", 
        "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"uniprot_canonical_ac\":\"P14210\"}", 
        "type": "user", 
        "id": ">96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 21:47:59 ", 
        "page": "protein-list", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": "96729ced790bc5e300144422dd900bf3"
    }, 
    {
        "ts": "2020-08-17 21:47:59 ", 
        "page": "protein-list", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:48:01 ", 
        "page": "protein", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 21:48:01 ", 
        "page": "protein", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:48:06 ", 
        "page": "protVista", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 21:48:06 ", 
        "page": "protVista", 
        "user": "NO", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 21:51:15 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "Q96RN1"
    }, 
    {
        "ts": "2020-08-17 22:14:18 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 22:14:19 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "Q9UJ14"
    }, 
    {
        "ts": "2020-08-17 23:02:38 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:02:38 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:05:56 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:05:57 ", 
        "page": "glycan-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:06:00 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:06:00 ", 
        "page": "home", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:06:02 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:06:03 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:06:14 ", 
        "page": "quick-search", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:06:14 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:06:14 ", 
        "page": "protein", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:06:18 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:06:18 ", 
        "page": "protVista", 
        "user": "wl1hb0whmro3ch5oy8j01hf1jdjhrso6", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:07:05 ", 
        "page": "home", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:07:15 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:07:24 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:07:33 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:07:34 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:07:34 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:07:43 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:07:43 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:08:37 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:08:51 ", 
        "page": "protein-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:09:36 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:10:10 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:11:41 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:11:44 ", 
        "page": "privacy-settings", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:11:47 ", 
        "page": "privacy-settings", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:11:47 ", 
        "page": "privacy-settings", 
        "user": "m02t0lose2fozoqilvica5e4f2jsqitv", 
        "message": "Enabled Logging", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:11:57 ", 
        "page": "privacy-settings", 
        "user": "m02t0lose2fozoqilvica5e4f2jsqitv", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:11:58 ", 
        "page": "privacy-settings", 
        "user": "Anonymous", 
        "message": "Disabled Logging", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:11:58 ", 
        "page": "privacy-settings", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:12:08 ", 
        "page": "privacy-settings", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:12:12 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:12:42 ", 
        "page": "home", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:12:44 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:13:01 ", 
        "page": "home", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:13:03 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:13:33 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:13:38 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "Performing Simple Search", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:13:39 ", 
        "page": "glycan-search", 
        "user": "Anonymous", 
        "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}", 
        "type": "user", 
        "id": ">adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 23:13:39 ", 
        "page": "glycan-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:13:39 ", 
        "page": "glycan-list", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "adc1a1030ce36ce29287fe023aa8cdec"
    }, 
    {
        "ts": "2020-08-17 23:13:57 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "G37626XQ"
    }, 
    {
        "ts": "2020-08-17 23:13:57 ", 
        "page": "glycan", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:14:42 ", 
        "page": "home", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:14:44 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:15:09 ", 
        "page": "quick-search", 
        "user": "Anonymous", 
        "message": "Quick Search Question_7 =/P14210-1 sequence", 
        "type": "user", 
        "id": ">P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:15:10 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:15:10 ", 
        "page": "protein", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:15:14 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:15:14 ", 
        "page": "protVista", 
        "user": "Anonymous", 
        "message": "page access", 
        "type": "user", 
        "id": "P14210-1"
    }, 
    {
        "ts": "2020-08-17 23:26:16 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": "P16410"
    }, 
    {
        "ts": "2020-08-17 23:26:16 ", 
        "page": "protein", 
        "user": "Undecided", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:38:18 ", 
        "page": "about", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:38:19 ", 
        "page": "about", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:39:07 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }, 
    {
        "ts": "2020-08-17 23:39:07 ", 
        "page": "home", 
        "user": "1f4ctru3nkb56crgemmy6asbae1mwo81", 
        "message": "page access", 
        "type": "user", 
        "id": ""
    }
]