[{"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 00:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 00:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 00:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 00:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 00:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 00:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:01:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTW7"}, "ts": "2023-07-25 00:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07202", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:01:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07202"}, "ts": "2023-07-25 00:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZUM4"}, "ts": "2023-07-25 00:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZUM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:02:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCD5"}, "ts": "2023-07-25 00:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13951"}, "ts": "2023-07-25 00:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13951", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:05:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "C9JLW8.24.24"}, "ts": "2023-07-25 00:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JLW8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:08:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:08:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU9"}, "ts": "2023-07-25 00:09:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-25 00:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:10:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20334"}, "ts": "2023-07-25 00:10:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20334", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:10:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11511"}, "ts": "2023-07-25 00:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13136"}, "ts": "2023-07-25 00:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13136", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:12:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHB6"}, "ts": "2023-07-25 00:12:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:12:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60232"}, "ts": "2023-07-25 00:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60232", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:12:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36776"}, "ts": "2023-07-25 00:16:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIN8-1"}, "ts": "2023-07-25 00:17:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIN8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:17:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BKC8"}, "ts": "2023-07-25 00:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BKC8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 00:18:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQJ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:18:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5PQJ5.171.171"}, "ts": "2023-07-25 00:18:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94910.915.915"}, "ts": "2023-07-25 00:19:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94910", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:19:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-25 00:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX15"}, "ts": "2023-07-25 00:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25483097", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:19:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25483097", "type": "PubMed"}, "ts": "2023-07-25 00:19:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16959833", "type": "PubMed"}, "ts": "2023-07-25 00:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16959833", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35055157", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:20:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35055157", "type": "PubMed"}, "ts": "2023-07-25 00:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35055157", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 00:20:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y662"}, "ts": "2023-07-25 00:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y662", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60934", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60934"}, "ts": "2023-07-25 00:20:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQA7"}, "ts": "2023-07-25 00:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:20:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13023"}, "ts": "2023-07-25 00:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16853", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:21:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16853.733.733"}, "ts": "2023-07-25 00:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75603"}, "ts": "2023-07-25 00:21:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12789.1068.1068"}, "ts": "2023-07-25 00:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12789", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:21:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68668TB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 00:21:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68668TB"}, "ts": "2023-07-25 00:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13497"}, "ts": "2023-07-25 00:21:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:21:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5Y7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:22:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5Y7"}, "ts": "2023-07-25 00:22:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 00:22:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-25 00:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14560022", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:24:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14560022", "type": "PubMed"}, "ts": "2023-07-25 00:24:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 00:24:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VB07", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 00:24:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q0VB07", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 00:24:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VB07", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 00:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25456411", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:24:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25456411", "type": "PubMed"}, "ts": "2023-07-25 00:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:24:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZM4.294.294"}, "ts": "2023-07-25 00:24:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24799285", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:24:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24799285", "type": "PubMed"}, "ts": "2023-07-25 00:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17302", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:25:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17302.279.279"}, "ts": "2023-07-25 00:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EB56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:25:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EB56"}, "ts": "2023-07-25 00:25:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-25 00:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VI56"}, "ts": "2023-07-25 00:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VI56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43116"}, "ts": "2023-07-25 00:26:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:26:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZ07-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:26:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZ07-1"}, "ts": "2023-07-25 00:26:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP73"}, "ts": "2023-07-25 00:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24557", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:27:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24557"}, "ts": "2023-07-25 00:27:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75074.708.708"}, "ts": "2023-07-25 00:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75074", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16581"}, "ts": "2023-07-25 00:29:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:29:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGU0.701.701"}, "ts": "2023-07-25 00:29:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGU0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:29:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUE6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:29:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IUE6.118.118"}, "ts": "2023-07-25 00:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X55"}, "ts": "2023-07-25 00:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:29:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876-1"}, "ts": "2023-07-25 00:29:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P1Z2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:30:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P1Z2"}, "ts": "2023-07-25 00:30:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48750"}, "ts": "2023-07-25 00:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23984SE"}, "ts": "2023-07-25 00:30:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11344", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:31:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11344"}, "ts": "2023-07-25 00:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:31:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07988"}, "ts": "2023-07-25 00:31:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-25 00:32:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-25 00:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:33:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-25 00:33:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 00:33:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 00:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 00:33:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61204", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:33:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61204"}, "ts": "2023-07-25 00:33:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867"}, "ts": "2023-07-25 00:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 00:35:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMV8"}, "ts": "2023-07-25 00:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMV8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 00:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:35:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NEZ2.182.182"}, "ts": "2023-07-25 00:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:35:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBH5"}, "ts": "2023-07-25 00:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NC56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NC56"}, "ts": "2023-07-25 00:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQA7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:36:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-25 00:36:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07350"}, "ts": "2023-07-25 00:36:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHY2"}, "ts": "2023-07-25 00:37:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZT9"}, "ts": "2023-07-25 00:37:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-25 00:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20929"}, "ts": "2023-07-25 00:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJW0"}, "ts": "2023-07-25 00:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JJ7"}, "ts": "2023-07-25 00:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-25 00:38:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14061"}, "ts": "2023-07-25 00:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14061", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 00:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:39:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70365", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:40:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70365"}, "ts": "2023-07-25 00:40:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04177-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:40:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04177-1"}, "ts": "2023-07-25 00:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQG5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:40:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQG5"}, "ts": "2023-07-25 00:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13061"}, "ts": "2023-07-25 00:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:41:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-25 00:41:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N336"}, "ts": "2023-07-25 00:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N336", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:42:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYH8"}, "ts": "2023-07-25 00:42:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96024"}, "ts": "2023-07-25 00:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96024", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:42:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H106"}, "ts": "2023-07-25 00:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H106", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:42:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-25 00:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4H9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:43:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4H9"}, "ts": "2023-07-25 00:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CF74-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:43:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CF74-1"}, "ts": "2023-07-25 00:43:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15263099", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:43:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15263099", "type": "PubMed"}, "ts": "2023-07-25 00:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15085", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:44:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15085"}, "ts": "2023-07-25 00:44:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64550"}, "ts": "2023-07-25 00:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:44:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1V9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:44:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16778204", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:44:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16778204", "type": "PubMed"}, "ts": "2023-07-25 00:44:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-25 00:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JG2-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 00:45:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JG2-1"}, "ts": "2023-07-25 00:45:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X17"}, "ts": "2023-07-25 00:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24442997", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:46:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24442997", "type": "PubMed"}, "ts": "2023-07-25 00:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:46:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZL6.293.293"}, "ts": "2023-07-25 00:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22668561", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:46:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22668561", "type": "PubMed"}, "ts": "2023-07-25 00:46:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12609607", "type": "PubMed"}, "ts": "2023-07-25 00:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12609607", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:47:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10759568", "type": "PubMed"}, "ts": "2023-07-25 00:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10759568", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51690"}, "ts": "2023-07-25 00:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-25 00:47:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68366", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:48:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P68366.432.432"}, "ts": "2023-07-25 00:48:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JI18.1549.1549"}, "ts": "2023-07-25 00:49:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI18", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:49:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04792"}, "ts": "2023-07-25 00:51:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11056530", "type": "PubMed"}, "ts": "2023-07-25 00:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11056530", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:51:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15061"}, "ts": "2023-07-25 00:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-25 00:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:53:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-25 00:53:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-25 00:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99952ON"}, "ts": "2023-07-25 00:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:54:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 00:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41208"}, "ts": "2023-07-25 00:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41208", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 00:54:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15652.1091.1091"}, "ts": "2023-07-25 00:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15652", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:55:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 00:55:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94919", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 00:55:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94919.59.59"}, "ts": "2023-07-25 00:55:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15657060", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:56:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15657060", "type": "PubMed"}, "ts": "2023-07-25 00:56:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00740"}, "ts": "2023-07-25 00:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00740", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10521596", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:57:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10521596", "type": "PubMed"}, "ts": "2023-07-25 00:57:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 00:58:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9751643", "type": "PubMed"}, "ts": "2023-07-25 00:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9751643", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33547341", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 00:59:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33547341", "type": "PubMed"}, "ts": "2023-07-25 00:59:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 00:59:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02671"}, "ts": "2023-07-25 00:59:37 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 01:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 01:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 01:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 01:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 01:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 01:00:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P10818", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 01:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10818", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 01:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10818", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 01:00:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-25 01:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15437", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:00:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15437.313.313"}, "ts": "2023-07-25 01:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JA4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 01:00:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99JA4", "cluster_type": "unselected"}, "ts": "2023-07-25 01:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JA4", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 01:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:01:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHV9"}, "ts": "2023-07-25 01:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3G6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:01:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3G6.551.551"}, "ts": "2023-07-25 01:01:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-25 01:02:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13541"}, "ts": "2023-07-25 01:02:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13541"}, "ts": "2023-07-25 01:02:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96ST3.505.505"}, "ts": "2023-07-25 01:02:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ST3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:02:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51690", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5N7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:04:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N5N7.110.110"}, "ts": "2023-07-25 01:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:04:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94778"}, "ts": "2023-07-25 01:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-25 01:06:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:07:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BH35"}, "ts": "2023-07-25 01:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BH35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZC2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:07:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZC2.79.79"}, "ts": "2023-07-25 01:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:08:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N387"}, "ts": "2023-07-25 01:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N387", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:09:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:09:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60981-1"}, "ts": "2023-07-25 01:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43117", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:12:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43117"}, "ts": "2023-07-25 01:12:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08662-1"}, "ts": "2023-07-25 01:13:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08662-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:13:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26038"}, "ts": "2023-07-25 01:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:13:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43255.28.28"}, "ts": "2023-07-25 01:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43255", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66538GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:14:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66538GV"}, "ts": "2023-07-25 01:14:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-25 01:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:16:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61586-1"}, "ts": "2023-07-25 01:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61586-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:16:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T4F4-1"}, "ts": "2023-07-25 01:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4F4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:16:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26968983", "type": "PubMed"}, "ts": "2023-07-25 01:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26968983", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3I9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:16:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K3I9.99.99"}, "ts": "2023-07-25 01:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-25 01:17:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY32"}, "ts": "2023-07-25 01:17:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY32", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:17:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-25 01:17:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13541", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:18:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-25 01:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:18:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:19:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCM1"}, "ts": "2023-07-25 01:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:20:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28332"}, "ts": "2023-07-25 01:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28332", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:20:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU68"}, "ts": "2023-07-25 01:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQN1"}, "ts": "2023-07-25 01:21:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:22:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22057101", "type": "PubMed"}, "ts": "2023-07-25 01:22:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22057101", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-25 01:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCR0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCR0-1"}, "ts": "2023-07-25 01:24:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70193"}, "ts": "2023-07-25 01:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70193", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:25:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-25 01:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2EG98"}, "ts": "2023-07-25 01:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1M0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:26:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1M0.177.177"}, "ts": "2023-07-25 01:26:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25445"}, "ts": "2023-07-25 01:27:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BX22"}, "ts": "2023-07-25 01:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BX22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:27:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 01:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSN6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 01:27:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSN6"}, "ts": "2023-07-25 01:27:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16116162", "type": "PubMed"}, "ts": "2023-07-25 01:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16116162", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:27:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66X93"}, "ts": "2023-07-25 01:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66X93", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP55", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:28:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP55.72.72"}, "ts": "2023-07-25 01:28:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47133WV"}, "ts": "2023-07-25 01:28:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 01:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5W3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 01:31:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5W3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 01:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04186"}, "ts": "2023-07-25 01:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29322"}, "ts": "2023-07-25 01:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29322", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 01:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5W3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 01:31:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9R0T4.584.584"}, "ts": "2023-07-25 01:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0T4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57930PW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:32:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57930PW"}, "ts": "2023-07-25 01:32:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57930PW"}, "ts": "2023-07-25 01:32:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59324HL"}, "ts": "2023-07-25 01:32:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31089UT"}, "ts": "2023-07-25 01:32:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17385XL"}, "ts": "2023-07-25 01:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:33:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35453"}, "ts": "2023-07-25 01:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35453", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2EG98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:35:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07195"}, "ts": "2023-07-25 01:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-25 01:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30453345", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:36:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30453345", "type": "PubMed"}, "ts": "2023-07-25 01:36:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97179UV"}, "ts": "2023-07-25 01:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G97179UV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:36:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-25 01:36:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-25 01:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 01:38:58 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 01:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 01:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ErbB2", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-25 01:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 01:39:06 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "ErbB2"}, "ts": "2023-07-25 01:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 01:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ErbB2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=ErbB2"}, "ts": "2023-07-25 01:39:06 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 01:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 01:39:12 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 01:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 01:39:44 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_ptm", "operator": "OR", "selected": ["O-Glycosylation reported"]}]}, "ts": "2023-07-25 01:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:39:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00629"}, "ts": "2023-07-25 01:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 01:40:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_ptm", "operator": "OR", "selected": ["O-Glycosylation reported"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-25 01:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 01:40:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported", "O-Glycosylation reported"]}]}, "ts": "2023-07-25 01:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64700", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:40:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q64700.410.410"}, "ts": "2023-07-25 01:40:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000104"}, "ts": "2023-07-25 01:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 01:40:26 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 01:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 01:40:26 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fe6e126d84c55aba70a602396c464a2e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 01:40:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01019"}, "ts": "2023-07-25 01:40:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04626-1"}, "ts": "2023-07-25 01:40:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04626-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:40:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52890YB"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95133RI"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-25 01:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:41:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09429"}, "ts": "2023-07-25 01:41:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12660"}, "ts": "2023-07-25 01:42:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37802"}, "ts": "2023-07-25 01:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:44:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29741879", "type": "PubMed"}, "ts": "2023-07-25 01:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29741879", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:44:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93008"}, "ts": "2023-07-25 01:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:45:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-25 01:45:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-25 01:45:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-25 01:45:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-25 01:45:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02315DX"}, "ts": "2023-07-25 01:45:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02628JF"}, "ts": "2023-07-25 01:45:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03461SC"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03930BU"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04672QB"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04784US"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05933EN"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06231AO"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09197ZW"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66766XF"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94854LT"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25637MV"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37399XV"}, "ts": "2023-07-25 01:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-25 01:45:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50757KG"}, "ts": "2023-07-25 01:45:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-25 01:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7005231", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:45:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7005231", "type": "PubMed"}, "ts": "2023-07-25 01:45:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13612.960.960"}, "ts": "2023-07-25 01:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13612", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:46:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49792.469.469"}, "ts": "2023-07-25 01:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49792", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:46:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30460NZ"}, "ts": "2023-07-25 01:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:46:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-25 01:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:47:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZUJ4"}, "ts": "2023-07-25 01:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZUJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:47:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-25 01:47:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04626"}, "ts": "2023-07-25 01:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05823-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:47:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05823-1"}, "ts": "2023-07-25 01:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 01:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L34", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 01:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L34"}, "ts": "2023-07-25 01:47:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 01:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:48:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0E3.122.122"}, "ts": "2023-07-25 01:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29741879", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:49:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29741879", "type": "PubMed"}, "ts": "2023-07-25 01:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23612980", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:49:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23612980", "type": "PubMed"}, "ts": "2023-07-25 01:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MZ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:50:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MZ4"}, "ts": "2023-07-25 01:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12907", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:51:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12907.91.91"}, "ts": "2023-07-25 01:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02463", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02463"}, "ts": "2023-07-25 01:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54767"}, "ts": "2023-07-25 01:53:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75037"}, "ts": "2023-07-25 01:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04629-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:53:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04629-1.701.701"}, "ts": "2023-07-25 01:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13635", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:53:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13635"}, "ts": "2023-07-25 01:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX30", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 01:53:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9CX30", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 01:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-25 01:53:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:53:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P99-1"}, "ts": "2023-07-25 01:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX30", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 01:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:53:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBR0.1072.1072"}, "ts": "2023-07-25 01:53:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SW2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:53:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SW2"}, "ts": "2023-07-25 01:53:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60307-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:53:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60307-1.916.916"}, "ts": "2023-07-25 01:53:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBW8"}, "ts": "2023-07-25 01:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27391WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 01:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63622", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:54:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63622.28.28"}, "ts": "2023-07-25 01:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:54:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99748"}, "ts": "2023-07-25 01:54:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-25 01:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRK5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 01:55:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BRK5.156.156"}, "ts": "2023-07-25 01:55:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22174130", "type": "PubMed"}, "ts": "2023-07-25 01:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22174130", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:55:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15247255", "type": "PubMed"}, "ts": "2023-07-25 01:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15247255", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:55:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-25 01:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-25 01:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:56:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXW1"}, "ts": "2023-07-25 01:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:56:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 01:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60842", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 01:56:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60842"}, "ts": "2023-07-25 01:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:58:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWH6"}, "ts": "2023-07-25 01:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:58:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16220"}, "ts": "2023-07-25 01:58:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:58:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99650"}, "ts": "2023-07-25 01:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31780315", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 01:58:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31780315", "type": "PubMed"}, "ts": "2023-07-25 01:59:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BTI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 01:59:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BTI8"}, "ts": "2023-07-25 01:59:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92824"}, "ts": "2023-07-25 01:59:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-25 01:59:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43561.125.125"}, "ts": "2023-07-25 02:00:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43561", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:00:02 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 02:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 02:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 02:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AD19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:00:03 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 02:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 02:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AD19"}, "ts": "2023-07-25 02:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 02:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38567", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38567"}, "ts": "2023-07-25 02:00:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34748562", "type": "PubMed"}, "ts": "2023-07-25 02:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34748562", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12980"}, "ts": "2023-07-25 02:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:00:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75094.192.192"}, "ts": "2023-07-25 02:00:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75094", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-25 02:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02461"}, "ts": "2023-07-25 02:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:01:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:01:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95786"}, "ts": "2023-07-25 02:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 02:01:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-25 02:01:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12846.15.15"}, "ts": "2023-07-25 02:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12846", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:02:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23630077", "type": "PubMed"}, "ts": "2023-07-25 02:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23630077", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:02:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77199IL"}, "ts": "2023-07-25 02:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:03:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VXT5"}, "ts": "2023-07-25 02:03:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VXT5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:03:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:04:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-25 02:04:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:05:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47750"}, "ts": "2023-07-25 02:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14162", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:05:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14162"}, "ts": "2023-07-25 02:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34731635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:05:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34731635", "type": "PubMed"}, "ts": "2023-07-25 02:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:06:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-25 02:06:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92625"}, "ts": "2023-07-25 02:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:06:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21697472", "type": "PubMed"}, "ts": "2023-07-25 02:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21697472", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0J4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:06:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0J4.1265.1265"}, "ts": "2023-07-25 02:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:07:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H59"}, "ts": "2023-07-25 02:07:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15391"}, "ts": "2023-07-25 02:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:07:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04070-1.290.290"}, "ts": "2023-07-25 02:07:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4KLH5.367.367"}, "ts": "2023-07-25 02:08:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLH5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:08:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N9B5.608.608"}, "ts": "2023-07-25 02:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9B5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQM7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:09:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQM7.286.286"}, "ts": "2023-07-25 02:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBD6"}, "ts": "2023-07-25 02:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBD6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54767", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:09:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UTJ2"}, "ts": "2023-07-25 02:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UTJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93099", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:10:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93099"}, "ts": "2023-07-25 02:10:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 02:10:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMW2"}, "ts": "2023-07-25 02:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMW2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 02:12:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9259267", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:12:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9259267", "type": "PubMed"}, "ts": "2023-07-25 02:12:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQV6"}, "ts": "2023-07-25 02:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:12:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06126"}, "ts": "2023-07-25 02:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06126", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVL7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:12:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WVL7.157.157"}, "ts": "2023-07-25 02:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93099", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 02:13:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93099"}, "ts": "2023-07-25 02:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62854", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62854"}, "ts": "2023-07-25 02:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93099", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:14:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93099"}, "ts": "2023-07-25 02:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92824", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13612", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13612"}, "ts": "2023-07-25 02:15:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 02:16:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 02:16:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 02:16:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-25 02:16:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-25 02:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8182057", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:16:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8182057", "type": "PubMed"}, "ts": "2023-07-25 02:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:16:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02461", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225"}, "ts": "2023-07-25 02:17:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12778-1"}, "ts": "2023-07-25 02:17:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21581"}, "ts": "2023-07-25 02:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93099", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:17:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93099"}, "ts": "2023-07-25 02:17:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8782815", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:19:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8782815", "type": "PubMed"}, "ts": "2023-07-25 02:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9P6"}, "ts": "2023-07-25 02:19:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:19:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-25 02:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:20:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70531"}, "ts": "2023-07-25 02:20:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L1W4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:21:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48507"}, "ts": "2023-07-25 02:21:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8294473", "type": "PubMed"}, "ts": "2023-07-25 02:21:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8294473", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54001"}, "ts": "2023-07-25 02:22:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:22:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHF4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHF4"}, "ts": "2023-07-25 02:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-25 02:25:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000114"}, "ts": "2023-07-25 02:25:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46976", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:25:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46976"}, "ts": "2023-07-25 02:25:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41250-1"}, "ts": "2023-07-25 02:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56159", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:26:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56159.59.59"}, "ts": "2023-07-25 02:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:26:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19338"}, "ts": "2023-07-25 02:26:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:27:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09603"}, "ts": "2023-07-25 02:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17442300", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:28:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17442300", "type": "PubMed"}, "ts": "2023-07-25 02:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q394", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:29:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "E9Q394.1613.1613"}, "ts": "2023-07-25 02:29:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00846"}, "ts": "2023-07-25 02:29:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11161814", "type": "PubMed"}, "ts": "2023-07-25 02:31:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11161814", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:31:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKQ2"}, "ts": "2023-07-25 02:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:31:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K229"}, "ts": "2023-07-25 02:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K229", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 02:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29684350", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:32:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29684350", "type": "PubMed"}, "ts": "2023-07-25 02:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LBE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:32:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7LBE3"}, "ts": "2023-07-25 02:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-25 02:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-25 02:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12778-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:33:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLH8"}, "ts": "2023-07-25 02:33:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97793"}, "ts": "2023-07-25 02:33:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:33:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9CX30", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 02:34:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX30", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 02:34:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX30", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 02:34:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-25 02:35:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZV3-1"}, "ts": "2023-07-25 02:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZV3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70309-1"}, "ts": "2023-07-25 02:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70309-1", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:35:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 02:35:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 02:35:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "diaph1", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 02:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 02:35:51 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "diaph1"}, "ts": "2023-07-25 02:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 02:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "diaph1", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "global-search-result", "message": "Global search term=diaph1"}, "ts": "2023-07-25 02:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:36:41 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 02:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 02:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 02:36:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00499.530.530"}, "ts": "2023-07-25 02:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00499", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:37:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16643.345.345"}, "ts": "2023-07-25 02:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16643", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:37:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-25 02:37:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-25 02:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N66-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:37:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96N66-1.451.451"}, "ts": "2023-07-25 02:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24530", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:37:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24530.152.152"}, "ts": "2023-07-25 02:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27005-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:37:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27005-1"}, "ts": "2023-07-25 02:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64LD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64LD2"}, "ts": "2023-07-25 02:37:46 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 02:37:47 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "f1fbcbe65dde222cc4dda9a9ee9a331a", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 02:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f1fbcbe65dde222cc4dda9a9ee9a331a", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 02:37:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60610-1"}, "ts": "2023-07-25 02:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60610-1", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:37:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:37:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35372"}, "ts": "2023-07-25 02:37:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-25 02:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231"}, "ts": "2023-07-25 02:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20351274", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:38:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20351274", "type": "PubMed"}, "ts": "2023-07-25 02:38:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60610-1"}, "ts": "2023-07-25 02:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60610-1", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "trop2", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 02:38:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 02:38:24 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "trop2"}, "ts": "2023-07-25 02:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 02:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "trop2", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "global-search-result", "message": "Global search term=trop2"}, "ts": "2023-07-25 02:38:25 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 02:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cbb74cb685da1c0f86482e59ef82d081", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 02:38:26 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "cbb74cb685da1c0f86482e59ef82d081", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 02:38:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09758-1"}, "ts": "2023-07-25 02:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09758-1", "user": "qqbkznoe1uquvqphuprap61v66bdki1r", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:38:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18462684", "type": "PubMed"}, "ts": "2023-07-25 02:38:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18462684", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15364545", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:39:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15364545", "type": "PubMed"}, "ts": "2023-07-25 02:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3THS6-1"}, "ts": "2023-07-25 02:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3THS6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:39:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKU9.238.238"}, "ts": "2023-07-25 02:39:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRR5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKU9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:39:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRR5.131.131"}, "ts": "2023-07-25 02:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00391", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:40:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00391.326.326"}, "ts": "2023-07-25 02:40:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27732"}, "ts": "2023-07-25 02:40:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGB6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:41:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGB6.284.284"}, "ts": "2023-07-25 02:41:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3ZCN5.1079.1079"}, "ts": "2023-07-25 02:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ZCN5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 02:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57930PW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 02:41:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57930PW"}, "ts": "2023-07-25 02:41:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57930PW"}, "ts": "2023-07-25 02:41:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59324HL"}, "ts": "2023-07-25 02:41:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31089UT"}, "ts": "2023-07-25 02:41:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17385XL"}, "ts": "2023-07-25 02:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41250-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:42:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GUX7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 02:42:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GUX7"}, "ts": "2023-07-25 02:42:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10704531", "type": "PubMed"}, "ts": "2023-07-25 02:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10704531", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 02:45:23 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 02:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 02:45:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49748"}, "ts": "2023-07-25 02:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-25 02:45:44 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-25 02:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-25 02:45:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2WF71.374.374"}, "ts": "2023-07-25 02:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WF71", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00846", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:45:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:46:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56199"}, "ts": "2023-07-25 02:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56199", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:46:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-25 02:46:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09693", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 02:46:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09693", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 02:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09693", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 02:46:57 EDT-0400"}, {"api": "/supersearch/search/", "req": {"concept_query_list": [{"concept": "glycan", "query": {"aggregator": "$and", "aggregated_list": [], "unaggregated_list": [{"path": "names.name", "order": 0, "operator": "$eq", "string_value": "GNPTA"}]}}]}, "ts": "2023-07-25 02:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "Performing Super Search. Super Search query={\"concept_query_list\":[{\"concept\":\"glycan\",\"query\":{\"aggregator\":\"$and\",\"aggregated_list\":[],\"unaggregated_list\":[{\"path\":\"names.name\",\"order\":0,\"operator\":\"$eq\",\"string_value\":\"GNPTA\"}]}}]}"}, "ts": "2023-07-25 02:47:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 02:47:35 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 02:47:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 02:47:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77670FL"}, "ts": "2023-07-25 02:47:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 02:48:01 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 02:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 02:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:48:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMY3.483.483"}, "ts": "2023-07-25 02:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:48:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06213.1062.1062"}, "ts": "2023-07-25 02:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70372"}, "ts": "2023-07-25 02:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27665677", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:48:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27665677", "type": "PubMed"}, "ts": "2023-07-25 02:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-25 02:49:08 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 0, "max": 0}, {"residue": "hex", "min": 1, "max": 15}, {"residue": "hexnac", "min": 0, "max": 0}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 0, "max": 0}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-25 02:49:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">841a979f9fa29931dc5ceee519c4a7dd", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":0,\"max\":0},{\"residue\":\"hex\",\"min\":1,\"max\":15},{\"residue\":\"hexnac\",\"min\":0,\"max\":0},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":0,\"max\":0},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-25 02:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "841a979f9fa29931dc5ceee519c4a7dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 02:49:15 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "841a979f9fa29931dc5ceee519c4a7dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 02:49:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71142DF"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53402KW"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77865AH"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53868KU"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25559RS"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92865GI"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-25 02:49:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99375FM"}, "ts": "2023-07-25 02:49:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07133YY"}, "ts": "2023-07-25 02:49:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12733WO"}, "ts": "2023-07-25 02:49:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69791DF"}, "ts": "2023-07-25 02:49:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19275UG"}, "ts": "2023-07-25 02:49:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00059MO"}, "ts": "2023-07-25 02:49:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84224TW"}, "ts": "2023-07-25 02:49:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65889KE"}, "ts": "2023-07-25 02:49:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51056AN"}, "ts": "2023-07-25 02:49:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67988RO"}, "ts": "2023-07-25 02:49:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61491DK"}, "ts": "2023-07-25 02:49:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78074HX"}, "ts": "2023-07-25 02:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "841a979f9fa29931dc5ceee519c4a7dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 02:49:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "841a979f9fa29931dc5ceee519c4a7dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-25 02:49:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24432YB"}, "ts": "2023-07-25 02:49:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26039ES"}, "ts": "2023-07-25 02:49:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41155"}, "ts": "2023-07-25 02:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 02:50:05 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 02:50:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-25 02:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:50:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-25 02:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75113", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:50:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75113.280.280"}, "ts": "2023-07-25 02:50:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-25 02:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:51:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02652"}, "ts": "2023-07-25 02:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g00052mo", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 02:52:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 02:53:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34968", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 02:53:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P34968", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 02:53:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34968", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 02:53:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22660413", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 02:54:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22660413", "type": "PubMed"}, "ts": "2023-07-25 02:54:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20813", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 02:54:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P20813", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 02:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20813", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 02:54:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06804"}, "ts": "2023-07-25 02:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SI1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:55:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96SI1.31.31"}, "ts": "2023-07-25 02:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:56:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-25 02:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:56:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31944", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:56:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31944"}, "ts": "2023-07-25 02:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ32", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:56:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7TQ32.111.111"}, "ts": "2023-07-25 02:56:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68363"}, "ts": "2023-07-25 02:56:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UNA0.44.44"}, "ts": "2023-07-25 02:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 02:57:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N122"}, "ts": "2023-07-25 02:58:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UP52"}, "ts": "2023-07-25 02:58:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UP52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09326", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:58:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09326"}, "ts": "2023-07-25 02:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07901", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 02:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07901"}, "ts": "2023-07-25 02:58:49 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 03:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 03:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 03:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 03:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 03:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 03:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXB1"}, "ts": "2023-07-25 03:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:01:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62195"}, "ts": "2023-07-25 03:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01374", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:03:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01374.84.84"}, "ts": "2023-07-25 03:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDL5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:03:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDL5"}, "ts": "2023-07-25 03:03:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PAL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:03:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PAL1"}, "ts": "2023-07-25 03:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43404-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:03:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43404-1"}, "ts": "2023-07-25 03:03:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:04:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-25 03:04:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22061"}, "ts": "2023-07-25 03:04:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56749GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 03:04:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51681"}, "ts": "2023-07-25 03:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51681", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:04:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-25 03:05:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:05:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y487"}, "ts": "2023-07-25 03:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:05:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 03:05:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-25 03:05:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22625SJ"}, "ts": "2023-07-25 03:05:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26915XM"}, "ts": "2023-07-25 03:05:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 03:05:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-25 03:05:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-25 03:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60653", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:06:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60653.250.250"}, "ts": "2023-07-25 03:06:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T7N3.266.266"}, "ts": "2023-07-25 03:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7N3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:06:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBW0.129.129"}, "ts": "2023-07-25 03:06:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C075.131.131"}, "ts": "2023-07-25 03:07:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C075", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:07:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:08:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-25 03:08:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 03:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:08:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2K8"}, "ts": "2023-07-25 03:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:08:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 03:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:09:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P99-1"}, "ts": "2023-07-25 03:09:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 03:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95196", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 03:09:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95196"}, "ts": "2023-07-25 03:09:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10909-1"}, "ts": "2023-07-25 03:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10909-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30728"}, "ts": "2023-07-25 03:10:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30728", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:10:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000017"}, "ts": "2023-07-25 03:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-25 03:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-25 03:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-25 03:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26853435", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26853435", "type": "PubMed"}, "ts": "2023-07-25 03:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26854602", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:10:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26854602", "type": "PubMed"}, "ts": "2023-07-25 03:10:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSI4"}, "ts": "2023-07-25 03:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5U6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:10:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5U6-1"}, "ts": "2023-07-25 03:10:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06804", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:11:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQP3"}, "ts": "2023-07-25 03:11:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y210"}, "ts": "2023-07-25 03:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:12:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-25 03:12:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ3"}, "ts": "2023-07-25 03:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XFR0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:13:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XFR0-1"}, "ts": "2023-07-25 03:13:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBK8-2"}, "ts": "2023-07-25 03:13:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49815"}, "ts": "2023-07-25 03:13:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49815"}, "ts": "2023-07-25 03:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:13:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPF0"}, "ts": "2023-07-25 03:13:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52597.161.161"}, "ts": "2023-07-25 03:14:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52597", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:14:10 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 03:15:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 03:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 03:15:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-25 03:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 03:16:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 03:16:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 03:16:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-25 03:16:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-25 03:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75417", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:17:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75417.2239.2239"}, "ts": "2023-07-25 03:17:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28660"}, "ts": "2023-07-25 03:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-25 03:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:17:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z739"}, "ts": "2023-07-25 03:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07602", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 03:18:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P07602", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 03:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07602", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 03:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:18:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19506079", "type": "PubMed"}, "ts": "2023-07-25 03:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19506079", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7J5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:18:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7J5"}, "ts": "2023-07-25 03:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06748"}, "ts": "2023-07-25 03:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V94-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:19:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V94-1"}, "ts": "2023-07-25 03:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:20:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 03:21:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y615"}, "ts": "2023-07-25 03:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y615", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:21:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-25 03:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3P7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3P7"}, "ts": "2023-07-25 03:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:21:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGQ3"}, "ts": "2023-07-25 03:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:21:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKK6-1"}, "ts": "2023-07-25 03:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9160755", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:21:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9160755", "type": "PubMed"}, "ts": "2023-07-25 03:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6R2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:22:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6R2"}, "ts": "2023-07-25 03:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A932", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:22:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A932"}, "ts": "2023-07-25 03:22:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-25 03:23:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14859"}, "ts": "2023-07-25 03:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07235", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:25:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07235.325.325"}, "ts": "2023-07-25 03:25:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:25:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22017875", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:25:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22017875", "type": "PubMed"}, "ts": "2023-07-25 03:25:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16109"}, "ts": "2023-07-25 03:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW71", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:26:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BW71.400.400"}, "ts": "2023-07-25 03:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N423", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N423"}, "ts": "2023-07-25 03:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:28:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75417.2239.2239"}, "ts": "2023-07-25 03:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBK8-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:28:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-25 03:29:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49815", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:32:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZS5-1"}, "ts": "2023-07-25 03:32:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99896CG"}, "ts": "2023-07-25 03:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75475", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:32:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75475"}, "ts": "2023-07-25 03:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:33:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:34:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15390"}, "ts": "2023-07-25 03:34:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-25 03:34:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:34:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPD5"}, "ts": "2023-07-25 03:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 03:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 03:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01137", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01137"}, "ts": "2023-07-25 03:36:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BW71.400.400"}, "ts": "2023-07-25 03:37:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-25 03:37:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000086"}, "ts": "2023-07-25 03:37:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88487"}, "ts": "2023-07-25 03:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88487", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 03:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31689", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:38:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31689.120.120"}, "ts": "2023-07-25 03:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01137"}, "ts": "2023-07-25 03:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01137", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UH66", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:39:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UH66.1725.1725"}, "ts": "2023-07-25 03:39:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:39:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22961547", "type": "PubMed"}, "ts": "2023-07-25 03:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22961547", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03979", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:40:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P03979.106.106"}, "ts": "2023-07-25 03:40:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96N66-1.126.126"}, "ts": "2023-07-25 03:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19217410", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:40:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19217410", "type": "PubMed"}, "ts": "2023-07-25 03:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:40:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00391.449.449"}, "ts": "2023-07-25 03:40:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00391", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15399", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:41:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15399.292.292"}, "ts": "2023-07-25 03:41:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15175240", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:41:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15175240", "type": "PubMed"}, "ts": "2023-07-25 03:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:42:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10153"}, "ts": "2023-07-25 03:42:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q569A2-1"}, "ts": "2023-07-25 03:42:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q569A2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570"}, "ts": "2023-07-25 03:42:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:43:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20108-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20108-1"}, "ts": "2023-07-25 03:43:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:43:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:43:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:44:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11245982", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:44:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11245982", "type": "PubMed"}, "ts": "2023-07-25 03:44:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:44:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:44:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:44:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43432"}, "ts": "2023-07-25 03:44:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:44:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:44:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13233.697.697"}, "ts": "2023-07-25 03:44:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13233", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:44:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:45:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VYS8"}, "ts": "2023-07-25 03:45:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VYS8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 03:45:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35222.34.34"}, "ts": "2023-07-25 03:45:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:46:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7H5"}, "ts": "2023-07-25 03:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE23", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96I25", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 03:47:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96I25", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 03:47:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TE23.479.479"}, "ts": "2023-07-25 03:47:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15665823", "type": "PubMed"}, "ts": "2023-07-25 03:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15665823", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:48:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Y1.779.779"}, "ts": "2023-07-25 03:48:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B0I1T2.866.866"}, "ts": "2023-07-25 03:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0I1T2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VYY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:49:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VYY2"}, "ts": "2023-07-25 03:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:50:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLN9-1"}, "ts": "2023-07-25 03:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:51:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VZ2"}, "ts": "2023-07-25 03:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:52:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMC9"}, "ts": "2023-07-25 03:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14957-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 03:52:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14957-1"}, "ts": "2023-07-25 03:52:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-25 03:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 03:54:01 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 03:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 03:54:01 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 03:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 03:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 03:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19665017", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 03:54:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19665017", "type": "PubMed"}, "ts": "2023-07-25 03:54:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62852"}, "ts": "2023-07-25 03:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62852", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:55:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48023"}, "ts": "2023-07-25 03:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:56:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95208"}, "ts": "2023-07-25 03:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95208", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56UD9"}, "ts": "2023-07-25 03:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56UD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:56:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZWJ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:56:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZWJ1.276.276"}, "ts": "2023-07-25 03:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82094", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:56:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82094"}, "ts": "2023-07-25 03:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 03:57:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12968.551.551"}, "ts": "2023-07-25 03:57:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q499Z3"}, "ts": "2023-07-25 03:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q499Z3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 03:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY50", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:58:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY50"}, "ts": "2023-07-25 03:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 03:58:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NI72", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 03:59:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NI72"}, "ts": "2023-07-25 03:59:48 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 04:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 04:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 04:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 04:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 04:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:01:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:02:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14669"}, "ts": "2023-07-25 04:02:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:02:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:02:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25490"}, "ts": "2023-07-25 04:02:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:03:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5X9"}, "ts": "2023-07-25 04:03:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 04:03:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96I25", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 04:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G76055XW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:04:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76055XW"}, "ts": "2023-07-25 04:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:05:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC35"}, "ts": "2023-07-25 04:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:05:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78325.564.564"}, "ts": "2023-07-25 04:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78325", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62765SF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:06:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62765SF"}, "ts": "2023-07-25 04:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76036"}, "ts": "2023-07-25 04:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76036", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:06:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-25 04:06:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23766859", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:07:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23766859", "type": "PubMed"}, "ts": "2023-07-25 04:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00499", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:07:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00499.530.530"}, "ts": "2023-07-25 04:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13638-1"}, "ts": "2023-07-25 04:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61513"}, "ts": "2023-07-25 04:07:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15326"}, "ts": "2023-07-25 04:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15326", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:08:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:09:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y663"}, "ts": "2023-07-25 04:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31346990", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:09:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31346990", "type": "PubMed"}, "ts": "2023-07-25 04:09:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q67ET0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:10:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q67ET0"}, "ts": "2023-07-25 04:10:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:10:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 04:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70301", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 04:10:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70301"}, "ts": "2023-07-25 04:10:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q695T7"}, "ts": "2023-07-25 04:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q695T7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S52"}, "ts": "2023-07-25 04:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:12:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-25 04:12:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12235"}, "ts": "2023-07-25 04:12:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05067"}, "ts": "2023-07-25 04:13:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05067"}, "ts": "2023-07-25 04:13:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-25 04:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:14:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK65"}, "ts": "2023-07-25 04:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16539", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16539"}, "ts": "2023-07-25 04:14:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17888947", "type": "PubMed"}, "ts": "2023-07-25 04:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17888947", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:16:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:17:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15812"}, "ts": "2023-07-25 04:17:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:18:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02655"}, "ts": "2023-07-25 04:18:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y696", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y696"}, "ts": "2023-07-25 04:19:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 04:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 04:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 04:19:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 04:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43360", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:20:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43360.165.165"}, "ts": "2023-07-25 04:20:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09472-1"}, "ts": "2023-07-25 04:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09472-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08133"}, "ts": "2023-07-25 04:22:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17050-1"}, "ts": "2023-07-25 04:22:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63279.35.35"}, "ts": "2023-07-25 04:23:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13638-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:23:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20226.169.169"}, "ts": "2023-07-25 04:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20226", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:23:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04206"}, "ts": "2023-07-25 04:24:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04206", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:24:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CF98", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 04:25:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CF98"}, "ts": "2023-07-25 04:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:25:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H488"}, "ts": "2023-07-25 04:25:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 04:25:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 04:25:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06231AO"}, "ts": "2023-07-25 04:25:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73578JC"}, "ts": "2023-07-25 04:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22496338", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:26:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22496338", "type": "PubMed"}, "ts": "2023-07-25 04:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z863-1"}, "ts": "2023-07-25 04:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z863-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:27:11 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 04:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 04:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 04:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06110VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:27:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 04:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T754"}, "ts": "2023-07-25 04:27:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T754", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 04:27:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:27:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R2P8"}, "ts": "2023-07-25 04:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10196196", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:28:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10196196", "type": "PubMed"}, "ts": "2023-07-25 04:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PVX1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:28:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PVX1-1"}, "ts": "2023-07-25 04:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06110VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:28:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 04:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06110VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:28:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 04:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99467", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:29:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99467"}, "ts": "2023-07-25 04:29:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05067", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05067", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:29:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01504UZ"}, "ts": "2023-07-25 04:30:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04554QW"}, "ts": "2023-07-25 04:30:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07445YJ"}, "ts": "2023-07-25 04:30:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07617FP"}, "ts": "2023-07-25 04:30:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09609EN"}, "ts": "2023-07-25 04:30:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09986RD"}, "ts": "2023-07-25 04:30:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11052OE"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11568OK"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14153CY"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16404YH"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18559HW"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20640NX"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21477HL"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23450YU"}, "ts": "2023-07-25 04:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23799GS"}, "ts": "2023-07-25 04:30:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23874KQ"}, "ts": "2023-07-25 04:30:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24199RH"}, "ts": "2023-07-25 04:30:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25179PZ"}, "ts": "2023-07-25 04:30:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25984CA"}, "ts": "2023-07-25 04:30:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27327VV"}, "ts": "2023-07-25 04:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88780"}, "ts": "2023-07-25 04:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88780", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32301-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32301-1"}, "ts": "2023-07-25 04:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30048"}, "ts": "2023-07-25 04:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30048", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:32:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 04:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:33:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "20551172"}, "ts": "2023-07-25 04:33:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 04:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 04:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9N2K0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 04:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9N2K0"}, "ts": "2023-07-25 04:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76KF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:37:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76KF0"}, "ts": "2023-07-25 04:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14272"}, "ts": "2023-07-25 04:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14272", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75387"}, "ts": "2023-07-25 04:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75387", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08133", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17050-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:38:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81827"}, "ts": "2023-07-25 04:38:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94855"}, "ts": "2023-07-25 04:40:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-25 04:40:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-25 04:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:41:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11445644", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:41:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11445644", "type": "PubMed"}, "ts": "2023-07-25 04:41:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50281", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:41:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50281.291.291"}, "ts": "2023-07-25 04:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73578JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:41:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NG5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:42:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96NG5.106.106"}, "ts": "2023-07-25 04:42:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-25 04:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99598", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 04:42:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99598", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 04:42:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99598", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 04:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:43:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-25 04:44:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVB2"}, "ts": "2023-07-25 04:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:46:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVB2"}, "ts": "2023-07-25 04:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0K1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:46:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0K1.20.20"}, "ts": "2023-07-25 04:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46527", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 04:46:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P46527", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 04:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 04:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46527", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 04:46:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y3Z3.18.18"}, "ts": "2023-07-25 04:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3Z3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21850687", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:51:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21850687", "type": "PubMed"}, "ts": "2023-07-25 04:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-25 04:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3670305", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:52:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3670305", "type": "PubMed"}, "ts": "2023-07-25 04:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8016121", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:52:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8016121", "type": "PubMed"}, "ts": "2023-07-25 04:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20108", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:53:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "P20108", "type": "PubMed"}, "ts": "2023-07-25 04:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20108", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/115.0.0.0 Safari/537.36"}, "ts": "2023-07-25 04:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:53:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "P20108", "type": "PubMed"}, "ts": "2023-07-25 04:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20108", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20108", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/115.0.0.0 Safari/537.36"}, "ts": "2023-07-25 04:53:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07359"}, "ts": "2023-07-25 04:54:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12837766", "type": "PubMed"}, "ts": "2023-07-25 04:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12837766", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:54:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07477"}, "ts": "2023-07-25 04:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:55:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30038"}, "ts": "2023-07-25 04:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00924FH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 04:55:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00924FH"}, "ts": "2023-07-25 04:55:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25940.323.323"}, "ts": "2023-07-25 04:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R415", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R415"}, "ts": "2023-07-25 04:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25940", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16619"}, "ts": "2023-07-25 04:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16619", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:56:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12388744", "type": "PubMed"}, "ts": "2023-07-25 04:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12388744", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:56:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51580"}, "ts": "2023-07-25 04:56:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21217755", "type": "PubMed"}, "ts": "2023-07-25 04:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21217755", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:57:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75427"}, "ts": "2023-07-25 04:58:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55014.96.96"}, "ts": "2023-07-25 04:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55014", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 04:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 04:58:40 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 04:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 04:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1748288", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 04:59:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1748288", "type": "PubMed"}, "ts": "2023-07-25 04:59:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 04:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 05:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 05:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 05:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 05:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 05:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 05:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-25 05:00:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:01:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969X5"}, "ts": "2023-07-25 05:01:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 05:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91W98-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:01:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91W98-1"}, "ts": "2023-07-25 05:01:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-25 05:02:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000108"}, "ts": "2023-07-25 05:02:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z1R2.986.986"}, "ts": "2023-07-25 05:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1R2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:04:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES07"}, "ts": "2023-07-25 05:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:04:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES07"}, "ts": "2023-07-25 05:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:04:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14625"}, "ts": "2023-07-25 05:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75604", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:04:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75604.78.78"}, "ts": "2023-07-25 05:04:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-25 05:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZUT9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:04:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZUT9-1"}, "ts": "2023-07-25 05:04:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27546.447.447"}, "ts": "2023-07-25 05:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27546", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-25 05:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75923-1"}, "ts": "2023-07-25 05:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75923-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:07:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-25 05:07:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50990-1"}, "ts": "2023-07-25 05:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:07:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49225WK"}, "ts": "2023-07-25 05:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:10:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H943"}, "ts": "2023-07-25 05:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37173"}, "ts": "2023-07-25 05:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:10:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JVZ6-1"}, "ts": "2023-07-25 05:10:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JVZ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:10:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:10:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H79"}, "ts": "2023-07-25 05:10:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21588"}, "ts": "2023-07-25 05:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13362-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:11:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13362-1"}, "ts": "2023-07-25 05:11:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIU6.204.204"}, "ts": "2023-07-25 05:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIU6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z8N2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:11:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z8N2-1"}, "ts": "2023-07-25 05:11:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51580", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BXA1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:13:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BXA1-1"}, "ts": "2023-07-25 05:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:13:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUB3"}, "ts": "2023-07-25 05:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVQ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:13:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVQ4"}, "ts": "2023-07-25 05:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:14:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q67ET0"}, "ts": "2023-07-25 05:14:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCD5.460.460"}, "ts": "2023-07-25 05:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:14:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:14:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-25 05:14:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 05:14:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-25 05:14:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 05:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:14:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q09666.1854.1854"}, "ts": "2023-07-25 05:15:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D394-1"}, "ts": "2023-07-25 05:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D394-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19367"}, "ts": "2023-07-25 05:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19367", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:15:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00441"}, "ts": "2023-07-25 05:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:16:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55186"}, "ts": "2023-07-25 05:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:17:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUQ1"}, "ts": "2023-07-25 05:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:17:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4R8"}, "ts": "2023-07-25 05:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92791", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92791"}, "ts": "2023-07-25 05:17:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BS35"}, "ts": "2023-07-25 05:17:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13336.349.349"}, "ts": "2023-07-25 05:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13336", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BS35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 05:17:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9T6"}, "ts": "2023-07-25 05:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9T6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 05:18:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZI0-1"}, "ts": "2023-07-25 05:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZI0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:18:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:18:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-25 05:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:20:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75122.162.162"}, "ts": "2023-07-25 05:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:22:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05996"}, "ts": "2023-07-25 05:22:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-25 05:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:22:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451-1"}, "ts": "2023-07-25 05:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50990-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:23:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60570"}, "ts": "2023-07-25 05:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:24:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16615-1"}, "ts": "2023-07-25 05:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16615-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49225WK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 05:24:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60568"}, "ts": "2023-07-25 05:25:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z5A7"}, "ts": "2023-07-25 05:26:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:26:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8375396", "type": "PubMed"}, "ts": "2023-07-25 05:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8375396", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:27:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43405-1"}, "ts": "2023-07-25 05:27:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43405-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 05:27:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14944", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:27:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14944.47.47"}, "ts": "2023-07-25 05:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16619", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:28:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16619"}, "ts": "2023-07-25 05:28:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11439350", "type": "PubMed"}, "ts": "2023-07-25 05:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11439350", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80VP1"}, "ts": "2023-07-25 05:29:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80VP1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:29:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P81133.548.548"}, "ts": "2023-07-25 05:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81133", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:29:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K301"}, "ts": "2023-07-25 05:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K301", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:32:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88441"}, "ts": "2023-07-25 05:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q24JP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:33:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q24JP5"}, "ts": "2023-07-25 05:33:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JG6"}, "ts": "2023-07-25 05:33:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:33:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-25 05:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LML7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:33:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LML7"}, "ts": "2023-07-25 05:33:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47741", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:35:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47741.144.144"}, "ts": "2023-07-25 05:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:35:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55196"}, "ts": "2023-07-25 05:35:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60934.43.43"}, "ts": "2023-07-25 05:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60934", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64435", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 05:37:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q64435", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 05:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64435", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 05:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10564231", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:37:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10564231", "type": "PubMed"}, "ts": "2023-07-25 05:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12109"}, "ts": "2023-07-25 05:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 05:38:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 05:38:20 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 05:38:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 05:38:29 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 05:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 05:38:29 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 05:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "adrenomedulin", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Global Search"}, "ts": "2023-07-25 05:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 05:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 05:38:38 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "adrenomedulin"}, "ts": "2023-07-25 05:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "adrenomedulin", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=adrenomedulin"}, "ts": "2023-07-25 05:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "adrenomedullin", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Global Search"}, "ts": "2023-07-25 05:38:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 05:38:51 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "adrenomedullin"}, "ts": "2023-07-25 05:38:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 05:38:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "adrenomedullin", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=adrenomedullin"}, "ts": "2023-07-25 05:38:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6cb941176f5697f2080415b4bd6237a5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 05:38:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6cb941176f5697f2080415b4bd6237a5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 05:38:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 05:38:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 05:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 05:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:39:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y663"}, "ts": "2023-07-25 05:39:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:39:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 05:39:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-25 05:39:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-25 05:39:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-25 05:39:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ34-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:39:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQ34-1.58.58"}, "ts": "2023-07-25 05:39:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25940", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:39:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25940.323.323"}, "ts": "2023-07-25 05:39:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6cb941176f5697f2080415b4bd6237a5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 05:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6cb941176f5697f2080415b4bd6237a5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 05:39:45 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "adrenomedullin"}, "ts": "2023-07-25 05:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 05:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "adrenomedullin", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=adrenomedullin"}, "ts": "2023-07-25 05:39:51 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 05:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "98e5cda06ea58c8d94263d1056080b01", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 05:39:55 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "98e5cda06ea58c8d94263d1056080b01", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 05:39:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35318-1"}, "ts": "2023-07-25 05:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35318-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:40:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 05:40:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6F4"}, "ts": "2023-07-25 05:40:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6F4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:40:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49859SH"}, "ts": "2023-07-25 05:40:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49859SH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 05:40:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55808", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:41:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55808.7.7"}, "ts": "2023-07-25 05:41:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31000-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:41:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31000-1"}, "ts": "2023-07-25 05:41:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106-1"}, "ts": "2023-07-25 05:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10436176", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:43:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10436176", "type": "PubMed"}, "ts": "2023-07-25 05:43:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EST8"}, "ts": "2023-07-25 05:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EST8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:46:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442-1"}, "ts": "2023-07-25 05:46:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22677001", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:46:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22677001", "type": "PubMed"}, "ts": "2023-07-25 05:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:46:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P37287.217.217"}, "ts": "2023-07-25 05:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWB7"}, "ts": "2023-07-25 05:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51174"}, "ts": "2023-07-25 05:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12920229", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:49:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12920229", "type": "PubMed"}, "ts": "2023-07-25 05:49:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-25 05:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZSC1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:50:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZSC1-1"}, "ts": "2023-07-25 05:50:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 05:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6ND48", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 05:50:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "A6ND48", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 05:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6ND48", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 05:50:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-25 05:51:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8W4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:51:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8W4"}, "ts": "2023-07-25 05:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5E3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:52:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5E3.46.46"}, "ts": "2023-07-25 05:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43426"}, "ts": "2023-07-25 05:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10698936", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 05:54:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10698936", "type": "PubMed"}, "ts": "2023-07-25 05:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0G2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 05:54:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0G2"}, "ts": "2023-07-25 05:54:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-25 05:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43934", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:56:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43934"}, "ts": "2023-07-25 05:56:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00536-1"}, "ts": "2023-07-25 05:56:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00536-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:56:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2E6"}, "ts": "2023-07-25 05:56:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-25 05:56:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-25 05:57:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z410.356.356"}, "ts": "2023-07-25 05:57:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z410", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 05:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15509", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 05:58:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15509.184.184"}, "ts": "2023-07-25 05:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7-1"}, "ts": "2023-07-25 05:59:23 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 06:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 06:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 06:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 06:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 06:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 06:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-25 06:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWF2"}, "ts": "2023-07-25 06:00:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:00:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:00:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:01:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2V0"}, "ts": "2023-07-25 06:01:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVM1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:01:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVM1-1"}, "ts": "2023-07-25 06:01:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09775CH"}, "ts": "2023-07-25 06:02:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-25 06:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-25 06:03:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:03:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13671.96.96"}, "ts": "2023-07-25 06:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54227-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:03:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54227-1"}, "ts": "2023-07-25 06:03:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-25 06:03:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3099851", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:04:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3099851", "type": "PubMed"}, "ts": "2023-07-25 06:04:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:04:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04004", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:05:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04004"}, "ts": "2023-07-25 06:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQT9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 06:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQT9"}, "ts": "2023-07-25 06:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UW1"}, "ts": "2023-07-25 06:06:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:06:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33076"}, "ts": "2023-07-25 06:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33076", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:06:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35932"}, "ts": "2023-07-25 06:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:07:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BX17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BX17"}, "ts": "2023-07-25 06:07:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20647423", "type": "PubMed"}, "ts": "2023-07-25 06:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20647423", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:07:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13113", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:07:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13113.20.20"}, "ts": "2023-07-25 06:07:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78559"}, "ts": "2023-07-25 06:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78559", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:08:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MTJ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:08:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MTJ3-1"}, "ts": "2023-07-25 06:08:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52209"}, "ts": "2023-07-25 06:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55735"}, "ts": "2023-07-25 06:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:10:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01864"}, "ts": "2023-07-25 06:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01864", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 06:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:10:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02880"}, "ts": "2023-07-25 06:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q561R9"}, "ts": "2023-07-25 06:10:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q561R9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:10:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40198", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40198"}, "ts": "2023-07-25 06:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279"}, "ts": "2023-07-25 06:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:11:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-25 06:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:14:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14584"}, "ts": "2023-07-25 06:14:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91X56.340.340"}, "ts": "2023-07-25 06:14:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X56", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:14:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:15:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07750"}, "ts": "2023-07-25 06:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SQ4-1"}, "ts": "2023-07-25 06:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SQ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2J4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:16:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2J4"}, "ts": "2023-07-25 06:16:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3LI72.22.22"}, "ts": "2023-07-25 06:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI72", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:17:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-25 06:17:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17450144", "type": "PubMed"}, "ts": "2023-07-25 06:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17450144", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:18:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-25 06:18:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15104-1"}, "ts": "2023-07-25 06:18:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02671"}, "ts": "2023-07-25 06:18:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-25 06:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:20:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00391"}, "ts": "2023-07-25 06:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0N5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:20:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0N5"}, "ts": "2023-07-25 06:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5C1"}, "ts": "2023-07-25 06:20:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-25 06:20:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-25 06:20:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-25 06:20:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60923RB"}, "ts": "2023-07-25 06:20:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-25 06:20:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77582RK"}, "ts": "2023-07-25 06:20:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-25 06:20:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42962KI"}, "ts": "2023-07-25 06:20:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 06:20:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-25 06:20:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87051GH"}, "ts": "2023-07-25 06:20:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:20:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-25 06:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16377563", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:21:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16377563", "type": "PubMed"}, "ts": "2023-07-25 06:21:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94875"}, "ts": "2023-07-25 06:21:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-25 06:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35932", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:22:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61289"}, "ts": "2023-07-25 06:22:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31394-1"}, "ts": "2023-07-25 06:22:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29157QS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:23:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29157QS"}, "ts": "2023-07-25 06:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10664448", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:23:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10664448", "type": "PubMed"}, "ts": "2023-07-25 06:23:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ8"}, "ts": "2023-07-25 06:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:24:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-25 06:24:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUQ1"}, "ts": "2023-07-25 06:24:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:24:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81533KY"}, "ts": "2023-07-25 06:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81533KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29017"}, "ts": "2023-07-25 06:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29017", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60894"}, "ts": "2023-07-25 06:25:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30038"}, "ts": "2023-07-25 06:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:25:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J1G0"}, "ts": "2023-07-25 06:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J1G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:25:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30711"}, "ts": "2023-07-25 06:25:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-25 06:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULW2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 06:26:37 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9ULW2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 06:26:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULW2", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 06:26:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11418864", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:26:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11418864", "type": "PubMed"}, "ts": "2023-07-25 06:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:27:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-25 06:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:28:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01813"}, "ts": "2023-07-25 06:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:28:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-25 06:28:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20395510", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:28:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20395510", "type": "PubMed"}, "ts": "2023-07-25 06:28:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P55096", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 06:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55096", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 06:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55096", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 06:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NY19", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:29:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6NY19.293.293"}, "ts": "2023-07-25 06:29:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-25 06:30:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05682", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:30:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05682"}, "ts": "2023-07-25 06:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P161-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:30:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P161-1"}, "ts": "2023-07-25 06:30:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0F1.67.67"}, "ts": "2023-07-25 06:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:31:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36941"}, "ts": "2023-07-25 06:31:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IBS0"}, "ts": "2023-07-25 06:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IBS0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:31:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-25 06:31:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-25 06:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:33:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04350"}, "ts": "2023-07-25 06:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:33:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:34:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCU5"}, "ts": "2023-07-25 06:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:34:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43883"}, "ts": "2023-07-25 06:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:35:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGL3.7.7"}, "ts": "2023-07-25 06:35:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-25 06:35:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-25 06:35:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48552"}, "ts": "2023-07-25 06:35:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPA5"}, "ts": "2023-07-25 06:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94875", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:37:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-25 06:37:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70534", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:38:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70534"}, "ts": "2023-07-25 06:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:38:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28482"}, "ts": "2023-07-25 06:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28482", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:39:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2N3"}, "ts": "2023-07-25 06:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2N3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYN5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYN5"}, "ts": "2023-07-25 06:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCX5-1"}, "ts": "2023-07-25 06:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCX5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10092511", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:40:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10092511", "type": "PubMed"}, "ts": "2023-07-25 06:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58781JH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:42:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58781JH"}, "ts": "2023-07-25 06:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQ94"}, "ts": "2023-07-25 06:42:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76N89"}, "ts": "2023-07-25 06:43:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76N89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:43:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32298", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:43:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32298.469.469"}, "ts": "2023-07-25 06:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:43:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-25 06:43:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01924ZE"}, "ts": "2023-07-25 06:43:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMQ3"}, "ts": "2023-07-25 06:44:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:44:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:44:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71527NE"}, "ts": "2023-07-25 06:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71527NE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:45:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33142236", "type": "PubMed"}, "ts": "2023-07-25 06:45:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60660BN"}, "ts": "2023-07-25 06:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33142236", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVM1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:46:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVM1-1"}, "ts": "2023-07-25 06:46:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:46:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0K011-1"}, "ts": "2023-07-25 06:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0K011-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:47:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-25 06:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01871-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:47:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01871-1"}, "ts": "2023-07-25 06:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGV5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 06:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGV5"}, "ts": "2023-07-25 06:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 06:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:48:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3V7"}, "ts": "2023-07-25 06:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:48:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-25 06:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:49:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14645214", "type": "PubMed"}, "ts": "2023-07-25 06:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14645214", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14272", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14272"}, "ts": "2023-07-25 06:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUD1"}, "ts": "2023-07-25 06:50:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14272"}, "ts": "2023-07-25 06:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14272", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15555", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15555"}, "ts": "2023-07-25 06:50:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70207"}, "ts": "2023-07-25 06:50:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-25 06:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:51:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB6"}, "ts": "2023-07-25 06:51:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB6"}, "ts": "2023-07-25 06:51:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15502"}, "ts": "2023-07-25 06:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:52:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYL3"}, "ts": "2023-07-25 06:52:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N307-1"}, "ts": "2023-07-25 06:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N307-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:53:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ5"}, "ts": "2023-07-25 06:53:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ5"}, "ts": "2023-07-25 06:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2483933", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:53:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2483933", "type": "PubMed"}, "ts": "2023-07-25 06:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15205"}, "ts": "2023-07-25 06:54:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-25 06:54:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 06:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 06:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 06:54:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WI3"}, "ts": "2023-07-25 06:55:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WI3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 06:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38445"}, "ts": "2023-07-25 06:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCN5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 06:57:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NCN5.458.458"}, "ts": "2023-07-25 06:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:57:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKJ1"}, "ts": "2023-07-25 06:57:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4R8"}, "ts": "2023-07-25 06:58:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 06:58:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4099cd9eb24bf22ebf8a15eaa4276328", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 06:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "error", "page": "glycan-search", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-25 06:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01924ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 06:59:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12110184", "type": "PubMed"}, "ts": "2023-07-25 06:59:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12110184", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 06:59:57 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 07:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 07:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 07:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 07:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 07:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 07:00:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": ""}, "ts": "2023-07-25 07:00:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 07:01:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09693", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 07:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 07:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60660BN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:01:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": ""}, "ts": "2023-07-25 07:02:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80WG7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:02:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80WG7"}, "ts": "2023-07-25 07:02:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-25 07:02:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18065"}, "ts": "2023-07-25 07:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94531EZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:03:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-25 07:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KS0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:03:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KS0.130.130"}, "ts": "2023-07-25 07:03:53 EDT-0400"}, {"api": "/data/detail_download/", "req": {"id": "G17689DH", "type": "glycan_detail", "format": "json", "compressed": false}, "ts": "2023-07-25 07:03:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g29068fm"}, "ts": "2023-07-25 07:03:58 EDT-0400"}, {"api": "/data/list_download/", "req": {"id": "", "type": "glycan_list", "format": "csv", "compressed": false}, "ts": "2023-07-25 07:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70101JE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:04:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18593899", "type": "PubMed"}, "ts": "2023-07-25 07:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18593899", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 07:05:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-25 07:06:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C419", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 07:06:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C419"}, "ts": "2023-07-25 07:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U1J4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:06:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U1J4-1"}, "ts": "2023-07-25 07:06:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17742-1"}, "ts": "2023-07-25 07:07:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17742-1"}, "ts": "2023-07-25 07:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:07:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DL1"}, "ts": "2023-07-25 07:07:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVF4-1.1432.1432"}, "ts": "2023-07-25 07:07:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVF4-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:07:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q499E0"}, "ts": "2023-07-25 07:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q499E0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:07:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67778"}, "ts": "2023-07-25 07:07:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:07:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZY8"}, "ts": "2023-07-25 07:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:08:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9691087", "type": "PubMed"}, "ts": "2023-07-25 07:08:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9691087", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 07:08:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CW73"}, "ts": "2023-07-25 07:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CW73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTI5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:08:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NTI5.1033.1033"}, "ts": "2023-07-25 07:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12789", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:09:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12789.1840.1840"}, "ts": "2023-07-25 07:09:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01871-1"}, "ts": "2023-07-25 07:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01871-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:10:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78363"}, "ts": "2023-07-25 07:10:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30153-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:10:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:10:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56524-1"}, "ts": "2023-07-25 07:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35626"}, "ts": "2023-07-25 07:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:11:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-25 07:11:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZQ7.204.204"}, "ts": "2023-07-25 07:12:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15457-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15457-1"}, "ts": "2023-07-25 07:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-25 07:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:12:52 EDT-0400"}, {"api": "/data/detail_download/", "req": {"id": "G17689DH", "type": "glycan_detail", "format": "json", "compressed": false}, "ts": "2023-07-25 07:12:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-25 07:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25054", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:13:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25054"}, "ts": "2023-07-25 07:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:13:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54652-1"}, "ts": "2023-07-25 07:13:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:14:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D15"}, "ts": "2023-07-25 07:14:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04155"}, "ts": "2023-07-25 07:15:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM7.277.277"}, "ts": "2023-07-25 07:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GQ7"}, "ts": "2023-07-25 07:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCI5"}, "ts": "2023-07-25 07:15:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00493"}, "ts": "2023-07-25 07:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS00", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS00"}, "ts": "2023-07-25 07:15:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75027.466.466"}, "ts": "2023-07-25 07:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:15:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND83"}, "ts": "2023-07-25 07:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND83", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPS6"}, "ts": "2023-07-25 07:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11114383", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 07:15:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11114383", "type": "PubMed"}, "ts": "2023-07-25 07:15:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRL5"}, "ts": "2023-07-25 07:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRL5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-25 07:15:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11344.230.230"}, "ts": "2023-07-25 07:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11344", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:15:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00144"}, "ts": "2023-07-25 07:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:16:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHH9"}, "ts": "2023-07-25 07:16:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05112"}, "ts": "2023-07-25 07:16:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11110708", "type": "PubMed"}, "ts": "2023-07-25 07:16:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11110708", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 07:16:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZX3"}, "ts": "2023-07-25 07:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07349-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:17:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07349-1"}, "ts": "2023-07-25 07:17:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G28663KH"}, "ts": "2023-07-25 07:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G28663KH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:18:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08237"}, "ts": "2023-07-25 07:18:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47871.59.59"}, "ts": "2023-07-25 07:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47871", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:18:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-25 07:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18065", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-25 07:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULK2"}, "ts": "2023-07-25 07:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18206"}, "ts": "2023-07-25 07:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18206", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:20:19 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 07:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15321", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:20:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15321"}, "ts": "2023-07-25 07:20:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q58FF8"}, "ts": "2023-07-25 07:20:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q58FF8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:20:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:20:47 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 07:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:20:47 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 07:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:20:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-25 07:20:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14119"}, "ts": "2023-07-25 07:21:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD6"}, "ts": "2023-07-25 07:21:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:21:13 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 07:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:21:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13336"}, "ts": "2023-07-25 07:21:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13336", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:21:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PL5"}, "ts": "2023-07-25 07:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PL5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:22:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-25 07:22:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17742-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17742-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07947", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:23:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07947"}, "ts": "2023-07-25 07:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:23:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZD2"}, "ts": "2023-07-25 07:23:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-25 07:23:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6A5"}, "ts": "2023-07-25 07:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6A5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:25:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11232563", "type": "PubMed"}, "ts": "2023-07-25 07:25:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVB2"}, "ts": "2023-07-25 07:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:26:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MT3"}, "ts": "2023-07-25 07:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02760", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:26:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02760.307.307"}, "ts": "2023-07-25 07:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23526-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:26:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23526-1"}, "ts": "2023-07-25 07:26:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ4"}, "ts": "2023-07-25 07:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56524-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:27:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21453"}, "ts": "2023-07-25 07:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21453", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RRU1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:27:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2RRU1.652.652"}, "ts": "2023-07-25 07:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:27:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00534.325.325"}, "ts": "2023-07-25 07:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00534", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:27:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-25 07:27:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-25 07:28:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-25 07:28:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:28:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UE3"}, "ts": "2023-07-25 07:28:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50135"}, "ts": "2023-07-25 07:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70704", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:28:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70704.1126.1126"}, "ts": "2023-07-25 07:28:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-25 07:29:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21506", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:29:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21506"}, "ts": "2023-07-25 07:29:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51970"}, "ts": "2023-07-25 07:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:29:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53618"}, "ts": "2023-07-25 07:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54652-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AEP3"}, "ts": "2023-07-25 07:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AEP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:30:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACU7"}, "ts": "2023-07-25 07:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACU7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BT18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:31:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BT18"}, "ts": "2023-07-25 07:31:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70257.288.288"}, "ts": "2023-07-25 07:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70257", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:31:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10499.446.446"}, "ts": "2023-07-25 07:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10499", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:31:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82576YO"}, "ts": "2023-07-25 07:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82576YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:31:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-25 07:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1M3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:33:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1M3"}, "ts": "2023-07-25 07:33:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1M3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:33:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1M3"}, "ts": "2023-07-25 07:33:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:33:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JXN0"}, "ts": "2023-07-25 07:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JXN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5MNZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:35:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5MNZ9"}, "ts": "2023-07-25 07:35:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000122"}, "ts": "2023-07-25 07:35:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95428"}, "ts": "2023-07-25 07:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:35:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H4A3.1757.1757"}, "ts": "2023-07-25 07:35:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15382"}, "ts": "2023-07-25 07:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15382", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:36:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZU2.982.982"}, "ts": "2023-07-25 07:36:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83461WR"}, "ts": "2023-07-25 07:36:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14119", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:37:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95155"}, "ts": "2023-07-25 07:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:37:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKB5"}, "ts": "2023-07-25 07:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "disclaimer", "message": "page access"}, "ts": "2023-07-25 07:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "disclaimer", "message": "page access"}, "ts": "2023-07-25 07:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DER2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:37:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DER2-1"}, "ts": "2023-07-25 07:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31751", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:38:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31751.371.371"}, "ts": "2023-07-25 07:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:38:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30044"}, "ts": "2023-07-25 07:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:38:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15887"}, "ts": "2023-07-25 07:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR16"}, "ts": "2023-07-25 07:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR16", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 07:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42704", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 07:39:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42704"}, "ts": "2023-07-25 07:39:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q498E2-1"}, "ts": "2023-07-25 07:39:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q498E2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:39:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTS7"}, "ts": "2023-07-25 07:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:40:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14950.20.20"}, "ts": "2023-07-25 07:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14950", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:41:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFP9"}, "ts": "2023-07-25 07:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10499-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10499-1"}, "ts": "2023-07-25 07:41:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75475.62.62"}, "ts": "2023-07-25 07:41:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75475", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHF7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:42:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHF7.751.751"}, "ts": "2023-07-25 07:42:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000109"}, "ts": "2023-07-25 07:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11052OE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:43:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11052OE"}, "ts": "2023-07-25 07:43:28 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 07:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 07:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:44:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50135", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:44:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "H3BV60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:45:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "H3BV60"}, "ts": "2023-07-25 07:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:46:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49238"}, "ts": "2023-07-25 07:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84467IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 07:48:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0H5"}, "ts": "2023-07-25 07:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0H5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 07:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U44"}, "ts": "2023-07-25 07:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:49:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14139"}, "ts": "2023-07-25 07:49:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPY3"}, "ts": "2023-07-25 07:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:49:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00051MO"}, "ts": "2023-07-25 07:50:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30926", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30926"}, "ts": "2023-07-25 07:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83461WR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 07:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:52:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48431"}, "ts": "2023-07-25 07:52:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:53:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHW4"}, "ts": "2023-07-25 07:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 07:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10894800", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 07:53:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10894800", "type": "PubMed"}, "ts": "2023-07-25 07:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30044", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:54:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19838.423.423"}, "ts": "2023-07-25 07:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97384-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 07:54:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P97384-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 07:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97384-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 07:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:55:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40189.555.555"}, "ts": "2023-07-25 07:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40189", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8G8"}, "ts": "2023-07-25 07:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00571"}, "ts": "2023-07-25 07:56:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30291.123.123"}, "ts": "2023-07-25 07:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30291", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 07:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68D85"}, "ts": "2023-07-25 07:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68D85", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:58:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0U6"}, "ts": "2023-07-25 07:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0U6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:58:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96E22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:58:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96E22"}, "ts": "2023-07-25 07:58:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0R8-1"}, "ts": "2023-07-25 07:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0R8-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 07:59:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GQ7"}, "ts": "2023-07-25 07:59:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 07:59:50 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 08:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 08:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 08:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 08:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 08:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 08:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AEP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AEP3"}, "ts": "2023-07-25 08:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94907"}, "ts": "2023-07-25 08:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11226-1"}, "ts": "2023-07-25 08:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78800HY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:00:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78800HY"}, "ts": "2023-07-25 08:00:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08771DC"}, "ts": "2023-07-25 08:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08771DC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:01:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64449"}, "ts": "2023-07-25 08:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64449", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES07"}, "ts": "2023-07-25 08:02:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES07"}, "ts": "2023-07-25 08:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV31"}, "ts": "2023-07-25 08:02:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42677"}, "ts": "2023-07-25 08:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42677", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYW2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:02:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYW2"}, "ts": "2023-07-25 08:02:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000088"}, "ts": "2023-07-25 08:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:03:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95347"}, "ts": "2023-07-25 08:03:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:03:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHV4"}, "ts": "2023-07-25 08:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:04:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28190459", "type": "PubMed"}, "ts": "2023-07-25 08:04:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28190459", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 08:04:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12319", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:05:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12319"}, "ts": "2023-07-25 08:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:06:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQQ3"}, "ts": "2023-07-25 08:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PVX1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:07:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PVX1-1"}, "ts": "2023-07-25 08:07:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06211"}, "ts": "2023-07-25 08:07:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:07:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZRT6.150.150"}, "ts": "2023-07-25 08:09:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRT6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31316511", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 08:09:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31316511", "type": "PubMed"}, "ts": "2023-07-25 08:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:10:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D98"}, "ts": "2023-07-25 08:11:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-25 08:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:12:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4R8"}, "ts": "2023-07-25 08:12:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:12:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61221"}, "ts": "2023-07-25 08:12:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24311", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:13:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24311.59.59"}, "ts": "2023-07-25 08:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78509", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:13:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78509.1266.1266"}, "ts": "2023-07-25 08:13:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM21"}, "ts": "2023-07-25 08:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:13:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4KMQ2.361.361"}, "ts": "2023-07-25 08:13:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFW7-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 08:14:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFW7-1"}, "ts": "2023-07-25 08:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MVW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:15:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MVW0"}, "ts": "2023-07-25 08:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:15:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVP5.13.13"}, "ts": "2023-07-25 08:15:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQD2"}, "ts": "2023-07-25 08:15:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:15:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80U58.82.82"}, "ts": "2023-07-25 08:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80U58", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:16:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11226-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEA2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 08:17:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEA2"}, "ts": "2023-07-25 08:17:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEA2", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 08:17:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000074"}, "ts": "2023-07-25 08:17:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07492"}, "ts": "2023-07-25 08:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07492"}, "ts": "2023-07-25 08:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q587J8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:20:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q587J8.207.207"}, "ts": "2023-07-25 08:20:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XX4"}, "ts": "2023-07-25 08:20:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS84"}, "ts": "2023-07-25 08:20:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS84", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 08:20:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-25 08:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DFW4"}, "ts": "2023-07-25 08:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DFW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30837", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:22:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30837"}, "ts": "2023-07-25 08:22:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052"}, "ts": "2023-07-25 08:22:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50429"}, "ts": "2023-07-25 08:22:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53007"}, "ts": "2023-07-25 08:23:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6JVE9"}, "ts": "2023-07-25 08:24:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6JVE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:24:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXK5"}, "ts": "2023-07-25 08:25:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80098"}, "ts": "2023-07-25 08:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39060-3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:26:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39060-3.731.731"}, "ts": "2023-07-25 08:26:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31648-1"}, "ts": "2023-07-25 08:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31648-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:26:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 08:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-25 08:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:26:54 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 08:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-25 08:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:26:56 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 08:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-25 08:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:27:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 08:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-25 08:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 08:27:21 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "undefined"}, "ts": "2023-07-25 08:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 08:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "undefined", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=undefined"}, "ts": "2023-07-25 08:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 08:27:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 08:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-25 08:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 08:27:52 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "undefined"}, "ts": "2023-07-25 08:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 08:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "undefined", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=undefined"}, "ts": "2023-07-25 08:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XHX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:27:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XHX5"}, "ts": "2023-07-25 08:27:59 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 08:27:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 08:27:59 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 08:27:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 08:28:12 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 08:28:12 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 08:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 08:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61221", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:28:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14764", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14764"}, "ts": "2023-07-25 08:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:30:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04155"}, "ts": "2023-07-25 08:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:30:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RI0"}, "ts": "2023-07-25 08:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15469410", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 08:32:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15469410", "type": "PubMed"}, "ts": "2023-07-25 08:32:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-25 08:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQV6-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 08:33:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9CQV6-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 08:33:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQV6-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 08:33:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 08:33:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-25 08:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:33:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPU9"}, "ts": "2023-07-25 08:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88677-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:33:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88677-1"}, "ts": "2023-07-25 08:33:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07492", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07492", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RUS2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:35:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RUS2"}, "ts": "2023-07-25 08:35:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11217", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:36:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11217"}, "ts": "2023-07-25 08:36:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T6X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X5"}, "ts": "2023-07-25 08:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15408"}, "ts": "2023-07-25 08:36:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84224TW"}, "ts": "2023-07-25 08:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84224TW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:36:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-25 08:36:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54707"}, "ts": "2023-07-25 08:37:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-25 08:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:37:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62178"}, "ts": "2023-07-25 08:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A523"}, "ts": "2023-07-25 08:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A523", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46952"}, "ts": "2023-07-25 08:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46952", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:37:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60412", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60412"}, "ts": "2023-07-25 08:38:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16676"}, "ts": "2023-07-25 08:38:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16676", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:38:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C7D2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:39:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C7D2-1"}, "ts": "2023-07-25 08:39:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-25 08:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66163OV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11589703", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 08:39:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11589703", "type": "PubMed"}, "ts": "2023-07-25 08:39:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9EQF4-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 08:39:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQF4-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 08:39:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQF4-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 08:39:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:39:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJX5"}, "ts": "2023-07-25 08:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46087", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:39:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46087"}, "ts": "2023-07-25 08:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D4V0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:40:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D4V0-1"}, "ts": "2023-07-25 08:40:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15371"}, "ts": "2023-07-25 08:40:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32519"}, "ts": "2023-07-25 08:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:41:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX47"}, "ts": "2023-07-25 08:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WR7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 08:43:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q86WR7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 08:43:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WR7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 08:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YBV0"}, "ts": "2023-07-25 08:43:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-25 08:43:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-25 08:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:43:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37231"}, "ts": "2023-07-25 08:44:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922M3-1"}, "ts": "2023-07-25 08:44:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922M3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:44:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55231NA"}, "ts": "2023-07-25 08:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55231NA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:44:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q18PE1"}, "ts": "2023-07-25 08:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q18PE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:44:18 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P29279", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 08:44:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29279", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 08:44:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29279", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 08:44:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:45:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVP5.13.13"}, "ts": "2023-07-25 08:45:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75096"}, "ts": "2023-07-25 08:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20160"}, "ts": "2023-07-25 08:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20160", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:46:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60237"}, "ts": "2023-07-25 08:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4ZYQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:47:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4ZYQ5"}, "ts": "2023-07-25 08:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8K8V0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:47:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8K8V0.334.334"}, "ts": "2023-07-25 08:47:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000087"}, "ts": "2023-07-25 08:47:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:48:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18414FL"}, "ts": "2023-07-25 08:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18414FL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:48:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18414FL"}, "ts": "2023-07-25 08:48:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48927BJ"}, "ts": "2023-07-25 08:48:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21161GI"}, "ts": "2023-07-25 08:48:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45728EK"}, "ts": "2023-07-25 08:48:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-25 08:48:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20700-1"}, "ts": "2023-07-25 08:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-25 08:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 08:48:53 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 08:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 08:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:49:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:49:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04264"}, "ts": "2023-07-25 08:49:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DF27"}, "ts": "2023-07-25 08:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DF27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A577", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:49:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13637"}, "ts": "2023-07-25 08:49:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A577"}, "ts": "2023-07-25 08:49:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07947", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:49:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07947"}, "ts": "2023-07-25 08:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:50:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04118"}, "ts": "2023-07-25 08:50:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:50:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14669.85.85"}, "ts": "2023-07-25 08:50:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91368RN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:50:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:50:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91368RN"}, "ts": "2023-07-25 08:50:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32030CB"}, "ts": "2023-07-25 08:50:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91368RN"}, "ts": "2023-07-25 08:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91368RN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 08:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99805"}, "ts": "2023-07-25 08:51:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-25 08:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15408", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:52:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-25 08:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:52:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16112"}, "ts": "2023-07-25 08:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35821"}, "ts": "2023-07-25 08:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35821", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LA6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:55:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LA6.293.293"}, "ts": "2023-07-25 08:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 08:56:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYE4"}, "ts": "2023-07-25 08:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:56:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-25 08:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:56:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40688"}, "ts": "2023-07-25 08:56:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:57:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06576"}, "ts": "2023-07-25 08:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:57:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:57:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96F46"}, "ts": "2023-07-25 08:57:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-25 08:58:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275"}, "ts": "2023-07-25 08:59:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P29279", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 08:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29279", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 08:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29279", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 08:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1U4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 08:59:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1U4"}, "ts": "2023-07-25 09:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 09:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 09:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 09:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 09:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 09:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 09:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:00:38 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 09:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:00:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23526"}, "ts": "2023-07-25 09:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23526", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13621", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:00:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13621"}, "ts": "2023-07-25 09:00:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 09:01:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCG1-1"}, "ts": "2023-07-25 09:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCG1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20293", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:02:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20293"}, "ts": "2023-07-25 09:02:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32314"}, "ts": "2023-07-25 09:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89001", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:03:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O89001.1067.1067"}, "ts": "2023-07-25 09:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:03:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12150153", "type": "PubMed"}, "ts": "2023-07-25 09:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12150153", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY11"}, "ts": "2023-07-25 09:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20700-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:04:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:04:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RP9"}, "ts": "2023-07-25 09:04:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15907"}, "ts": "2023-07-25 09:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876"}, "ts": "2023-07-25 09:04:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98179", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:04:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98179"}, "ts": "2023-07-25 09:04:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-25 09:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:05:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:05:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-25 09:06:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI33", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:06:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UI33.370.370"}, "ts": "2023-07-25 09:06:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q18PE1"}, "ts": "2023-07-25 09:06:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q18PE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:06:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:06:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-25 09:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UII5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:07:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UII5"}, "ts": "2023-07-25 09:07:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-25 09:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50045TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:07:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-25 09:07:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IC83.127.127"}, "ts": "2023-07-25 09:08:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IC83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:08:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921V7"}, "ts": "2023-07-25 09:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTH9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:08:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VTH9.470.470"}, "ts": "2023-07-25 09:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:08:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80Z10"}, "ts": "2023-07-25 09:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80Z10", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:10:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14625-1.774.774"}, "ts": "2023-07-25 09:10:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K592"}, "ts": "2023-07-25 09:11:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K592", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:11:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-25 09:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1Y3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:11:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1Y3-1"}, "ts": "2023-07-25 09:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI33", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:11:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UI33.511.511"}, "ts": "2023-07-25 09:11:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-25 09:11:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:11:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13500"}, "ts": "2023-07-25 09:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13500", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42666HT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:12:13 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 09:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:12:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y277"}, "ts": "2023-07-25 09:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:13:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19814"}, "ts": "2023-07-25 09:13:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 09:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVQ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVQ4"}, "ts": "2023-07-25 09:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 09:14:07 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 09:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 09:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 09:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 09:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:14:15 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "mucin 2", "term_category": "any"}, "ts": "2023-07-25 09:14:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-25 09:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 09:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c41d3b231a7ae96b8e64de5cd8e0a7a9", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"mucin 2\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:15:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19336478", "type": "PubMed"}, "ts": "2023-07-25 09:15:04 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 09:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c41d3b231a7ae96b8e64de5cd8e0a7a9", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 09:15:05 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "c41d3b231a7ae96b8e64de5cd8e0a7a9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 09:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19336478", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02817-1"}, "ts": "2023-07-25 09:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:15:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00035MO"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03172PR"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03494YC"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03674DU"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07932PU"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19399OS"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23438NR"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23870PO"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25780HH"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26915XM"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27726WH"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29025YS"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30304IT"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-25 09:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35520"}, "ts": "2023-07-25 09:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62635-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:15:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62635-1"}, "ts": "2023-07-25 09:15:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00219VH"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01351CD"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02856QE"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04908IA"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06116KH"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10013HB"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12035CL"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12678YV"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12679QG"}, "ts": "2023-07-25 09:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16831PL"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17236TT"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20165PS"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22355FZ"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23755RZ"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23990GP"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25340RJ"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26724PP"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26777KI"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29166US"}, "ts": "2023-07-25 09:15:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16288", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15279782", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:16:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15279782", "type": "PubMed"}, "ts": "2023-07-25 09:16:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16288.162.162"}, "ts": "2023-07-25 09:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y253"}, "ts": "2023-07-25 09:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MUC5aC", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-25 09:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 09:16:51 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "MUC5aC"}, "ts": "2023-07-25 09:16:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 09:16:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MUC5aC", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=MUC5aC"}, "ts": "2023-07-25 09:16:51 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 09:16:55 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "711d0e5611069f0fb73452365bea102c", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 09:16:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "711d0e5611069f0fb73452365bea102c", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 09:16:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37043KH"}, "ts": "2023-07-25 09:16:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37043KH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:16:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14145"}, "ts": "2023-07-25 09:16:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:16:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37043KH"}, "ts": "2023-07-25 09:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10331BX"}, "ts": "2023-07-25 09:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-25 09:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-25 09:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 09:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39446WN"}, "ts": "2023-07-25 09:16:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20034JD"}, "ts": "2023-07-25 09:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:17:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088-1"}, "ts": "2023-07-25 09:17:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42665KV"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38887TM"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315FS"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20148946", "type": "PubMed"}, "ts": "2023-07-25 09:17:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20148946", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14145", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:17:07 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 09:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "711d0e5611069f0fb73452365bea102c", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 09:17:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "711d0e5611069f0fb73452365bea102c", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 09:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYY6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:17:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYY6"}, "ts": "2023-07-25 09:17:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9QAQ8-1"}, "ts": "2023-07-25 09:17:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9QAQ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:17:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYY6", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 09:17:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-25 09:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:17:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LT42-1"}, "ts": "2023-07-25 09:17:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LT42-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:17:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19560569", "type": "PubMed"}, "ts": "2023-07-25 09:18:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19560569", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:18:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04792"}, "ts": "2023-07-25 09:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04792", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-25 09:19:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16665"}, "ts": "2023-07-25 09:19:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29317"}, "ts": "2023-07-25 09:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00505", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:20:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00505"}, "ts": "2023-07-25 09:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14683"}, "ts": "2023-07-25 09:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14683", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:20:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z4T8.356.356"}, "ts": "2023-07-25 09:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4T8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:20:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04075"}, "ts": "2023-07-25 09:21:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15050.75.75"}, "ts": "2023-07-25 09:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15050", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:22:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46531"}, "ts": "2023-07-25 09:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB80", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:23:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TB80.379.379"}, "ts": "2023-07-25 09:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25025", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:23:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25025"}, "ts": "2023-07-25 09:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:24:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21596819", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:24:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21596819", "type": "PubMed"}, "ts": "2023-07-25 09:24:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01591"}, "ts": "2023-07-25 09:24:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14567YG"}, "ts": "2023-07-25 09:24:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:24:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14669.85.85"}, "ts": "2023-07-25 09:24:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07585"}, "ts": "2023-07-25 09:25:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6M0"}, "ts": "2023-07-25 09:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:25:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27169"}, "ts": "2023-07-25 09:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27169", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:25:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-25 09:25:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-25 09:25:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-25 09:25:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27947YN"}, "ts": "2023-07-25 09:25:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23453IV"}, "ts": "2023-07-25 09:25:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24954UD"}, "ts": "2023-07-25 09:25:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-25 09:25:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-25 09:26:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-25 09:26:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-25 09:26:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-25 09:26:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 09:26:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-25 09:26:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57776ZU"}, "ts": "2023-07-25 09:26:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59626AS"}, "ts": "2023-07-25 09:26:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-25 09:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-25 09:26:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZQ1"}, "ts": "2023-07-25 09:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25940-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:26:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-25 09:26:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25940-1"}, "ts": "2023-07-25 09:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYM9"}, "ts": "2023-07-25 09:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61916"}, "ts": "2023-07-25 09:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:27:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-25 09:27:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78348"}, "ts": "2023-07-25 09:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78348", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10767", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 09:27:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P10767", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 09:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10767", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 09:27:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNP9"}, "ts": "2023-07-25 09:28:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55231NA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:28:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55231NA"}, "ts": "2023-07-25 09:28:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14136"}, "ts": "2023-07-25 09:28:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56202TA"}, "ts": "2023-07-25 09:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56202TA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:28:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75179-1"}, "ts": "2023-07-25 09:28:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DP30"}, "ts": "2023-07-25 09:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP30", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:29:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31457FJ"}, "ts": "2023-07-25 09:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31457FJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:30:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31457FJ"}, "ts": "2023-07-25 09:30:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-25 09:30:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21161GI"}, "ts": "2023-07-25 09:30:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48927BJ"}, "ts": "2023-07-25 09:30:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97067QW"}, "ts": "2023-07-25 09:30:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-25 09:30:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43252"}, "ts": "2023-07-25 09:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:31:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-25 09:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHW3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:32:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHW3-1"}, "ts": "2023-07-25 09:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11627", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:32:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11627.1247.1247"}, "ts": "2023-07-25 09:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHW9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:33:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHW9.990.990"}, "ts": "2023-07-25 09:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:34:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G148", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:34:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G148"}, "ts": "2023-07-25 09:34:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35354", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:34:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35354.293.293"}, "ts": "2023-07-25 09:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60713GB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:35:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60713GB"}, "ts": "2023-07-25 09:35:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UNA4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:35:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UNA4-1"}, "ts": "2023-07-25 09:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16665", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:35:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZP8-1"}, "ts": "2023-07-25 09:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZP8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AIV8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:36:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AIV8.231.231"}, "ts": "2023-07-25 09:36:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5C9Z4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:36:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5C9Z4"}, "ts": "2023-07-25 09:36:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-25 09:37:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:37:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "19478460"}, "ts": "2023-07-25 09:37:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 09:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:37:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11465.20.20"}, "ts": "2023-07-25 09:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11465", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NHR9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:37:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NHR9.760.760"}, "ts": "2023-07-25 09:37:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33896"}, "ts": "2023-07-25 09:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:40:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02680"}, "ts": "2023-07-25 09:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02680", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07585", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:41:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NB91"}, "ts": "2023-07-25 09:41:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NB91", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 09:41:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-25 09:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19583974", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:42:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19583974", "type": "PubMed"}, "ts": "2023-07-25 09:42:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q640M1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q640M1"}, "ts": "2023-07-25 09:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LT42-1"}, "ts": "2023-07-25 09:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LT42-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14136", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75179-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03951", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:44:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P03951.126.126"}, "ts": "2023-07-25 09:44:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42765"}, "ts": "2023-07-25 09:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75911", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:47:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75911.266.266"}, "ts": "2023-07-25 09:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070-1"}, "ts": "2023-07-25 09:47:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-25 09:47:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-25 09:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:48:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:48:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUD1"}, "ts": "2023-07-25 09:48:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:48:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:48:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:48:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14584"}, "ts": "2023-07-25 09:48:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-25 09:48:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYY1"}, "ts": "2023-07-25 09:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:48:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96T91"}, "ts": "2023-07-25 09:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:48:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41218"}, "ts": "2023-07-25 09:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41218", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:48:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29508"}, "ts": "2023-07-25 09:49:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000006"}, "ts": "2023-07-25 09:50:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17506785", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:50:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99PU7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 09:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PU7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 09:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PU7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 09:50:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46093"}, "ts": "2023-07-25 09:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46093", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AHZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AHZ1"}, "ts": "2023-07-25 09:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-25 09:50:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13315"}, "ts": "2023-07-25 09:50:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-25 09:51:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75140"}, "ts": "2023-07-25 09:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02549", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:51:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02549.358.358"}, "ts": "2023-07-25 09:51:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5W0B7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:51:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5W0B7"}, "ts": "2023-07-25 09:51:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_detail.html", "message": "page access"}, "ts": "2023-07-25 09:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein_detail.html", "message": "Disabled Logging"}, "ts": "2023-07-25 09:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "Disabled Logging"}, "ts": "2023-07-25 09:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:51:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22756.725.725"}, "ts": "2023-07-25 09:51:58 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 09:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22756", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:51:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13258"}, "ts": "2023-07-25 09:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-25 09:52:10 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-25 09:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-25 09:52:11 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 09:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCG1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:52:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCG1-1"}, "ts": "2023-07-25 09:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:52:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZC3"}, "ts": "2023-07-25 09:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:52:24 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:52:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96N66-1", "cluster_type": "unselected"}, "ts": "2023-07-25 09:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N66-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 09:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N66-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 09:52:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H2S6-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 09:52:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 09:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2S6-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 09:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2S6-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 09:52:27 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "B4GALT1", "term_category": "any"}, "ts": "2023-07-25 09:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8013e80eec05ee61bb33e3dd3138eeb0", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"B4GALT1\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:52:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 09:52:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 09:52:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63889NK"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91365ZQ"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79809MM"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53752TA"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-25 09:52:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80108"}, "ts": "2023-07-25 09:52:36 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:52:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 09:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-25 09:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:53:04 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "EDEM3", "term_category": "any"}, "ts": "2023-07-25 09:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0>e4f4f36d0543ec14cc0f25c666e0f36f", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"EDEM3\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 09:53:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:53:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 09:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-25 09:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 09:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-25 09:53:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-25 09:53:06 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:53:12 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 09:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:53:24 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "SERPINC1", "term_category": "any"}, "ts": "2023-07-25 09:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f>6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"SERPINC1\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:53:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 09:53:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-25 09:53:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-25 09:53:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-25 09:53:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46902YN"}, "ts": "2023-07-25 09:53:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-25 09:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:53:50 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:53:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 09:53:51 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "PMM2", "term_category": "any"}, "ts": "2023-07-25 09:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"PMM2\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:53:57 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "PMM2", "term_category": "any"}, "ts": "2023-07-25 09:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"PMM2\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:54:03 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "PMM2", "term_category": "any"}, "ts": "2023-07-25 09:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"PMM2\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:54:04 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "MPI", "term_category": "any"}, "ts": "2023-07-25 09:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"MPI\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01063", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 09:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 09:54:21 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "SERPINC1", "term_category": "any"}, "ts": "2023-07-25 09:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e>6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"SERPINC1\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 09:54:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 09:54:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q01063", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 09:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01063", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 09:54:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-25 09:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:54:25 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 09:54:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:54:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:54:26 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:54:26 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:54:26 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6eb980ea2300c7fcb8ebf7e69c5a106e", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "Search modification initiated"}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e4f4f36d0543ec14cc0f25c666e0f36f", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:54:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8013e80eec05ee61bb33e3dd3138eeb0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 09:54:28 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 09:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 09:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "error", "page": "glycan-search", "message": "Network error. search_init api call. Mozilla/5.0 (X11; Ubuntu; Linux x86_64; rv:109.0) Gecko/20100101 Firefox/114.0"}, "ts": "2023-07-25 09:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "error", "page": "glycan-search", "message": "Network error. list api call. Mozilla/5.0 (X11; Ubuntu; Linux x86_64; rv:109.0) Gecko/20100101 Firefox/114.0"}, "ts": "2023-07-25 09:54:29 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 09:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05014UV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:55:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05014UV"}, "ts": "2023-07-25 09:55:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05014UV"}, "ts": "2023-07-25 09:55:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 09:55:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-25 09:55:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20034JD"}, "ts": "2023-07-25 09:55:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39446WN"}, "ts": "2023-07-25 09:55:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10331BX"}, "ts": "2023-07-25 09:55:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8052633", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 09:56:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8052633", "type": "PubMed"}, "ts": "2023-07-25 09:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98179", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:56:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98179"}, "ts": "2023-07-25 09:56:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31629.1283.1283"}, "ts": "2023-07-25 09:56:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31629", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:56:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-25 09:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70994MS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:57:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-25 09:57:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 09:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H173", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 09:57:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H173.73.73"}, "ts": "2023-07-25 09:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64394MX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:57:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T8D3"}, "ts": "2023-07-25 09:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T8D3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 09:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60603"}, "ts": "2023-07-25 09:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:57:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34838RM"}, "ts": "2023-07-25 09:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34838RM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 09:57:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34838RM"}, "ts": "2023-07-25 09:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55382TU"}, "ts": "2023-07-25 09:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98288RW"}, "ts": "2023-07-25 09:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09244EU"}, "ts": "2023-07-25 09:57:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000016"}, "ts": "2023-07-25 09:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 09:58:07 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 09:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "sialyl lewis x", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-25 09:58:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 09:58:31 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "sialyl lewis x"}, "ts": "2023-07-25 09:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 09:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "sialyl lewis x", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=sialyl lewis x"}, "ts": "2023-07-25 09:58:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04350"}, "ts": "2023-07-25 09:58:35 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-25 09:58:48 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-25 09:58:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000042"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-25 09:58:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000004"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000021"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000050"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000049"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000017"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000051"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000006"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000044"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000033"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000043"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000037"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000026"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000032"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000029"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000041"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000039"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000047"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000058"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000027"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000040"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000046"}, "ts": "2023-07-25 09:58:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000252"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000030"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000057"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000025"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000074"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000118"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000095"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000100"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000064"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000078"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000091"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000089"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000104"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000060"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000085"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000108"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000110"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000121"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000059"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000081"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000068"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000114"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000070"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000084"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000109"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000111"}, "ts": "2023-07-25 09:58:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000075"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000120"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000013"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000080"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000069"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000115"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000071"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000098"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000119"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000094"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000007"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000101"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000065"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000054"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000079"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000088"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000105"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000061"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000086"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000113"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000077"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000122"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000011"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000082"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000117"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000073"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000096"}, "ts": "2023-07-25 09:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000103"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000067"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000092"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000028"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000063"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000097"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000102"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000066"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000093"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000053"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000106"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000062"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000087"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000014"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000112"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000076"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000010"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000083"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000116"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000072"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000056"}, "ts": "2023-07-25 09:58:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWZ3-1.1603.1603"}, "ts": "2023-07-25 09:59:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-25 09:59:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 10:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 10:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 10:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 10:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 10:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 10:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZK6"}, "ts": "2023-07-25 10:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:01:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02311IE"}, "ts": "2023-07-25 10:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95007"}, "ts": "2023-07-25 10:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-25 10:02:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY37"}, "ts": "2023-07-25 10:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY37", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH04"}, "ts": "2023-07-25 10:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RA2"}, "ts": "2023-07-25 10:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH01"}, "ts": "2023-07-25 10:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XKE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XKE5"}, "ts": "2023-07-25 10:02:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH04", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDS7"}, "ts": "2023-07-25 10:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P1Q5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P1Q5"}, "ts": "2023-07-25 10:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGL6"}, "ts": "2023-07-25 10:02:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09919"}, "ts": "2023-07-25 10:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:02:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07141"}, "ts": "2023-07-25 10:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:03:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62052"}, "ts": "2023-07-25 10:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:03:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80303"}, "ts": "2023-07-25 10:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:03:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYW0"}, "ts": "2023-07-25 10:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:03:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGK9"}, "ts": "2023-07-25 10:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGK9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96577RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:04:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD2"}, "ts": "2023-07-25 10:04:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGP9"}, "ts": "2023-07-25 10:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55957", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGA0"}, "ts": "2023-07-25 10:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58170", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RC9"}, "ts": "2023-07-25 10:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG98"}, "ts": "2023-07-25 10:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFC9"}, "ts": "2023-07-25 10:04:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58170"}, "ts": "2023-07-25 10:04:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55957"}, "ts": "2023-07-25 10:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXE1"}, "ts": "2023-07-25 10:04:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZM6"}, "ts": "2023-07-25 10:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:04:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:04:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-25 10:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGI7"}, "ts": "2023-07-25 10:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59535"}, "ts": "2023-07-25 10:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59535", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14746"}, "ts": "2023-07-25 10:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14746", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGK6"}, "ts": "2023-07-25 10:05:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGN2"}, "ts": "2023-07-25 10:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAW4"}, "ts": "2023-07-25 10:05:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02509"}, "ts": "2023-07-25 10:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41586", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGJ7"}, "ts": "2023-07-25 10:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH90"}, "ts": "2023-07-25 10:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH90", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41586"}, "ts": "2023-07-25 10:05:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH51"}, "ts": "2023-07-25 10:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:05:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515"}, "ts": "2023-07-25 10:06:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-25 10:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:06:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95150.47.47"}, "ts": "2023-07-25 10:06:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95150", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:06:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NHG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NHG9"}, "ts": "2023-07-25 10:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H346", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H346"}, "ts": "2023-07-25 10:06:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z591"}, "ts": "2023-07-25 10:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MC4"}, "ts": "2023-07-25 10:06:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH41"}, "ts": "2023-07-25 10:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13315", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTK1"}, "ts": "2023-07-25 10:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH19"}, "ts": "2023-07-25 10:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99988"}, "ts": "2023-07-25 10:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:06:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-25 10:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75140", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:07:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55420MQ"}, "ts": "2023-07-25 10:07:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55420MQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:07:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 10:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQ92", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 10:07:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQ92"}, "ts": "2023-07-25 10:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75376", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:07:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75376.66.66"}, "ts": "2023-07-25 10:07:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH95"}, "ts": "2023-07-25 10:07:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22888"}, "ts": "2023-07-25 10:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYE1"}, "ts": "2023-07-25 10:07:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NMS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:07:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NMS3"}, "ts": "2023-07-25 10:07:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47884"}, "ts": "2023-07-25 10:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47884", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:07:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGS1"}, "ts": "2023-07-25 10:07:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q401N2"}, "ts": "2023-07-25 10:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q401N2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:07:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGM9"}, "ts": "2023-07-25 10:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:08:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60174"}, "ts": "2023-07-25 10:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:08:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGS3"}, "ts": "2023-07-25 10:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:09:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56279.57.57"}, "ts": "2023-07-25 10:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q704Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:09:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q704Y3"}, "ts": "2023-07-25 10:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94832", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:10:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94832.574.574"}, "ts": "2023-07-25 10:10:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64240"}, "ts": "2023-07-25 10:11:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:11:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N766"}, "ts": "2023-07-25 10:11:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:11:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:11:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPH3"}, "ts": "2023-07-25 10:11:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-25 10:11:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24954UD"}, "ts": "2023-07-25 10:11:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38663NM"}, "ts": "2023-07-25 10:11:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46902YN"}, "ts": "2023-07-25 10:11:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70375MX"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72398FA"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78790NZ"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82119TF"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90093AU"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 10:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-25 10:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:12:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y618.1566.1566"}, "ts": "2023-07-25 10:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:12:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TD94"}, "ts": "2023-07-25 10:12:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31274", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:12:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31274"}, "ts": "2023-07-25 10:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:13:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-25 10:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26640", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:14:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26640"}, "ts": "2023-07-25 10:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 10:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13797", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 10:16:18 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P13797", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 10:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13797", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 10:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C025", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:17:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C025"}, "ts": "2023-07-25 10:17:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42338.971.971"}, "ts": "2023-07-25 10:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42338", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:17:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02311IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:18:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:18:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60412", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60412"}, "ts": "2023-07-25 10:18:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:18:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-25 10:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01024"}, "ts": "2023-07-25 10:18:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68037"}, "ts": "2023-07-25 10:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:18:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-25 10:19:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-25 10:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75509"}, "ts": "2023-07-25 10:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62516-1"}, "ts": "2023-07-25 10:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62516-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96G21"}, "ts": "2023-07-25 10:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-25 10:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49908", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53350-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53350-1"}, "ts": "2023-07-25 10:20:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IC83", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYT1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IC83"}, "ts": "2023-07-25 10:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQE9"}, "ts": "2023-07-25 10:20:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y426"}, "ts": "2023-07-25 10:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VW32", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JJ3-1"}, "ts": "2023-07-25 10:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JJ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBP5"}, "ts": "2023-07-25 10:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VW32"}, "ts": "2023-07-25 10:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5G2"}, "ts": "2023-07-25 10:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5G2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A3KFT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:20:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A3KFT3"}, "ts": "2023-07-25 10:20:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYT1"}, "ts": "2023-07-25 10:20:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48356"}, "ts": "2023-07-25 10:21:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07666"}, "ts": "2023-07-25 10:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84224TW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:21:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84224TW"}, "ts": "2023-07-25 10:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIE1"}, "ts": "2023-07-25 10:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95718", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:22:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95718.292.292"}, "ts": "2023-07-25 10:22:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5MNV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43820"}, "ts": "2023-07-25 10:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5MNV8"}, "ts": "2023-07-25 10:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGQ6"}, "ts": "2023-07-25 10:22:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY35"}, "ts": "2023-07-25 10:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43820", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96J88"}, "ts": "2023-07-25 10:22:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96J88", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95156"}, "ts": "2023-07-25 10:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96C57", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96C57"}, "ts": "2023-07-25 10:22:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4I9"}, "ts": "2023-07-25 10:22:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4I9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95156", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14508"}, "ts": "2023-07-25 10:22:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43323.48.48"}, "ts": "2023-07-25 10:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43323", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:22:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48668", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:22:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48668"}, "ts": "2023-07-25 10:22:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-25 10:22:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IEY1"}, "ts": "2023-07-25 10:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IEY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19958IL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q67FW5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:23:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q67FW5.239.239"}, "ts": "2023-07-25 10:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:23:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21317208", "type": "PubMed"}, "ts": "2023-07-25 10:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21317208", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:23:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95139"}, "ts": "2023-07-25 10:24:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HD15"}, "ts": "2023-07-25 10:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7F7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7F7"}, "ts": "2023-07-25 10:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14519"}, "ts": "2023-07-25 10:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122-1"}, "ts": "2023-07-25 10:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08708"}, "ts": "2023-07-25 10:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08637"}, "ts": "2023-07-25 10:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGG2"}, "ts": "2023-07-25 10:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08708", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6T423"}, "ts": "2023-07-25 10:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6T423", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NLU5"}, "ts": "2023-07-25 10:24:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYW2"}, "ts": "2023-07-25 10:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYW2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NLU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PZ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:25:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PZ0"}, "ts": "2023-07-25 10:25:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18146"}, "ts": "2023-07-25 10:25:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2F5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:25:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2F5"}, "ts": "2023-07-25 10:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3XA59", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 10:25:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3XA59"}, "ts": "2023-07-25 10:25:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18146"}, "ts": "2023-07-25 10:25:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3W0D1"}, "ts": "2023-07-25 10:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3W0D1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:26:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00451"}, "ts": "2023-07-25 10:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A99", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:26:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A99"}, "ts": "2023-07-25 10:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13790", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:27:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13790"}, "ts": "2023-07-25 10:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4X5"}, "ts": "2023-07-25 10:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7Q3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:27:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7Q3"}, "ts": "2023-07-25 10:27:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21701560", "type": "PubMed"}, "ts": "2023-07-25 10:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21701560", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48284", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:27:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48284"}, "ts": "2023-07-25 10:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BR01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5Q4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BR01"}, "ts": "2023-07-25 10:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5Q4"}, "ts": "2023-07-25 10:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NJZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:28:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NJZ3"}, "ts": "2023-07-25 10:28:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16900UB"}, "ts": "2023-07-25 10:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16900UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:29:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16900UB"}, "ts": "2023-07-25 10:29:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-25 10:29:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 10:29:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20034JD"}, "ts": "2023-07-25 10:29:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39446WN"}, "ts": "2023-07-25 10:29:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10331BX"}, "ts": "2023-07-25 10:29:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-25 10:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4Q2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:30:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01033.186.186"}, "ts": "2023-07-25 10:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01033", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:30:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-25 10:30:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41155"}, "ts": "2023-07-25 10:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:31:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15321"}, "ts": "2023-07-25 10:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15321", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:31:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7P6"}, "ts": "2023-07-25 10:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19429", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:31:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19429.187.187"}, "ts": "2023-07-25 10:31:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14389GM"}, "ts": "2023-07-25 10:32:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13646"}, "ts": "2023-07-25 10:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13646", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2U8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:34:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2U8.187.187"}, "ts": "2023-07-25 10:34:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 10:34:35 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 10:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 10:34:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6XJV6"}, "ts": "2023-07-25 10:34:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XJV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:34:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:34:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03886", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:34:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03886"}, "ts": "2023-07-25 10:34:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 10:34:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047-1.1024.1024"}, "ts": "2023-07-25 10:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:34:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-25 10:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:35:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-25 10:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0E7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 10:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:35:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5I0E7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 10:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28575669", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:35:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28575669", "type": "PubMed"}, "ts": "2023-07-25 10:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:36:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16900UB"}, "ts": "2023-07-25 10:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16900UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:36:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28906"}, "ts": "2023-07-25 10:36:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZN44"}, "ts": "2023-07-25 10:36:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZN44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:36:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26203138", "type": "PubMed"}, "ts": "2023-07-25 10:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26203138", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48356", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26640", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:37:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26640"}, "ts": "2023-07-25 10:37:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70669"}, "ts": "2023-07-25 10:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14490"}, "ts": "2023-07-25 10:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDZ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:38:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDZ6.251.251"}, "ts": "2023-07-25 10:38:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59510"}, "ts": "2023-07-25 10:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59510", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:38:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YP2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YP2-1"}, "ts": "2023-07-25 10:39:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTX0"}, "ts": "2023-07-25 10:39:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20718"}, "ts": "2023-07-25 10:39:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P531"}, "ts": "2023-07-25 10:39:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14153"}, "ts": "2023-07-25 10:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8G1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20718", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA56"}, "ts": "2023-07-25 10:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YBV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YBV0"}, "ts": "2023-07-25 10:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8G1"}, "ts": "2023-07-25 10:39:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H741"}, "ts": "2023-07-25 10:39:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15018"}, "ts": "2023-07-25 10:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H741", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59045", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59045"}, "ts": "2023-07-25 10:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-25 10:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75525"}, "ts": "2023-07-25 10:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60852", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60852"}, "ts": "2023-07-25 10:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXC9"}, "ts": "2023-07-25 10:39:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:39:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMB2"}, "ts": "2023-07-25 10:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WT01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WT01"}, "ts": "2023-07-25 10:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69YZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6Q4"}, "ts": "2023-07-25 10:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY78"}, "ts": "2023-07-25 10:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CB8"}, "ts": "2023-07-25 10:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR23"}, "ts": "2023-07-25 10:40:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6Q4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31391"}, "ts": "2023-07-25 10:40:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69YZ2"}, "ts": "2023-07-25 10:40:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43007"}, "ts": "2023-07-25 10:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q148V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q148V7"}, "ts": "2023-07-25 10:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L8S5"}, "ts": "2023-07-25 10:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L8S5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0L4"}, "ts": "2023-07-25 10:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05901"}, "ts": "2023-07-25 10:40:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1X1"}, "ts": "2023-07-25 10:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05901", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30533"}, "ts": "2023-07-25 10:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96ER9"}, "ts": "2023-07-25 10:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00602"}, "ts": "2023-07-25 10:40:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ER9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56373"}, "ts": "2023-07-25 10:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5R6"}, "ts": "2023-07-25 10:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB20"}, "ts": "2023-07-25 10:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5R6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB20", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75525"}, "ts": "2023-07-25 10:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0PJZ3"}, "ts": "2023-07-25 10:41:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25940"}, "ts": "2023-07-25 10:41:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2VYF4"}, "ts": "2023-07-25 10:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2VYF4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0PJZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22794", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3D8"}, "ts": "2023-07-25 10:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3D8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM22"}, "ts": "2023-07-25 10:41:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22794"}, "ts": "2023-07-25 10:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96N76"}, "ts": "2023-07-25 10:41:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IQ19"}, "ts": "2023-07-25 10:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IQ19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78509.2961.2961"}, "ts": "2023-07-25 10:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78509", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:41:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKT4"}, "ts": "2023-07-25 10:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YF9"}, "ts": "2023-07-25 10:41:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18146", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18146", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:41:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-25 10:42:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPI0"}, "ts": "2023-07-25 10:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVT3"}, "ts": "2023-07-25 10:42:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A075B6W5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A075B6W5"}, "ts": "2023-07-25 10:42:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:42:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZL4"}, "ts": "2023-07-25 10:42:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:42:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35956"}, "ts": "2023-07-25 10:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49023", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:42:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49023.454.454"}, "ts": "2023-07-25 10:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NE01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:43:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NE01"}, "ts": "2023-07-25 10:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:43:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVN8"}, "ts": "2023-07-25 10:43:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5F0"}, "ts": "2023-07-25 10:43:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:43:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3B9"}, "ts": "2023-07-25 10:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3B9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:43:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCT2"}, "ts": "2023-07-25 10:43:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23582"}, "ts": "2023-07-25 10:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23582", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A589"}, "ts": "2023-07-25 10:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50750"}, "ts": "2023-07-25 10:44:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZM5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:44:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZM5"}, "ts": "2023-07-25 10:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VVM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:44:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VVM6"}, "ts": "2023-07-25 10:44:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16637.4.4"}, "ts": "2023-07-25 10:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16637", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H425"}, "ts": "2023-07-25 10:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H425", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:45:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-25 10:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:45:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBE9"}, "ts": "2023-07-25 10:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESN6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:45:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ESN6.424.424"}, "ts": "2023-07-25 10:45:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32238.289.289"}, "ts": "2023-07-25 10:45:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32238", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:45:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DL1"}, "ts": "2023-07-25 10:45:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:45:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6QNK2"}, "ts": "2023-07-25 10:46:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6QNK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:46:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWS1"}, "ts": "2023-07-25 10:46:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-25 10:46:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6G3"}, "ts": "2023-07-25 10:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZR1"}, "ts": "2023-07-25 10:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6G3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZN01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:46:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZN01"}, "ts": "2023-07-25 10:46:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:46:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-25 10:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95067", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:47:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04114.3264.3264"}, "ts": "2023-07-25 10:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04114", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:47:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95067.183.183"}, "ts": "2023-07-25 10:47:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDD5"}, "ts": "2023-07-25 10:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:48:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUN9"}, "ts": "2023-07-25 10:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14389GM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:49:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-25 10:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:49:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23453IV"}, "ts": "2023-07-25 10:49:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 10:49:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 10:49:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 10:49:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32418"}, "ts": "2023-07-25 10:49:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q0VGY8-1.1436.1436"}, "ts": "2023-07-25 10:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28581500", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:51:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28581500", "type": "PubMed"}, "ts": "2023-07-25 10:51:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12830"}, "ts": "2023-07-25 10:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:52:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y487"}, "ts": "2023-07-25 10:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28906", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14614133", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:52:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14614133", "type": "PubMed"}, "ts": "2023-07-25 10:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97797-1"}, "ts": "2023-07-25 10:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:53:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5E9"}, "ts": "2023-07-25 10:53:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99614"}, "ts": "2023-07-25 10:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99614", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:53:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66538GV"}, "ts": "2023-07-25 10:53:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47198-1"}, "ts": "2023-07-25 10:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47198-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTE8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTE8"}, "ts": "2023-07-25 10:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00395TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 10:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:56:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-25 10:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:56:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 10:56:25 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 10:56:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 10:56:25 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 10:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 10:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:56:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99798"}, "ts": "2023-07-25 10:56:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-25 10:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y463", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:57:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y463"}, "ts": "2023-07-25 10:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-25 10:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26992", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 10:57:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26992.70.70"}, "ts": "2023-07-25 10:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M9I1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 10:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M9I1-1"}, "ts": "2023-07-25 10:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7753821", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 10:59:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7753821", "type": "PubMed"}, "ts": "2023-07-25 10:59:51 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 11:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 11:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 11:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 11:00:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WC31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 11:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WC31"}, "ts": "2023-07-25 11:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 11:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T21", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 11:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96T21"}, "ts": "2023-07-25 11:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76082"}, "ts": "2023-07-25 11:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32004447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:00:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32004447", "type": "PubMed"}, "ts": "2023-07-25 11:00:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02786.24.24"}, "ts": "2023-07-25 11:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:01:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05279MG"}, "ts": "2023-07-25 11:01:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P97384-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 11:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97384-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 11:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97384-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 11:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:02:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FA3"}, "ts": "2023-07-25 11:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:02:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04114.3264.3264"}, "ts": "2023-07-25 11:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04114", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:02:56 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 11:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 11:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 11:03:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-25 11:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-25 11:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08922", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:04:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08922.179.179"}, "ts": "2023-07-25 11:04:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:04:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MI9"}, "ts": "2023-07-25 11:04:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-25 11:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70152"}, "ts": "2023-07-25 11:05:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70152", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-25 11:05:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 11:06:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08069"}, "ts": "2023-07-25 11:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:06:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUH6"}, "ts": "2023-07-25 11:06:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-25 11:06:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NE79"}, "ts": "2023-07-25 11:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1KXE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1KXE4"}, "ts": "2023-07-25 11:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4E1"}, "ts": "2023-07-25 11:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBH2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBH2"}, "ts": "2023-07-25 11:07:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4H7"}, "ts": "2023-07-25 11:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4H7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZU64"}, "ts": "2023-07-25 11:07:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43529"}, "ts": "2023-07-25 11:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3B726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3B726"}, "ts": "2023-07-25 11:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43529", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZU64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1C4"}, "ts": "2023-07-25 11:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7E9"}, "ts": "2023-07-25 11:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JSS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JSS6"}, "ts": "2023-07-25 11:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1C4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MVS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53H80"}, "ts": "2023-07-25 11:08:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53H80", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MVS5"}, "ts": "2023-07-25 11:08:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKU9"}, "ts": "2023-07-25 11:08:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15431"}, "ts": "2023-07-25 11:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFR9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFR9"}, "ts": "2023-07-25 11:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3Q3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5H5"}, "ts": "2023-07-25 11:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H974", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H974"}, "ts": "2023-07-25 11:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1C0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1C0"}, "ts": "2023-07-25 11:08:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32245", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32245"}, "ts": "2023-07-25 11:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97797-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:08:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JUQ0"}, "ts": "2023-07-25 11:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JUQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01242", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:09:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01242"}, "ts": "2023-07-25 11:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60687", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:09:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60687"}, "ts": "2023-07-25 11:09:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCY6"}, "ts": "2023-07-25 11:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:10:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULH7"}, "ts": "2023-07-25 11:10:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08357"}, "ts": "2023-07-25 11:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-25 11:10:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-25 11:10:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15924"}, "ts": "2023-07-25 11:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12787-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:12:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12787-1"}, "ts": "2023-07-25 11:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:12:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27487"}, "ts": "2023-07-25 11:12:50 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 11:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 11:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 11:12:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10019LZ"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62461SM"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23984SE"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38663NM"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47748JZ"}, "ts": "2023-07-25 11:12:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-25 11:12:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 11:12:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41882MT"}, "ts": "2023-07-25 11:12:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 11:12:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-25 11:12:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:13:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29391424", "type": "PubMed"}, "ts": "2023-07-25 11:13:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29391424", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:13:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06906LK"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08796TW"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14110OQ"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14796IU"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18589KA"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21070BH"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25541YH"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-25 11:13:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-25 11:13:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-25 11:13:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59536GA"}, "ts": "2023-07-25 11:13:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987-1"}, "ts": "2023-07-25 11:14:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08791"}, "ts": "2023-07-25 11:14:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08791", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:14:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10019LZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:14:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10019LZ"}, "ts": "2023-07-25 11:14:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02791WJ"}, "ts": "2023-07-25 11:14:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 11:14:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95292", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 11:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95292"}, "ts": "2023-07-25 11:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27487"}, "ts": "2023-07-25 11:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:14:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3Q3"}, "ts": "2023-07-25 11:14:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22061"}, "ts": "2023-07-25 11:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:16:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N3T1.186.186"}, "ts": "2023-07-25 11:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3T1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:16:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35639.30.30"}, "ts": "2023-07-25 11:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35639", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:16:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-25 11:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05279MG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:17:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GQX6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:17:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6GQX6-1"}, "ts": "2023-07-25 11:17:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y267"}, "ts": "2023-07-25 11:17:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:17:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40259.70.70"}, "ts": "2023-07-25 11:18:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40259", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:18:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 11:18:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11856323", "type": "PubMed"}, "ts": "2023-07-25 11:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11856323", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:18:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNC4"}, "ts": "2023-07-25 11:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55196", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:19:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55196.246.246"}, "ts": "2023-07-25 11:19:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08607-1"}, "ts": "2023-07-25 11:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08607-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS00", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:20:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS00"}, "ts": "2023-07-25 11:20:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34364AA"}, "ts": "2023-07-25 11:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3SHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BWA5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:20:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BWA5-1"}, "ts": "2023-07-25 11:20:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3SHH9"}, "ts": "2023-07-25 11:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K119", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:20:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K119"}, "ts": "2023-07-25 11:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:20:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08188.535.535"}, "ts": "2023-07-25 11:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08188", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:21:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N271"}, "ts": "2023-07-25 11:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N271", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:21:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAC7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:21:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAC7-1"}, "ts": "2023-07-25 11:21:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV92"}, "ts": "2023-07-25 11:22:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969V1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969V1"}, "ts": "2023-07-25 11:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:16 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 11:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 11:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 11:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:32 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 11:22:33 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 11:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 11:22:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJ90"}, "ts": "2023-07-25 11:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJ90", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T442"}, "ts": "2023-07-25 11:22:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02641", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02641"}, "ts": "2023-07-25 11:22:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70UQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q70UQ0"}, "ts": "2023-07-25 11:22:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2B4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2B4"}, "ts": "2023-07-25 11:22:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-25 11:22:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:22:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00479"}, "ts": "2023-07-25 11:23:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00479", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:23:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:23:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL51"}, "ts": "2023-07-25 11:23:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:23:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47871"}, "ts": "2023-07-25 11:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14129", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:23:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14129"}, "ts": "2023-07-25 11:23:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08174.813.813"}, "ts": "2023-07-25 11:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08174", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:23:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94855"}, "ts": "2023-07-25 11:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:23:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ICH7"}, "ts": "2023-07-25 11:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ICH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:23:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51654"}, "ts": "2023-07-25 11:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GYQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:24:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6GYQ0.221.221"}, "ts": "2023-07-25 11:24:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-25 11:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13591"}, "ts": "2023-07-25 11:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:25:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDB4"}, "ts": "2023-07-25 11:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99569", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:25:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99569.712.712"}, "ts": "2023-07-25 11:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2E5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 11:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2E5"}, "ts": "2023-07-25 11:25:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BTF0.155.155"}, "ts": "2023-07-25 11:25:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:25:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8U3"}, "ts": "2023-07-25 11:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8U3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08357", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:26:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP70", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:26:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP70"}, "ts": "2023-07-25 11:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23863VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:26:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75027"}, "ts": "2023-07-25 11:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15924", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67870", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:27:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67870"}, "ts": "2023-07-25 11:27:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 11:28:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:28:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14142"}, "ts": "2023-07-25 11:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:28:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53420", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:28:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53420"}, "ts": "2023-07-25 11:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H694", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 11:28:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H694"}, "ts": "2023-07-25 11:28:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-25 11:28:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15431"}, "ts": "2023-07-25 11:28:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13987-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25988428", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:30:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25988428", "type": "PubMed"}, "ts": "2023-07-25 11:30:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-25 11:30:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z5L9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:30:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z5L9"}, "ts": "2023-07-25 11:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:30:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13508"}, "ts": "2023-07-25 11:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22721717", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:31:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22721717", "type": "PubMed"}, "ts": "2023-07-25 11:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 11:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:32:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2NL82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:32:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2NL82"}, "ts": "2023-07-25 11:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 11:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:33:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08857-1"}, "ts": "2023-07-25 11:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:33:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW30"}, "ts": "2023-07-25 11:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:34:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60664.170.170"}, "ts": "2023-07-25 11:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:34:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56545"}, "ts": "2023-07-25 11:34:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-25 11:35:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-25 11:36:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15758"}, "ts": "2023-07-25 11:36:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LX8"}, "ts": "2023-07-25 11:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15651"}, "ts": "2023-07-25 11:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15651", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:37:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07954.1101.1101"}, "ts": "2023-07-25 11:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:39:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z401"}, "ts": "2023-07-25 11:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z401", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:39:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15684423", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:40:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15684423", "type": "PubMed"}, "ts": "2023-07-25 11:40:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:41:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-25 11:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16339447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:41:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16339447", "type": "PubMed"}, "ts": "2023-07-25 11:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20719", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:41:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20719"}, "ts": "2023-07-25 11:41:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28425186", "type": "PubMed"}, "ts": "2023-07-25 11:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28425186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:42:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 11:42:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43516-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:42:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43516-1"}, "ts": "2023-07-25 11:42:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-25 11:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:43:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8-1"}, "ts": "2023-07-25 11:43:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3525564", "type": "PubMed"}, "ts": "2023-07-25 11:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3525564", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:43:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22123324", "type": "PubMed"}, "ts": "2023-07-25 11:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11274220", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:43:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11274220", "type": "PubMed"}, "ts": "2023-07-25 11:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22123324", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:43:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10100623", "type": "PubMed"}, "ts": "2023-07-25 11:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10100623", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24906252", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:43:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24906252", "type": "PubMed"}, "ts": "2023-07-25 11:43:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYW6.208.208"}, "ts": "2023-07-25 11:44:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10191087", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10191087", "type": "PubMed"}, "ts": "2023-07-25 11:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8185599", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8035319", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8185599", "type": "PubMed"}, "ts": "2023-07-25 11:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29066024", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12719537", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12719537", "type": "PubMed"}, "ts": "2023-07-25 11:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16182515", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:44:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29066024", "type": "PubMed"}, "ts": "2023-07-25 11:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12540846", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12540846", "type": "PubMed"}, "ts": "2023-07-25 11:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43251", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:44:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43251"}, "ts": "2023-07-25 11:44:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10727532", "type": "PubMed"}, "ts": "2023-07-25 11:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10727532", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10381885", "type": "PubMed"}, "ts": "2023-07-25 11:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10381885", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80966KZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:44:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8035319", "type": "PubMed"}, "ts": "2023-07-25 11:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:45:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02750"}, "ts": "2023-07-25 11:45:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3086311", "type": "PubMed"}, "ts": "2023-07-25 11:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3086311", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LG0"}, "ts": "2023-07-25 11:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:45:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18434541", "type": "PubMed"}, "ts": "2023-07-25 11:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18434541", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16268778", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11385580", "type": "PubMed"}, "ts": "2023-07-25 11:46:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16268778", "type": "PubMed"}, "ts": "2023-07-25 11:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11385580", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9305846", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9305846", "type": "PubMed"}, "ts": "2023-07-25 11:46:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11355873", "type": "PubMed"}, "ts": "2023-07-25 11:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11355873", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12427552", "type": "PubMed"}, "ts": "2023-07-25 11:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12427552", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2834384", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2834384", "type": "PubMed"}, "ts": "2023-07-25 11:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0E6"}, "ts": "2023-07-25 11:46:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1314587", "type": "PubMed"}, "ts": "2023-07-25 11:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1314587", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6589611", "type": "PubMed"}, "ts": "2023-07-25 11:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6589611", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10438732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10438732", "type": "PubMed"}, "ts": "2023-07-25 11:46:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830"}, "ts": "2023-07-25 11:46:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7524088", "type": "PubMed"}, "ts": "2023-07-25 11:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7524088", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3856870", "type": "PubMed"}, "ts": "2023-07-25 11:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3856870", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:46:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75071"}, "ts": "2023-07-25 11:46:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1905813", "type": "PubMed"}, "ts": "2023-07-25 11:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1905813", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 11:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:46:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-25 11:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09486", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09486"}, "ts": "2023-07-25 11:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERE9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERE9-1"}, "ts": "2023-07-25 11:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8X3"}, "ts": "2023-07-25 11:47:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8X3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:47:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDV3"}, "ts": "2023-07-25 11:48:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:48:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19883"}, "ts": "2023-07-25 11:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:48:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04519"}, "ts": "2023-07-25 11:48:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:48:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:48:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI7"}, "ts": "2023-07-25 11:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08857-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:49:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21781"}, "ts": "2023-07-25 11:49:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21781", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56545", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-25 11:51:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62917"}, "ts": "2023-07-25 11:51:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FYB0"}, "ts": "2023-07-25 11:51:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FYB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9Z1"}, "ts": "2023-07-25 11:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9Z1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-25 11:51:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 11:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q33E94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q33E94"}, "ts": "2023-07-25 11:51:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4QQV7"}, "ts": "2023-07-25 11:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4QQV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14031", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75071.347.347"}, "ts": "2023-07-25 11:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:51:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14031"}, "ts": "2023-07-25 11:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75071", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13804", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13804"}, "ts": "2023-07-25 11:51:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75071.153.153"}, "ts": "2023-07-25 11:51:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2S2"}, "ts": "2023-07-25 11:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2S2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:51:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75071.301.301"}, "ts": "2023-07-25 11:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBL0"}, "ts": "2023-07-25 11:52:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42574"}, "ts": "2023-07-25 11:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75071.324.324"}, "ts": "2023-07-25 11:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13598"}, "ts": "2023-07-25 11:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13598", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 11:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880"}, "ts": "2023-07-25 11:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63241", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63241"}, "ts": "2023-07-25 11:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51993", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51993"}, "ts": "2023-07-25 11:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 11:52:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49757"}, "ts": "2023-07-25 11:52:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49757", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10749", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 11:52:17 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P10749", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 11:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96I24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96I24"}, "ts": "2023-07-25 11:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10749", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 11:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUR7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUR7"}, "ts": "2023-07-25 11:52:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25100"}, "ts": "2023-07-25 11:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:52:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05090.65.65"}, "ts": "2023-07-25 11:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCB6"}, "ts": "2023-07-25 11:52:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6U3"}, "ts": "2023-07-25 11:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15031", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6U3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-25 11:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03001"}, "ts": "2023-07-25 11:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26639"}, "ts": "2023-07-25 11:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15758", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:53:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVA2"}, "ts": "2023-07-25 11:53:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67871"}, "ts": "2023-07-25 11:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 11:53:20 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 11:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 11:53:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03135-1"}, "ts": "2023-07-25 11:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:53:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49788"}, "ts": "2023-07-25 11:53:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.131.131"}, "ts": "2023-07-25 11:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 11:53:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.113.113"}, "ts": "2023-07-25 11:53:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.127.127"}, "ts": "2023-07-25 11:53:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.367.367"}, "ts": "2023-07-25 11:53:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.132.132"}, "ts": "2023-07-25 11:53:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:53:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55095"}, "ts": "2023-07-25 11:53:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.110.110"}, "ts": "2023-07-25 11:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36941"}, "ts": "2023-07-25 11:53:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.109.109"}, "ts": "2023-07-25 11:54:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.316.316"}, "ts": "2023-07-25 11:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:54:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5X5"}, "ts": "2023-07-25 11:54:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:54:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63267"}, "ts": "2023-07-25 11:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53671"}, "ts": "2023-07-25 11:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21127"}, "ts": "2023-07-25 11:54:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21127"}, "ts": "2023-07-25 11:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:54:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50395"}, "ts": "2023-07-25 11:54:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.347.347"}, "ts": "2023-07-25 11:54:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.126.126"}, "ts": "2023-07-25 11:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0D2"}, "ts": "2023-07-25 11:55:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-25 11:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 11:59:04 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 12:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 12:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 12:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 12:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 12:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 12:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0I6"}, "ts": "2023-07-25 12:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0I6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:00:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000011"}, "ts": "2023-07-25 12:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69849"}, "ts": "2023-07-25 12:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:02:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CG23"}, "ts": "2023-07-25 12:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:02:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBM8"}, "ts": "2023-07-25 12:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:02:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-25 12:03:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-25 12:03:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2ARV4-1.387.387"}, "ts": "2023-07-25 12:04:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:04:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ARV4-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:04:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-25 12:04:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYF6"}, "ts": "2023-07-25 12:04:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYF6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32119", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:04:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32119.18.18"}, "ts": "2023-07-25 12:04:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32119.112.112"}, "ts": "2023-07-25 12:04:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32119", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:04:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48382"}, "ts": "2023-07-25 12:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48382", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3M8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:06:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3M8"}, "ts": "2023-07-25 12:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:07:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16594"}, "ts": "2023-07-25 12:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16594", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:07:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NCL4.239.239"}, "ts": "2023-07-25 12:07:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCL4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:07:05 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000044", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-25 12:07:06 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000044", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-25 12:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000044", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-25 12:07:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q709F0"}, "ts": "2023-07-25 12:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q709F0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:07:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10124"}, "ts": "2023-07-25 12:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10124", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:07:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15375"}, "ts": "2023-07-25 12:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15375", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:08:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FA3"}, "ts": "2023-07-25 12:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZXQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:09:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZXQ5"}, "ts": "2023-07-25 12:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:09:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZU64"}, "ts": "2023-07-25 12:09:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZU64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:09:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75071.296.296"}, "ts": "2023-07-25 12:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G0T1"}, "ts": "2023-07-25 12:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G0T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52306"}, "ts": "2023-07-25 12:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94779", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:11:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94779.891.891"}, "ts": "2023-07-25 12:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDM6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:11:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDM6.1186.1186"}, "ts": "2023-07-25 12:11:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:11:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-25 12:11:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02771"}, "ts": "2023-07-25 12:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08677", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:11:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08677.242.242"}, "ts": "2023-07-25 12:11:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12643"}, "ts": "2023-07-25 12:11:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08677.82.82"}, "ts": "2023-07-25 12:12:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-25 12:12:08 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 12:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 12:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 12:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210"}, "ts": "2023-07-25 12:12:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210"}, "ts": "2023-07-25 12:13:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28065"}, "ts": "2023-07-25 12:13:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10361"}, "ts": "2023-07-25 12:13:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08677.168.168"}, "ts": "2023-07-25 12:13:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08677.204.204"}, "ts": "2023-07-25 12:13:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92985", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 12:14:06 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92985", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 12:14:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 12:14:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:14:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62917"}, "ts": "2023-07-25 12:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15596"}, "ts": "2023-07-25 12:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15596", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92985", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 12:14:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06702"}, "ts": "2023-07-25 12:14:41 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-25 12:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-25 12:14:49 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 3}, "ts": "2023-07-25 12:14:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">3", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=3"}, "ts": "2023-07-25 12:14:51 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 3}, "ts": "2023-07-25 12:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-25 12:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-25 12:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14174"}, "ts": "2023-07-25 12:15:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-25 12:17:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08677"}, "ts": "2023-07-25 12:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08677", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERE9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:17:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERE9-1"}, "ts": "2023-07-25 12:17:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-25 12:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VCS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:18:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VCS5"}, "ts": "2023-07-25 12:18:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-25 12:18:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00966"}, "ts": "2023-07-25 12:18:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-25 12:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62269"}, "ts": "2023-07-25 12:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62269", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3U1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:19:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3U1.849.849"}, "ts": "2023-07-25 12:19:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXV6"}, "ts": "2023-07-25 12:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:20:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18505"}, "ts": "2023-07-25 12:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18505", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:21:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09874"}, "ts": "2023-07-25 12:21:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N328"}, "ts": "2023-07-25 12:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N328", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:22:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88325.501.501"}, "ts": "2023-07-25 12:22:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88325", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6K9"}, "ts": "2023-07-25 12:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q687X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:23:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q687X5"}, "ts": "2023-07-25 12:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-25 12:23:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15945"}, "ts": "2023-07-25 12:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:23:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85767HW"}, "ts": "2023-07-25 12:24:49 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 12:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 12:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 12:25:26 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-25 12:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 12:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 12:25:29 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 12:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 12:25:29 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 12:25:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-25 12:25:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:25:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-25 12:25:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-25 12:25:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 12:25:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 12:25:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 12:25:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-25 12:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:26:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IB77", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:27:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IB77"}, "ts": "2023-07-25 12:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08934", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:27:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08934"}, "ts": "2023-07-25 12:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:27:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-25 12:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:28:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15722"}, "ts": "2023-07-25 12:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:28:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA0"}, "ts": "2023-07-25 12:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28065", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:29:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-25 12:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKW0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKW0-1"}, "ts": "2023-07-25 12:29:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VEK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:30:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VEK0"}, "ts": "2023-07-25 12:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06702", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:30:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:32:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-25 12:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76093", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:32:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76093"}, "ts": "2023-07-25 12:32:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49327"}, "ts": "2023-07-25 12:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:32:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP70"}, "ts": "2023-07-25 12:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP70", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:32:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-25 12:33:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP70.43.43"}, "ts": "2023-07-25 12:33:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP70", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:34:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y275"}, "ts": "2023-07-25 12:34:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:34:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56817-1"}, "ts": "2023-07-25 12:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58216EF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:36:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58216EF"}, "ts": "2023-07-25 12:36:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-25 12:36:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61282"}, "ts": "2023-07-25 12:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61282", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:37:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VZK9"}, "ts": "2023-07-25 12:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZK9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 12:37:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17428803", "type": "PubMed"}, "ts": "2023-07-25 12:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17428803", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 12:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QV1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:37:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QV1"}, "ts": "2023-07-25 12:37:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-25 12:38:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:38:04 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 12:38:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 12:38:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 12:38:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "peptidase", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-25 12:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 12:39:36 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "peptidase"}, "ts": "2023-07-25 12:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 12:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "peptidase", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=peptidase"}, "ts": "2023-07-25 12:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "dc27678c7ecc3ddd8d3427ecc2464ecb", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 12:39:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "dc27678c7ecc3ddd8d3427ecc2464ecb", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 12:39:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 12:39:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 12:39:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 12:39:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-25 12:39:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 12:39:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-25 12:39:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-25 12:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06110VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:39:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 12:39:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2U0"}, "ts": "2023-07-25 12:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2U0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:39:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01504UZ"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04554QW"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07617FP"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07445YJ"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09609EN"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09986RD"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11052OE"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11568OK"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14153CY"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16404YH"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18559HW"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20640NX"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21477HL"}, "ts": "2023-07-25 12:39:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23450YU"}, "ts": "2023-07-25 12:39:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23799GS"}, "ts": "2023-07-25 12:39:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23874KQ"}, "ts": "2023-07-25 12:39:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24199RH"}, "ts": "2023-07-25 12:39:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25179PZ"}, "ts": "2023-07-25 12:39:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25984CA"}, "ts": "2023-07-25 12:39:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27327VV"}, "ts": "2023-07-25 12:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937-1"}, "ts": "2023-07-25 12:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "dc27678c7ecc3ddd8d3427ecc2464ecb", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 12:40:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "dc27678c7ecc3ddd8d3427ecc2464ecb", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 12:40:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19404"}, "ts": "2023-07-25 12:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19404", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:40:22 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "peptidase"}, "ts": "2023-07-25 12:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 12:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "peptidase", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=peptidase"}, "ts": "2023-07-25 12:40:31 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 12:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "95be4820283ddb1a5038e035d28df622", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 12:40:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "95be4820283ddb1a5038e035d28df622", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 12:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 12:40:40 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "peptidase"}, "ts": "2023-07-25 12:40:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "peptidase", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=peptidase"}, "ts": "2023-07-25 12:40:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "303231bc8ec16340389e29315840a504", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 12:40:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "303231bc8ec16340389e29315840a504", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 12:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85767HW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:40:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.966.966"}, "ts": "2023-07-25 12:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZK9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G74724QE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:40:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-25 12:40:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05484KA"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03389ET"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05675LB"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06041BR"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05686QK"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07626IW"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07988QE"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10706IL"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12440KU"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13811NF"}, "ts": "2023-07-25 12:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14037HH"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14646AF"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15605KR"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15849KC"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18067AF"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18521RG"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21989SY"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24274RK"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24970IL"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25062CC"}, "ts": "2023-07-25 12:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZK9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 12:41:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5VZK9", "cluster_type": "unselected"}, "ts": "2023-07-25 12:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20068231", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 12:41:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20068231", "type": "PubMed"}, "ts": "2023-07-25 12:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZK9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 12:41:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19211784", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 12:41:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19211784", "type": "PubMed"}, "ts": "2023-07-25 12:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q29TV8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:41:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q29TV8-1"}, "ts": "2023-07-25 12:41:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCL4"}, "ts": "2023-07-25 12:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:41:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5VZK9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 12:41:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.916.916"}, "ts": "2023-07-25 12:41:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.1291.1291"}, "ts": "2023-07-25 12:41:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:41:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43768"}, "ts": "2023-07-25 12:41:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.1324.1324"}, "ts": "2023-07-25 12:42:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCK4"}, "ts": "2023-07-25 12:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:43:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P07996", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 12:43:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07996", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 12:43:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07996", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 12:43:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.1360.1360"}, "ts": "2023-07-25 12:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:44:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZK9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:44:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.1315.1315"}, "ts": "2023-07-25 12:44:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.1331.1331"}, "ts": "2023-07-25 12:44:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11532"}, "ts": "2023-07-25 12:44:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6I3"}, "ts": "2023-07-25 12:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6I3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95476", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:45:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95476"}, "ts": "2023-07-25 12:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14739", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:45:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14739.59.59"}, "ts": "2023-07-25 12:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15289-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:45:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15289-1"}, "ts": "2023-07-25 12:45:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHC9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 12:46:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHC9"}, "ts": "2023-07-25 12:46:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.122.122"}, "ts": "2023-07-25 12:46:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047.1224.1224"}, "ts": "2023-07-25 12:46:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11047", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:46:24 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 12:46:52 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 12:46:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15236580", "type": "PubMed"}, "ts": "2023-07-25 12:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15236580", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 12:47:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24268657", "type": "PubMed"}, "ts": "2023-07-25 12:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24268657", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 12:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:49:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU1"}, "ts": "2023-07-25 12:49:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99698", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:49:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99698.1339.1339"}, "ts": "2023-07-25 12:49:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08146BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 12:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62715-1"}, "ts": "2023-07-25 12:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62715-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:49:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15164"}, "ts": "2023-07-25 12:49:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.1228.1228"}, "ts": "2023-07-25 12:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07988", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:50:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07988.165.165"}, "ts": "2023-07-25 12:50:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.968.968"}, "ts": "2023-07-25 12:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:51:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-25 12:51:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C7U0.349.349"}, "ts": "2023-07-25 12:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7U0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52948", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:51:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52948"}, "ts": "2023-07-25 12:51:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 12:51:58 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 12:52:01 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 12:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VBD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VBD2"}, "ts": "2023-07-25 12:52:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZK9.1280.1280"}, "ts": "2023-07-25 12:53:26 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 12:53:36 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 12:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-25 12:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-25 12:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-25 12:53:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 12:53:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-25 12:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:54:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02545"}, "ts": "2023-07-25 12:54:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52948", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:54:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52948"}, "ts": "2023-07-25 12:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15049", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:54:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15049.1.1"}, "ts": "2023-07-25 12:54:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86627OG"}, "ts": "2023-07-25 12:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:54:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS6"}, "ts": "2023-07-25 12:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52948", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:55:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52948"}, "ts": "2023-07-25 12:55:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14656"}, "ts": "2023-07-25 12:55:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:55:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11792318", "type": "PubMed"}, "ts": "2023-07-25 12:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11792318", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 12:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:55:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-25 12:55:56 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 12:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 12:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 12:56:36 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-25 12:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-25 12:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:57:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09622", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 12:57:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09622.328.328"}, "ts": "2023-07-25 12:57:12 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 12:57:50 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 12:57:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:58:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-25 12:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:58:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPG1"}, "ts": "2023-07-25 12:58:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29375", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:58:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29375"}, "ts": "2023-07-25 12:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52948", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:58:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52948"}, "ts": "2023-07-25 12:58:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-25 12:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:58:27 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 12:58:29 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 12:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60879", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:59:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60879"}, "ts": "2023-07-25 12:59:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 12:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:59:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60706"}, "ts": "2023-07-25 12:59:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60706", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 12:59:36 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 13:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 13:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 13:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 13:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 13:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 13:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00299", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:00:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00299"}, "ts": "2023-07-25 13:00:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63208"}, "ts": "2023-07-25 13:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:00:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N139"}, "ts": "2023-07-25 13:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-25 13:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-25 13:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNK1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:01:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11682486", "type": "PubMed"}, "ts": "2023-07-25 13:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11682486", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNK1-1"}, "ts": "2023-07-25 13:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-25 13:01:55 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-25 13:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-25 13:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16271074", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:01:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16271074", "type": "PubMed"}, "ts": "2023-07-25 13:01:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q33E94", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 13:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q33E94", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 13:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q33E94", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 13:01:58 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-25 13:01:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12925582", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:02:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12925582", "type": "PubMed"}, "ts": "2023-07-25 13:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q33E94", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 13:02:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q33E94", "cluster_type": "unselected"}, "ts": "2023-07-25 13:02:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52948", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:03:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52948"}, "ts": "2023-07-25 13:03:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-25 13:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-25 13:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG20", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:03:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0CG20.159.159"}, "ts": "2023-07-25 13:03:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70251-1"}, "ts": "2023-07-25 13:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70251-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:04:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07306"}, "ts": "2023-07-25 13:04:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15893672", "type": "PubMed"}, "ts": "2023-07-25 13:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15893672", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:04:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01222"}, "ts": "2023-07-25 13:05:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-25 13:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16881", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:05:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16881"}, "ts": "2023-07-25 13:05:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22083"}, "ts": "2023-07-25 13:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:05:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18077"}, "ts": "2023-07-25 13:05:45 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 13:06:13 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 13:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969D9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:06:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969D9-1"}, "ts": "2023-07-25 13:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52948", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:06:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52948"}, "ts": "2023-07-25 13:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-25 13:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12391014", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:07:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12391014", "type": "PubMed"}, "ts": "2023-07-25 13:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35579"}, "ts": "2023-07-25 13:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7U1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:07:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C7U1"}, "ts": "2023-07-25 13:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:07:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZA8"}, "ts": "2023-07-25 13:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZA8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15398", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:08:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:08:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15398"}, "ts": "2023-07-25 13:08:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63424"}, "ts": "2023-07-25 13:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:08:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-25 13:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6V1X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:09:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6V1X1"}, "ts": "2023-07-25 13:09:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:10:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-25 13:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:10:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ84"}, "ts": "2023-07-25 13:10:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-25 13:10:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880"}, "ts": "2023-07-25 13:10:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54766"}, "ts": "2023-07-25 13:11:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71835BN"}, "ts": "2023-07-25 13:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:11:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZI7"}, "ts": "2023-07-25 13:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31274", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:11:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31274"}, "ts": "2023-07-25 13:11:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00115"}, "ts": "2023-07-25 13:12:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19487464", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:12:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19487464", "type": "PubMed"}, "ts": "2023-07-25 13:12:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000252"}, "ts": "2023-07-25 13:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1Q1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1Q1"}, "ts": "2023-07-25 13:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05121"}, "ts": "2023-07-25 13:12:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6R2W3.490.490"}, "ts": "2023-07-25 13:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2W3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:13:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451"}, "ts": "2023-07-25 13:13:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16650"}, "ts": "2023-07-25 13:14:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76KX8"}, "ts": "2023-07-25 13:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76KX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:14:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61606"}, "ts": "2023-07-25 13:14:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61606", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-25 13:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54920"}, "ts": "2023-07-25 13:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54920", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:16:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21860.582.582"}, "ts": "2023-07-25 13:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63208", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:16:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29375"}, "ts": "2023-07-25 13:17:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29375", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:17:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210"}, "ts": "2023-07-25 13:18:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210"}, "ts": "2023-07-25 13:18:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NB14"}, "ts": "2023-07-25 13:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NB14", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53365", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:19:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53365"}, "ts": "2023-07-25 13:19:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 13:19:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U2C5"}, "ts": "2023-07-25 13:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U2C5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:20:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 13:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 13:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 13:20:42 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 13:20:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 13:20:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 13:20:47 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-25 13:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 13:20:47 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 13:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 13:20:48 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 13:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-25 13:20:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:20:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-25 13:20:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05901", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05901"}, "ts": "2023-07-25 13:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "POR1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 13:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 13:21:15 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "POR1"}, "ts": "2023-07-25 13:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 13:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "POR1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=POR1"}, "ts": "2023-07-25 13:21:16 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 13:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a9ef66441ce94cc7f000b3a459e1b682", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 13:21:20 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "a9ef66441ce94cc7f000b3a459e1b682", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 13:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18077", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 13:21:42 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "POR1"}, "ts": "2023-07-25 13:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "POR1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=POR1"}, "ts": "2023-07-25 13:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:24:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-25 13:24:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-25 13:25:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:26:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61073.351.351"}, "ts": "2023-07-25 13:26:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07483YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:26:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2K5"}, "ts": "2023-07-25 13:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:26:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00480"}, "ts": "2023-07-25 13:26:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-25 13:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71835BN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:27:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:27:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17931"}, "ts": "2023-07-25 13:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:27:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-25 13:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00115", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:28:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-25 13:28:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-25 13:28:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-25 13:29:45 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 13:30:00 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 13:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:30:01 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 13:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 13:30:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13433.686.686"}, "ts": "2023-07-25 13:30:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13433", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000100"}, "ts": "2023-07-25 13:30:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P43657", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 13:30:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43657", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 13:30:44 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 13:30:51 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 13:30:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-25 13:31:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51679"}, "ts": "2023-07-25 13:32:07 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 13:32:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 13:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28472-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 13:32:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P28472-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 13:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28472-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 13:32:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-25 13:32:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-25 13:34:08 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 13:34:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 13:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15920", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:34:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15920.700.700"}, "ts": "2023-07-25 13:34:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-25 13:35:09 EDT-0400"}, {"api": "/protein/search/", "req": {"gene_name": "ACE2"}, "ts": "2023-07-25 13:35:18 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "da85738d6f9015be8b42fbf991f57be9"}, "ts": "2023-07-25 13:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35859-1"}, "ts": "2023-07-25 13:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35859-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:36:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2R6.475.475"}, "ts": "2023-07-25 13:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2R6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15576372", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:38:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15576372", "type": "PubMed"}, "ts": "2023-07-25 13:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02545", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:39:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02545"}, "ts": "2023-07-25 13:39:36 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14869", "cluster_type": "unselected"}, "ts": "2023-07-25 13:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14869", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 13:39:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q61885-1", "cluster_type": "unselected"}, "ts": "2023-07-25 13:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 13:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14869", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 13:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61885-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 13:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61885-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 13:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52480-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:39:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52480-1"}, "ts": "2023-07-25 13:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-25 13:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13117-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:40:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13117-1"}, "ts": "2023-07-25 13:40:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42566.323.323"}, "ts": "2023-07-25 13:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42566", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59598", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:40:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59598"}, "ts": "2023-07-25 13:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:41:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04941", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:41:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04941.18.18"}, "ts": "2023-07-25 13:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00480", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SG7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:43:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SG7"}, "ts": "2023-07-25 13:43:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBC3.110.110"}, "ts": "2023-07-25 13:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBC3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQC3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:43:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BQC3.435.435"}, "ts": "2023-07-25 13:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35226-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:44:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35226-1.256.256"}, "ts": "2023-07-25 13:44:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:44:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30102256", "type": "PubMed"}, "ts": "2023-07-25 13:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30102256", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:44:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000111"}, "ts": "2023-07-25 13:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:45:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75509"}, "ts": "2023-07-25 13:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:45:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70570"}, "ts": "2023-07-25 13:45:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUM9"}, "ts": "2023-07-25 13:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R0H7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:45:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R0H7"}, "ts": "2023-07-25 13:45:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22072671", "type": "PubMed"}, "ts": "2023-07-25 13:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22072671", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:46:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0K1"}, "ts": "2023-07-25 13:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0K1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T9"}, "ts": "2023-07-25 13:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:47:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33766"}, "ts": "2023-07-25 13:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:47:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-25 13:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:48:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 13:48:06 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 13:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 13:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:48:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60235"}, "ts": "2023-07-25 13:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12923", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:49:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12923"}, "ts": "2023-07-25 13:49:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-25 13:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGV3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 13:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 13:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGV3", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 13:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 13:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02038LQ"}, "ts": "2023-07-25 13:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17066", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:49:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17066"}, "ts": "2023-07-25 13:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84452RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:50:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-25 13:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 13:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UN71", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 13:50:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UN71"}, "ts": "2023-07-25 13:50:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-25 13:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:51:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60287-1"}, "ts": "2023-07-25 13:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60287-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:51:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCC5"}, "ts": "2023-07-25 13:51:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:51:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-25 13:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-25 13:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19285439", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:51:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19285439", "type": "PubMed"}, "ts": "2023-07-25 13:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51674", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:52:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51674"}, "ts": "2023-07-25 13:52:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000117"}, "ts": "2023-07-25 13:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15118", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:52:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15118.596.596"}, "ts": "2023-07-25 13:52:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V14", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V14"}, "ts": "2023-07-25 13:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01730"}, "ts": "2023-07-25 13:53:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14004", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 13:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 13:53:24 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 13:53:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14004.1286.1286"}, "ts": "2023-07-25 13:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A488-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 13:53:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "D4A488-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 13:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 13:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A488-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 13:53:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGH9.227.227"}, "ts": "2023-07-25 13:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGH9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:54:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20719"}, "ts": "2023-07-25 13:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20719", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35354", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:54:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35354.580.580"}, "ts": "2023-07-25 13:54:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AEL8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:54:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AEL8"}, "ts": "2023-07-25 13:54:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00747.263.263"}, "ts": "2023-07-25 13:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:54:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "26176669"}, "ts": "2023-07-25 13:54:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 13:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0S5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:54:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UN88"}, "ts": "2023-07-25 13:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UN88", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:55:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-25 13:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19324841", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 13:55:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19324841", "type": "PubMed"}, "ts": "2023-07-25 13:55:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-25 13:56:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-25 13:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22768VO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:56:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97776"}, "ts": "2023-07-25 13:56:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97776", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:56:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000072"}, "ts": "2023-07-25 13:57:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96M98.73.73"}, "ts": "2023-07-25 13:57:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96M98", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49736", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UCQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:57:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49736"}, "ts": "2023-07-25 13:57:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UCQ1"}, "ts": "2023-07-25 13:57:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 13:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UP95", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 13:58:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UP95"}, "ts": "2023-07-25 13:58:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG6"}, "ts": "2023-07-25 13:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:58:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15599"}, "ts": "2023-07-25 13:58:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:58:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00975"}, "ts": "2023-07-25 13:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:58:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43561.43.43"}, "ts": "2023-07-25 13:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43561", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HD2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 13:59:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HD2-1"}, "ts": "2023-07-25 13:59:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-25 13:59:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75762", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 13:59:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75762.166.166"}, "ts": "2023-07-25 13:59:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08174.813.813"}, "ts": "2023-07-25 13:59:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-25 13:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66621EA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 13:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 14:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 14:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 14:00:01 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 14:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 14:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 14:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UIK4-1"}, "ts": "2023-07-25 14:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UIK4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07288", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07288"}, "ts": "2023-07-25 14:00:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9QXB9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 14:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXB9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 14:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXB9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 14:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 14:01:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-25 14:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:01:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08721"}, "ts": "2023-07-25 14:02:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99452IK"}, "ts": "2023-07-25 14:02:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-25 14:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56817"}, "ts": "2023-07-25 14:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBU9"}, "ts": "2023-07-25 14:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:02:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5K4E3"}, "ts": "2023-07-25 14:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5K4E3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5NDF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5NDF0"}, "ts": "2023-07-25 14:03:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNC4"}, "ts": "2023-07-25 14:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:04:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKY1"}, "ts": "2023-07-25 14:04:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75469"}, "ts": "2023-07-25 14:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75469", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070"}, "ts": "2023-07-25 14:05:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:05:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G95335FK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:05:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95335FK"}, "ts": "2023-07-25 14:05:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98161"}, "ts": "2023-07-25 14:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C7U1"}, "ts": "2023-07-25 14:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7U1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WU17", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:05:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WU17.110.110"}, "ts": "2023-07-25 14:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:05:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58173"}, "ts": "2023-07-25 14:06:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54132"}, "ts": "2023-07-25 14:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:06:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-25 14:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:07:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000101"}, "ts": "2023-07-25 14:07:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:07:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:07:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:07:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1Y3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:07:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1Y3-1"}, "ts": "2023-07-25 14:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-25 14:08:00 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-25 14:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-25 14:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "super-search", "message": "Performing Super Search. Super Search query={\"concept_query_list\":[{\"concept\":\"glycan\",\"query\":{\"aggregator\":\"$and\",\"unaggregated_list\":[{\"order\":0,\"path\":\"glytoucan_ac\",\"operator\":\"$eq\",\"string_value\":\"G17689DH\"}],\"aggregated_list\":[]}}]}"}, "ts": "2023-07-25 14:08:09 EDT-0400"}, {"api": "/supersearch/search/", "req": {"concept_query_list": [{"concept": "glycan", "query": {"aggregator": "$and", "unaggregated_list": [{"order": 0, "path": "glytoucan_ac", "operator": "$eq", "string_value": "G17689DH"}], "aggregated_list": []}}]}, "ts": "2023-07-25 14:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2J0"}, "ts": "2023-07-25 14:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:08:34 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:08:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2J0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-25 14:08:41 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-25 14:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-25 14:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-25 14:08:51 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-25 14:08:51 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 4}, "ts": "2023-07-25 14:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">4", "user": "Anonymous", "type": "user", "page": "blast", "message": "Blast Search query=4"}, "ts": "2023-07-25 14:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-25 14:08:55 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 4}, "ts": "2023-07-25 14:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:09:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937"}, "ts": "2023-07-25 14:09:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P14210-1, Q08048-1, P17945-1, P26927-1, P26928-1, F7FMS0-1, P20918-1, Q01177-1, Q2TV78-1, P00747-1, P08519-1, P19637-1, P11214-1, P00750-1, P00734-1, P19221-1, Q9R098-1, F7ELL4-1, P18292-1, Q04756-1, Q6L711-1, Q80YC5-1, Q8K0D2-1, P29598-1, D3ZTE0-1, Q14520-1, P00748-1, P06869-1, Q9ESD1-1, Q9ES87-1, Q02844-1, P00749-1, P20231-1, Q15661-1, P97435-1, P27435-1, Q16651-1, Q8NF86-1, P98073-1, Q9CR35-1, Q8CGR6-1, Q8K1T0-1, D3ZY65-1, Q3UKY7-1, D4ACZ0-1, D3ZJ70-1, A0A8I6APH4-1, E9Q409-1, Q792Z0-1, P14272-1, Q9UKR3-1, P03952-1, D4A911-1, P26262-1, W4VSR6-1, P07477-1, P07338-1, P05981-1, Q92876-1, Q9R0T7-1, Q9QUK9-1, F1LVG1-1, P00763-1, Q80UR4-1, Q8BJR6-1, Q9BQR3-1, Q91Y47-1, Q9Z1R9-1, A0A8I5Y5M6-1, Q792Y8-1, P08217-1, P57727-1, A0A8I6AAZ3-1, A0A8I5ZME9-1, O60235-1, P21845-1, Q8IQ10-1, P50343-1, Q792Y9-1, D3ZQV0-1, P00762-1, Q5U405-1, O35453-1, P17538-1, P08426-1, F7FMG3-1, M0RAL3-1, Q6GPI1-1, Q9CPN9-1, P05208-1, Q6BEA2-1, Q9UNI1-1, P12788-1, P00774-1, P35030-1, A0A0G2K4I9-1, Q9BYE2-1, P00773-1, Q792Z1-1, P15947-1, A0A1W2Q644-1, P08218-1, G3V8H1-1, P32821-1, P36373-1, P07146-1, Q9NRS4-1, Q7Z410-1, A1L453-1, A0A0N4SVQ0-1, Q16609-1, O15393-1, F6R7E8-1, Q9CPN7-1, Q9JHJ7-1, A0A8I6GHE1-1, Q7RTY9-1, D4AB49-1, F1LSP0-1, Q924N9-1, Q80WM7-1, Q05511-1, D3Z9X4-1, Q7RTY3-1, P00758-1, P03951-1, P69526-1, A0A8I6AMU8-1, Q8VCA5-1, P15948-1, P07478-1, Q8NHM4-1, P32822-1, P15946-1, Q6IE15-1, Q91X79-1, P00757-1, P83748-1, Q9ER04-1, Q14B25-1, P40313-1, Q9UBX7-2, Q8VHJ4-1, P09093-1, Q61754-1, Q9GZN4-1, A6H6T1-1, P08861-1, Q9Y6M0-1, Q61955-1, Q9CQ52-1, Q6P7D7-1, P49862-1, Q9QUL7-1, P00759-1, F1M2C8-1, Q9JIQ8-1, Q9VSU2-1, Q9NRR2-1, Q9ER05-1, P15945-1, P36374-1, M9NDV6-1, Q1JRP2-1, P69525-1, D3ZZK6-1, D4AAE4-1, P07288-1, Q8VHK8-1, P36375-1, M0R778-1, D4AEK6-1, Q8IRX5-1, A0A0G2KAN9-1, Q9JM71-1, P00756-1, P49864-1, Q61759-1, Q9VEA0-1, B5DF96-1, P36369-1, Q9H3S3-1, P06870-1, O35205-1, Q920S2-1, Q6UWB4-1, P36376-1, F1M091-1, O88780-1, P00746-1, Q402U7-1, D3ZXU4-1, P04071-1, Q99MS4-1, P33587-1, Q91VE3-1, Q9ER10-1, Q5K2P9-1, P15949-1, Q7RTY5-2, Q9DBI0-1, P07647-1, Q9QYN3-1, Q6AXZ6-1, O43240-1, Q8VIF2-1, P31394-1, O54854-1, F1M6D3-1, Q9QYZ9-1, P00755-1, Q8IU80-4, P36368-1, P29293-1, Q3V0Q7-1, A0A8I6G6J0-1, Q86WS5-1, Q32M27-1, Q7RTY7-1, Q5QSK2-1, A6NIE9-1, P08709-1, P04070-1, P07628-1, Q9P0G3-1, Q8CGR5-1, Q06605-1, P23578-1, Q03238-1, Q9H2R5-1, A0A8I6A055-1, Q6ZWK6-1, Q9Y5Y6-1, D4A488-1, G3V934-1, Q91Y82-1, P20151-1, Q5K4E3-1, O08643-1, P24158-1, F1M348-1, D4ABF2-1, Q86T26-1, Q5K2P8-1, Q8BZ10-1, Q8BIK6-1, O08762-1, Q9JJI7-1, Q9VGB9-1, Q9VUG2-1"}, "ts": "2023-07-25 14:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:09:46 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:09:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50454"}, "ts": "2023-07-25 14:09:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14896"}, "ts": "2023-07-25 14:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:09:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5F8", "cluster_type": "unselected"}, "ts": "2023-07-25 14:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 14:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F8", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 14:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-25 14:12:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000081"}, "ts": "2023-07-25 14:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE60"}, "ts": "2023-07-25 14:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:13:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:13:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGC0"}, "ts": "2023-07-25 14:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80662SX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:14:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80662SX"}, "ts": "2023-07-25 14:14:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25520XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BUE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:15:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BUE4"}, "ts": "2023-07-25 14:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UEE5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:15:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UEE5-1"}, "ts": "2023-07-25 14:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IF63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:15:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IF63.15.15"}, "ts": "2023-07-25 14:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76071"}, "ts": "2023-07-25 14:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:15:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-25 14:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VIP2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 14:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VIP2"}, "ts": "2023-07-25 14:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09472", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:16:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q09472.1391.1391"}, "ts": "2023-07-25 14:16:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGT6"}, "ts": "2023-07-25 14:17:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:17:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B96"}, "ts": "2023-07-25 14:17:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:17:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-25 14:17:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:17:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08721", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:18:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000064"}, "ts": "2023-07-25 14:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:18:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02751-15.528.528"}, "ts": "2023-07-25 14:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01097", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:18:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01097.348.348"}, "ts": "2023-07-25 14:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:19:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95478-1"}, "ts": "2023-07-25 14:19:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95478-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:19:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23415232", "type": "PubMed"}, "ts": "2023-07-25 14:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23415232", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K9W0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:19:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K9W0"}, "ts": "2023-07-25 14:19:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20239"}, "ts": "2023-07-25 14:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20239", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:20:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13595", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:20:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13595"}, "ts": "2023-07-25 14:20:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46531"}, "ts": "2023-07-25 14:21:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:21:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52292"}, "ts": "2023-07-25 14:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555"}, "ts": "2023-07-25 14:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33746035", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:22:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33746035", "type": "PubMed"}, "ts": "2023-07-25 14:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33746035", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 14:22:04 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:22:13 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 14:22:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:22:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 14:22:16 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-25 14:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6db0a535f896f31ad73eeecc521ee9e7", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 14:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 14:22:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93822DY"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81459MV"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626XQ"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29255IL"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64132UH"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24005JZ"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67393WG"}, "ts": "2023-07-25 14:22:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72956NR"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30048DT"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48844XN"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74026TS"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94019IV"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90889KG"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61734US"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180XB"}, "ts": "2023-07-25 14:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-25 14:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K135"}, "ts": "2023-07-25 14:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K135", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:22:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX14"}, "ts": "2023-07-25 14:22:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX14", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:22:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-25 14:22:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01042-1"}, "ts": "2023-07-25 14:23:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-25 14:23:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00584"}, "ts": "2023-07-25 14:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBU9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:23:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBU9.346.346"}, "ts": "2023-07-25 14:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33261556", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:23:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33261556", "type": "PubMed"}, "ts": "2023-07-25 14:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:23:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-25 14:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:23:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBU9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 14:23:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9HBU9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 14:23:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBU9.4.4"}, "ts": "2023-07-25 14:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBU9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 14:23:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES82-1"}, "ts": "2023-07-25 14:23:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P722-1"}, "ts": "2023-07-25 14:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P722-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES82-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19562805", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:23:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19562805", "type": "PubMed"}, "ts": "2023-07-25 14:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:23:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "36624536", "type": "PubMed"}, "ts": "2023-07-25 14:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "36624536", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:23:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBU9.344.344"}, "ts": "2023-07-25 14:23:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14978", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:23:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14978"}, "ts": "2023-07-25 14:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T5X7-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:24:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T5X7-1.225.225"}, "ts": "2023-07-25 14:24:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9HBU9", "cluster_type": "unselected"}, "ts": "2023-07-25 14:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:25:04 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 14:25:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:25:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 14:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 14:25:07 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G53621MK", "term_category": "any"}, "ts": "2023-07-25 14:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7>96bb98ee80cb39f1b9b1cf47188e3939", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G53621MK\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 14:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "96bb98ee80cb39f1b9b1cf47188e3939", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 14:25:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "96bb98ee80cb39f1b9b1cf47188e3939", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:25:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53621MK"}, "ts": "2023-07-25 14:25:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:25:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8"}, "ts": "2023-07-25 14:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:25:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 14:25:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53621MK"}, "ts": "2023-07-25 14:25:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53621MK", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:25:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:25:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:25:25 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 14:25:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "96bb98ee80cb39f1b9b1cf47188e3939", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "96bb98ee80cb39f1b9b1cf47188e3939", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 14:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26642364", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:25:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26642364", "type": "PubMed"}, "ts": "2023-07-25 14:25:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "96bb98ee80cb39f1b9b1cf47188e3939", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 14:25:31 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G82740LG", "term_category": "any"}, "ts": "2023-07-25 14:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "96bb98ee80cb39f1b9b1cf47188e3939>70530426bc65dc5f5d6ac636aac130f4", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G82740LG\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 14:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "70530426bc65dc5f5d6ac636aac130f4", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 14:25:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "70530426bc65dc5f5d6ac636aac130f4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82740LG"}, "ts": "2023-07-25 14:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82740LG", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:25:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82740LG"}, "ts": "2023-07-25 14:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-25 14:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:25:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40424"}, "ts": "2023-07-25 14:25:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6327169", "type": "PubMed"}, "ts": "2023-07-25 14:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6327169", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:26:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBU9.361.361"}, "ts": "2023-07-25 14:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBU9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 14:26:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBU9.6.6"}, "ts": "2023-07-25 14:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63096"}, "ts": "2023-07-25 14:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:27:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60568"}, "ts": "2023-07-25 14:27:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-25 14:28:05 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-25 14:28:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU6-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:28:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDU6-1.4.4"}, "ts": "2023-07-25 14:28:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-25 14:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:28:36 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59708", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:28:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59708"}, "ts": "2023-07-25 14:28:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-25 14:28:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:28:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 14:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7511099", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:29:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7511099", "type": "PubMed"}, "ts": "2023-07-25 14:29:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MTQ0-1"}, "ts": "2023-07-25 14:29:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-25 14:29:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-25 14:29:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04791QM"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07995VK"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MTQ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23295TF"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30460NZ"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27919IH"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31916IQ"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43694RQ"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-25 14:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66937TJ"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75850OP"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58667NI"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81295CK"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-25 14:29:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEV4"}, "ts": "2023-07-25 14:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P7Q1-1"}, "ts": "2023-07-25 14:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P7Q1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:29:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C9JE40"}, "ts": "2023-07-25 14:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JE40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:30:05 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:30:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25101"}, "ts": "2023-07-25 14:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25101", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:30:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZV9"}, "ts": "2023-07-25 14:30:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY41.39.39"}, "ts": "2023-07-25 14:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY41", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06238", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:32:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06238.74.74"}, "ts": "2023-07-25 14:32:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIB4"}, "ts": "2023-07-25 14:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:32:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:32:39 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 14:32:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 14:32:41 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-25 14:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6db0a535f896f31ad73eeecc521ee9e7", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 14:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 14:32:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:32:42 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 14:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 14:32:48 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-25 14:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 14:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 14:32:51 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 14:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 14:32:51 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 14:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 14:32:56 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 14:32:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPH2"}, "ts": "2023-07-25 14:32:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:32:56 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 14:32:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Search modification initiated"}, "ts": "2023-07-25 14:32:57 EDT-0400"}, {"api": "/protein/search/", "req": {"operation": "AND", "query_type": "search_protein"}, "ts": "2023-07-25 14:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Performing Advanced Search"}, "ts": "2023-07-25 14:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded>6587be4a62c9b51692ebacc17eb2a5b9", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\"}"}, "ts": "2023-07-25 14:33:00 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 14:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6587be4a62c9b51692ebacc17eb2a5b9", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 14:33:00 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "6587be4a62c9b51692ebacc17eb2a5b9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 14:33:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01081"}, "ts": "2023-07-25 14:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01081", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8828036", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:33:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8828036", "type": "PubMed"}, "ts": "2023-07-25 14:33:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925F2"}, "ts": "2023-07-25 14:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10636909", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:33:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10636909", "type": "PubMed"}, "ts": "2023-07-25 14:33:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394"}, "ts": "2023-07-25 14:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "site-search", "message": "page access"}, "ts": "2023-07-25 14:33:38 EDT-0400"}, {"api": "/site/search_init/", "req": {}, "ts": "2023-07-25 14:33:38 EDT-0400"}, {"api": "/supersearch/search/", "req": {"concept_query_list": []}, "ts": "2023-07-25 14:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "site-search", "message": "Performing Site Search"}, "ts": "2023-07-25 14:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "site-search", "message": "No results."}, "ts": "2023-07-25 14:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "site-search", "message": "Performing Site Search"}, "ts": "2023-07-25 14:33:47 EDT-0400"}, {"api": "/supersearch/search/", "req": {"concept_query_list": [{"concept": "site", "query": {"aggregator": "$and", "unaggregated_list": [{"path": "site_seq", "order": 0, "operator": "$eq", "string_value": "T"}], "aggregated_list": []}}]}, "ts": "2023-07-25 14:33:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">223e345131a27dfe3852b3ae56ae5181", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "site-search", "message": "Site Search query={\"proteinId\":[],\"aminoType\":\"T\",\"annotations\":[],\"annotationOperation\":\"$and\",\"singleannotations\":\"\",\"operator\":\"$lte\",\"updownoperator\":\"down_seq\",\"distance\":\"\",\"combinedPattern\":\"\"}"}, "ts": "2023-07-25 14:33:55 EDT-0400"}, {"api": "/supersearch/list/", "req": {"id": "223e345131a27dfe3852b3ae56ae5181", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:33:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "site-list", "message": "page access"}, "ts": "2023-07-25 14:33:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "223e345131a27dfe3852b3ae56ae5181", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "site-list", "message": "page access"}, "ts": "2023-07-25 14:33:58 EDT-0400"}, {"api": "/site/search_init/", "req": {}, "ts": "2023-07-25 14:33:58 EDT-0400"}, {"api": "/supersearch/list/", "req": {"id": "223e345131a27dfe3852b3ae56ae5181", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:33:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000046"}, "ts": "2023-07-25 14:34:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-25 14:34:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-25 14:34:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:35:14 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 14:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-25 14:35:18 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": ""}, "ts": "2023-07-25 14:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">f3cf76dbbbc57727260a5cab991ba11d", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\"}"}, "ts": "2023-07-25 14:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f3cf76dbbbc57727260a5cab991ba11d", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 14:35:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f3cf76dbbbc57727260a5cab991ba11d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:35:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-25 14:35:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63889NK"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91365ZQ"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-25 14:35:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:36:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47888"}, "ts": "2023-07-25 14:36:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12814"}, "ts": "2023-07-25 14:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AWL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:36:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AWL9"}, "ts": "2023-07-25 14:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14562"}, "ts": "2023-07-25 14:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14562", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:36:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1482348", "type": "PubMed"}, "ts": "2023-07-25 14:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1482348", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:36:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45637XA"}, "ts": "2023-07-25 14:36:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-25 14:36:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-25 14:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52292", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:37:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253"}, "ts": "2023-07-25 14:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:38:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000043"}, "ts": "2023-07-25 14:39:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01042-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:39:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:39:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L5Y1"}, "ts": "2023-07-25 14:40:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:40:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L5Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:40:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11684292", "type": "PubMed"}, "ts": "2023-07-25 14:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11684292", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42345", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:40:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42345"}, "ts": "2023-07-25 14:40:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "E9Q3P4-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 14:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q3P4-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 14:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q3P4-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 14:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:41:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:41:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQC9"}, "ts": "2023-07-25 14:42:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:42:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUI6"}, "ts": "2023-07-25 14:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:42:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03825XC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:43:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03825XC"}, "ts": "2023-07-25 14:43:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14358WN"}, "ts": "2023-07-25 14:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPG1"}, "ts": "2023-07-25 14:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-25 14:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q496Z0-1"}, "ts": "2023-07-25 14:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q496Z0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:43:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24941"}, "ts": "2023-07-25 14:44:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:44:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00199AH"}, "ts": "2023-07-25 14:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:45:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B23"}, "ts": "2023-07-25 14:45:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-25 14:45:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08508", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:45:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08508.64.64"}, "ts": "2023-07-25 14:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPG1"}, "ts": "2023-07-25 14:45:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49859SH"}, "ts": "2023-07-25 14:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49859SH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AYB6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 14:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1AYB6"}, "ts": "2023-07-25 14:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90333CG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:47:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90333CG"}, "ts": "2023-07-25 14:47:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE85"}, "ts": "2023-07-25 14:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE85", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZXV5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:49:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZXV5.453.453"}, "ts": "2023-07-25 14:49:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6TXG7"}, "ts": "2023-07-25 14:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6TXG7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 14:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6TXG7", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 14:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000032"}, "ts": "2023-07-25 14:49:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14139"}, "ts": "2023-07-25 14:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91413ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13807", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:50:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13807"}, "ts": "2023-07-25 14:50:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14654"}, "ts": "2023-07-25 14:51:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14654", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:51:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 14:51:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CWH0"}, "ts": "2023-07-25 14:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CWH0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 14:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16816-1"}, "ts": "2023-07-25 14:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXR3"}, "ts": "2023-07-25 14:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXR3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 14:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-25 14:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:52:50 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 14:52:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 14:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-25 14:52:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42226"}, "ts": "2023-07-25 14:52:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 14:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-25 14:53:02 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "O-fucose"}, "ts": "2023-07-25 14:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">d9e5150f6928d93fa1a10f2e3607cecd", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"O-fucose\"}"}, "ts": "2023-07-25 14:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d9e5150f6928d93fa1a10f2e3607cecd", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 14:53:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d9e5150f6928d93fa1a10f2e3607cecd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:53:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70593HA"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60605ZN"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06038KF"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50236GJ"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27608TI"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98896IU"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36855WW"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39294YF"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98318PN"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17931GP"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30868KJ"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34964CV"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17988BN"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01758EA"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21971UP"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08324ZK"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48998UF"}, "ts": "2023-07-25 14:53:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54574KG"}, "ts": "2023-07-25 14:53:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26040WE"}, "ts": "2023-07-25 14:53:04 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:53:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70593HA"}, "ts": "2023-07-25 14:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70593HA", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 14:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42932DS"}, "ts": "2023-07-25 14:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58879PQ"}, "ts": "2023-07-25 14:53:09 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 14:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 14:53:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-25 14:53:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-25 14:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:54:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11055895", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 14:54:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11055895", "type": "PubMed"}, "ts": "2023-07-25 14:54:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZF2"}, "ts": "2023-07-25 14:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3P9"}, "ts": "2023-07-25 14:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3P9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2W2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 14:54:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2W2.481.481"}, "ts": "2023-07-25 14:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:55:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000041"}, "ts": "2023-07-25 14:55:15 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 14:56:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 14:56:25 EDT-0400"}, {"api": "/typeahead/typeahead/", "req": {"field": "go_id", "value": "GO:0005739", "limit": 100}, "ts": "2023-07-25 14:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Performing Advanced Search"}, "ts": "2023-07-25 14:56:32 EDT-0400"}, {"api": "/protein/search/", "req": {"operation": "AND", "query_type": "search_protein", "go_id": "GO:0005739"}, "ts": "2023-07-25 14:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">91d42693992161342daafb84f7baa7b5", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_protein\",\"go_id\":\"GO:0005739\"}"}, "ts": "2023-07-25 14:56:33 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 14:56:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "91d42693992161342daafb84f7baa7b5", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 14:56:33 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "91d42693992161342daafb84f7baa7b5", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 14:56:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 14:57:20 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 14:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-25 14:57:28 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "O-mannose"}, "ts": "2023-07-25 14:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">150408c08cb01c0e9f0665d18762a3bf", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"O-mannose\"}"}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "150408c08cb01c0e9f0665d18762a3bf", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "150408c08cb01c0e9f0665d18762a3bf", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59126YU"}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28052FT"}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-25 14:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49644CL"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46831QF"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28681TP"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20956ZV"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93579XB"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16404NW"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81911LP"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29191MN"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52805ZP"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16403CM"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63498YL"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22898AD"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61023PY"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28911EK"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81952MV"}, "ts": "2023-07-25 14:57:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59126YU"}, "ts": "2023-07-25 14:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59126YU", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 14:57:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-25 14:57:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-25 14:57:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63053UD"}, "ts": "2023-07-25 14:57:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55677NY"}, "ts": "2023-07-25 14:57:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33885RT"}, "ts": "2023-07-25 14:57:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2T1"}, "ts": "2023-07-25 14:58:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3H5-1"}, "ts": "2023-07-25 14:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3H5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 14:59:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-25 14:59:55 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 15:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 15:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 15:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 15:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 15:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 15:00:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000058"}, "ts": "2023-07-25 15:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:00:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXB1"}, "ts": "2023-07-25 15:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 15:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12032", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12032"}, "ts": "2023-07-25 15:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:01:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9P015", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 15:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P015", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 15:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P015", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 15:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:02:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV08"}, "ts": "2023-07-25 15:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WI0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:02:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86WI0.153.153"}, "ts": "2023-07-25 15:02:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCG1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 15:03:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8VCG1-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 15:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCG1-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 15:03:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-25 15:03:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DD2"}, "ts": "2023-07-25 15:03:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:03:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-25 15:04:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58743"}, "ts": "2023-07-25 15:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58743", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:04:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30559"}, "ts": "2023-07-25 15:04:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6J3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6J3"}, "ts": "2023-07-25 15:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98158"}, "ts": "2023-07-25 15:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:05:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDS5"}, "ts": "2023-07-25 15:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:05:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000073"}, "ts": "2023-07-25 15:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:06:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31639"}, "ts": "2023-07-25 15:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:06:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.114.114"}, "ts": "2023-07-25 15:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 15:06:25 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 15:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 15:06:27 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-25 15:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 15:06:27 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 15:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 15:06:27 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 15:06:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-25 15:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:06:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-25 15:06:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-25 15:06:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:06:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:06:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:06:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5C9Z4"}, "ts": "2023-07-25 15:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5C9Z4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:06:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.114.114"}, "ts": "2023-07-25 15:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:07:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UF56", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 15:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UF56", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 15:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UF56", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 15:08:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPZ6"}, "ts": "2023-07-25 15:08:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:08:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15758", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:08:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15927"}, "ts": "2023-07-25 15:09:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:09:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60882"}, "ts": "2023-07-25 15:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60882", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:10:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U515"}, "ts": "2023-07-25 15:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42694-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42694-1"}, "ts": "2023-07-25 15:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000121"}, "ts": "2023-07-25 15:11:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q15796", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 15:11:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15796", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 15:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15796", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 15:11:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06733"}, "ts": "2023-07-25 15:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35221", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:12:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35221"}, "ts": "2023-07-25 15:12:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62715-1"}, "ts": "2023-07-25 15:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62715-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:12:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-25 15:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:13:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48740", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:13:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48740"}, "ts": "2023-07-25 15:13:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SH4"}, "ts": "2023-07-25 15:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:13:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20823"}, "ts": "2023-07-25 15:13:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R0H7"}, "ts": "2023-07-25 15:14:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R0H7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:14:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64729"}, "ts": "2023-07-25 15:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64729", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:14:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09871.683.683"}, "ts": "2023-07-25 15:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VXI9"}, "ts": "2023-07-25 15:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VXI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16442"}, "ts": "2023-07-25 15:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 15:16:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000110"}, "ts": "2023-07-25 15:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:16:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16402.198.198"}, "ts": "2023-07-25 15:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16402", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:16:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCK1.888.888"}, "ts": "2023-07-25 15:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCK1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:17:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-25 15:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:17:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43116"}, "ts": "2023-07-25 15:17:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:19:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15407YE"}, "ts": "2023-07-25 15:19:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15407YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:19:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30559", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:20:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60235"}, "ts": "2023-07-25 15:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:20:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000039"}, "ts": "2023-07-25 15:21:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43556.200.200"}, "ts": "2023-07-25 15:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43556", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGL3"}, "ts": "2023-07-25 15:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18269759", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:23:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18269759", "type": "PubMed"}, "ts": "2023-07-25 15:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-25 15:23:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56202TA"}, "ts": "2023-07-25 15:23:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56202TA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:23:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613"}, "ts": "2023-07-25 15:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WW43-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WW43-1"}, "ts": "2023-07-25 15:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTX8"}, "ts": "2023-07-25 15:25:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:25:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXA5"}, "ts": "2023-07-25 15:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02425YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:26:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02425YO"}, "ts": "2023-07-25 15:26:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000054"}, "ts": "2023-07-25 15:27:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7L8"}, "ts": "2023-07-25 15:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7L8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49407", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:28:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49407"}, "ts": "2023-07-25 15:28:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-25 15:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:29:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTX2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:29:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WTX2.18.18"}, "ts": "2023-07-25 15:29:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z133", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 15:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z133"}, "ts": "2023-07-25 15:30:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A781"}, "ts": "2023-07-25 15:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A781", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36324QX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:31:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36324QX"}, "ts": "2023-07-25 15:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:31:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N336"}, "ts": "2023-07-25 15:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N336", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:32:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21408167", "type": "PubMed"}, "ts": "2023-07-25 15:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21408167", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:32:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000037"}, "ts": "2023-07-25 15:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:33:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47863"}, "ts": "2023-07-25 15:33:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47863", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:33:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26572"}, "ts": "2023-07-25 15:34:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26572", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:35:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PIJ6.592.592"}, "ts": "2023-07-25 15:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PIJ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:35:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33527-1"}, "ts": "2023-07-25 15:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33527-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13725-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:35:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13725-1.100.100"}, "ts": "2023-07-25 15:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95196"}, "ts": "2023-07-25 15:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:35:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02280"}, "ts": "2023-07-25 15:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCT3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:36:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCT3-1"}, "ts": "2023-07-25 15:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-25 15:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7H5"}, "ts": "2023-07-25 15:36:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 15:36:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 15:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:37:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-25 15:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34725712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:37:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34725712", "type": "PubMed"}, "ts": "2023-07-25 15:37:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N743.2.2"}, "ts": "2023-07-25 15:37:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N743", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:37:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:37:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61266"}, "ts": "2023-07-25 15:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:37:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29741879", "type": "PubMed"}, "ts": "2023-07-25 15:37:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29741879", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02628JF"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02315DX"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03461SC"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03930BU"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04672QB"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04784US"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05933EN"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06231AO"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09197ZW"}, "ts": "2023-07-25 15:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66766XF"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94854LT"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25637MV"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37399XV"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50757KG"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-25 15:37:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-25 15:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01081", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01081"}, "ts": "2023-07-25 15:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VE47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:38:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VE47"}, "ts": "2023-07-25 15:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IMN6"}, "ts": "2023-07-25 15:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IMN6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-25 15:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6V1P9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:38:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6V1P9"}, "ts": "2023-07-25 15:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:39:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ01"}, "ts": "2023-07-25 15:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:39:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTX7"}, "ts": "2023-07-25 15:39:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43581", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 15:40:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43581"}, "ts": "2023-07-25 15:40:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16144"}, "ts": "2023-07-25 15:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:40:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU9"}, "ts": "2023-07-25 15:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54840"}, "ts": "2023-07-25 15:40:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:40:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-25 15:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 15:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 15:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X95", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:41:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X95.155.155"}, "ts": "2023-07-25 15:41:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000051"}, "ts": "2023-07-25 15:41:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM21"}, "ts": "2023-07-25 15:42:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:42:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-25 15:42:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-25 15:43:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37275"}, "ts": "2023-07-25 15:43:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12884"}, "ts": "2023-07-25 15:43:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12884"}, "ts": "2023-07-25 15:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000037"}, "ts": "2023-07-25 15:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:44:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:44:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:44:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.114.114"}, "ts": "2023-07-25 15:45:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:45:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000021"}, "ts": "2023-07-25 15:45:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:45:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.245.245"}, "ts": "2023-07-25 15:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:45:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:46:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:46:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UA1"}, "ts": "2023-07-25 15:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:46:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-25 15:46:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.934.934"}, "ts": "2023-07-25 15:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:46:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 15:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20364144", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:47:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20364144", "type": "PubMed"}, "ts": "2023-07-25 15:47:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45379"}, "ts": "2023-07-25 15:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:47:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BP2"}, "ts": "2023-07-25 15:47:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-25 15:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PRD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:47:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PRD1"}, "ts": "2023-07-25 15:47:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q495A1"}, "ts": "2023-07-25 15:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q495A1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63116-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:48:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63116-1"}, "ts": "2023-07-25 15:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33527-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:49:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33527-1"}, "ts": "2023-07-25 15:49:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04085", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:49:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04085"}, "ts": "2023-07-25 15:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000060"}, "ts": "2023-07-25 15:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQD0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:49:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQD0.1383.1383"}, "ts": "2023-07-25 15:49:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55011"}, "ts": "2023-07-25 15:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GY3"}, "ts": "2023-07-25 15:50:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10646.145.145"}, "ts": "2023-07-25 15:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10646", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQS9"}, "ts": "2023-07-25 15:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQS9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:51:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-25 15:51:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-25 15:51:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:52:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-25 15:52:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19267780", "type": "PubMed"}, "ts": "2023-07-25 15:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19267780", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 15:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 15:53:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L5"}, "ts": "2023-07-25 15:53:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-25 15:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42666HT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-25 15:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-25 15:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19234OH"}, "ts": "2023-07-25 15:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54064OC"}, "ts": "2023-07-25 15:53:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000069"}, "ts": "2023-07-25 15:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04114"}, "ts": "2023-07-25 15:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04114", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:53:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C7N5"}, "ts": "2023-07-25 15:53:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7N5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24468"}, "ts": "2023-07-25 15:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24468", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:54:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-25 15:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99707"}, "ts": "2023-07-25 15:55:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000077"}, "ts": "2023-07-25 15:55:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-25 15:55:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-25 15:56:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:56:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29127148", "type": "PubMed"}, "ts": "2023-07-25 15:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29127148", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 15:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:56:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61266"}, "ts": "2023-07-25 15:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:56:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-25 15:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:57:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01830"}, "ts": "2023-07-25 15:57:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000013"}, "ts": "2023-07-25 15:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06210XB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:58:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06210XB"}, "ts": "2023-07-25 15:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10425SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 15:58:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12907.301.301"}, "ts": "2023-07-25 15:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12907", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31274", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:58:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31274"}, "ts": "2023-07-25 15:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12884", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:59:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12884", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 15:59:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 15:59:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.142.142"}, "ts": "2023-07-25 15:59:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31665QC"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-25 15:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000082"}, "ts": "2023-07-25 15:59:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P11835", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 16:00:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11835", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 16:00:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11835", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-25 16:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 16:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 16:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 16:00:01 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 16:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 16:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 16:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14498", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:00:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14498.205.205"}, "ts": "2023-07-25 16:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 16:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43234", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 16:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43234"}, "ts": "2023-07-25 16:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01019"}, "ts": "2023-07-25 16:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15061"}, "ts": "2023-07-25 16:00:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JTW2"}, "ts": "2023-07-25 16:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTW2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:00:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-25 16:01:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-25 16:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:02:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUL3.188.188"}, "ts": "2023-07-25 16:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:02:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-25 16:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:03:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UY5.327.327"}, "ts": "2023-07-25 16:03:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-25 16:03:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000017"}, "ts": "2023-07-25 16:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2G8"}, "ts": "2023-07-25 16:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MQT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MQT2"}, "ts": "2023-07-25 16:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:04:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5F2"}, "ts": "2023-07-25 16:04:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35368"}, "ts": "2023-07-25 16:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35368", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:05:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000095"}, "ts": "2023-07-25 16:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:05:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:05:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23515"}, "ts": "2023-07-25 16:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55011", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:06:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75096"}, "ts": "2023-07-25 16:06:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-25 16:06:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9768693", "type": "PubMed"}, "ts": "2023-07-25 16:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9768693", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 16:06:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25054", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:07:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25054.1818.1818"}, "ts": "2023-07-25 16:07:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000075"}, "ts": "2023-07-25 16:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-25 16:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04792"}, "ts": "2023-07-25 16:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MV58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:08:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2MV58"}, "ts": "2023-07-25 16:08:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000105"}, "ts": "2023-07-25 16:09:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60721"}, "ts": "2023-07-25 16:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60721", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:09:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TD33"}, "ts": "2023-07-25 16:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80858MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7D4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7D4"}, "ts": "2023-07-25 16:10:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48056-1"}, "ts": "2023-07-25 16:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48056-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15109"}, "ts": "2023-07-25 16:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18850"}, "ts": "2023-07-25 16:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18850", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:10:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 16:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14139"}, "ts": "2023-07-25 16:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:11:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22105"}, "ts": "2023-07-25 16:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22105", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:11:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-25 16:11:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14451.435.435"}, "ts": "2023-07-25 16:11:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14451", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-25 16:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55091", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:12:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55091"}, "ts": "2023-07-25 16:12:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:13:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000089"}, "ts": "2023-07-25 16:13:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14220"}, "ts": "2023-07-25 16:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:13:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75056", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75056"}, "ts": "2023-07-25 16:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2U5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:14:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2U5"}, "ts": "2023-07-25 16:14:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-25 16:14:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99547"}, "ts": "2023-07-25 16:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99547", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:15:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-25 16:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92925-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92925-1"}, "ts": "2023-07-25 16:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86W56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:15:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q58NB6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:15:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86W56"}, "ts": "2023-07-25 16:15:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q58NB6-1"}, "ts": "2023-07-25 16:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61555", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:16:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61555"}, "ts": "2023-07-25 16:16:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58743", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:16:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58743"}, "ts": "2023-07-25 16:16:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34998"}, "ts": "2023-07-25 16:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-25 16:17:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000029"}, "ts": "2023-07-25 16:17:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HAH1.275.275"}, "ts": "2023-07-25 16:17:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:17:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60981-1"}, "ts": "2023-07-25 16:17:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:17:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11052OE"}, "ts": "2023-07-25 16:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11052OE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46777", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:18:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46777"}, "ts": "2023-07-25 16:18:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000119"}, "ts": "2023-07-25 16:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:19:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-25 16:19:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35632"}, "ts": "2023-07-25 16:19:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70389", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:20:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70389"}, "ts": "2023-07-25 16:20:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11189WY"}, "ts": "2023-07-25 16:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-25 16:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:21:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47888"}, "ts": "2023-07-25 16:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:21:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13618"}, "ts": "2023-07-25 16:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2K8"}, "ts": "2023-07-25 16:22:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000096"}, "ts": "2023-07-25 16:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:23:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31639"}, "ts": "2023-07-25 16:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 16:23:10 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 16:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 16:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AC62", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:23:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AC62"}, "ts": "2023-07-25 16:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 16:23:21 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 16:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 16:23:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07195"}, "ts": "2023-07-25 16:23:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:23:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY84"}, "ts": "2023-07-25 16:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-25 16:24:03 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 1, "max": 1}, {"residue": "hex", "min": 1, "max": 5}, {"residue": "hexnac", "min": 1, "max": 4}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 1, "max": 2}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-25 16:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7125da11e3e91753c2874ffc92609da2", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":1,\"max\":1},{\"residue\":\"hex\",\"min\":1,\"max\":5},{\"residue\":\"hexnac\",\"min\":1,\"max\":4},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":1,\"max\":2},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-25 16:24:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7125da11e3e91753c2874ffc92609da2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 16:24:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7125da11e3e91753c2874ffc92609da2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:24:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59655SA"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69982RY"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81413UE"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97947UQ"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63787RZ"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54505OS"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30460NZ"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23295TF"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43694RQ"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-25 16:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35599NO"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68937TM"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53752TA"}, "ts": "2023-07-25 16:24:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 16:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:24:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-25 16:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:24:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 16:24:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-25 16:24:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-25 16:24:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-25 16:24:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-25 16:24:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 16:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:24:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 16:24:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43115"}, "ts": "2023-07-25 16:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43115", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:24:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-25 16:24:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49281"}, "ts": "2023-07-25 16:25:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55058.245.245"}, "ts": "2023-07-25 16:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55058", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:25:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95838"}, "ts": "2023-07-25 16:25:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:25:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95838", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:25:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99598", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 16:26:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55174-1"}, "ts": "2023-07-25 16:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55174-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09470", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14757", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:26:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14757.280.280"}, "ts": "2023-07-25 16:26:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000085"}, "ts": "2023-07-25 16:26:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04689DA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:26:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04689DA"}, "ts": "2023-07-25 16:26:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRJ7"}, "ts": "2023-07-25 16:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2BI50-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2BI50-1"}, "ts": "2023-07-25 16:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:27:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-25 16:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:28:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02786-1"}, "ts": "2023-07-25 16:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:28:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13041EF"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-25 16:28:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45827ZM"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49632WD"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80111QD"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-25 16:28:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-25 16:28:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "muc5", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 16:28:46 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "muc5"}, "ts": "2023-07-25 16:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 16:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "muc5", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=muc5"}, "ts": "2023-07-25 16:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 16:28:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000049"}, "ts": "2023-07-25 16:28:49 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 16:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 16:28:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12660"}, "ts": "2023-07-25 16:28:55 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "MUC5", "term_category": "any"}, "ts": "2023-07-25 16:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 16:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">a587b0029325d05ab61235241cfd8e71", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"MUC5\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 16:29:04 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 16:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a587b0029325d05ab61235241cfd8e71", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 16:29:04 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "a587b0029325d05ab61235241cfd8e71", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 16:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:29:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088-1"}, "ts": "2023-07-25 16:29:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42665KV"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38887TM"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-25 16:29:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315FS"}, "ts": "2023-07-25 16:29:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-25 16:29:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HS1"}, "ts": "2023-07-25 16:29:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:29:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54767"}, "ts": "2023-07-25 16:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYM0"}, "ts": "2023-07-25 16:30:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:30:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-25 16:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:30:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-25 16:30:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:31:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-25 16:31:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:31:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06587"}, "ts": "2023-07-25 16:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48740SL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:31:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48740SL"}, "ts": "2023-07-25 16:31:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55091"}, "ts": "2023-07-25 16:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55091", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:32:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000016"}, "ts": "2023-07-25 16:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:33:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QR8"}, "ts": "2023-07-25 16:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00568-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:34:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00568-1"}, "ts": "2023-07-25 16:34:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H156", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:34:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H156"}, "ts": "2023-07-25 16:34:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y624", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:34:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y624"}, "ts": "2023-07-25 16:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7125da11e3e91753c2874ffc92609da2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 16:34:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7125da11e3e91753c2874ffc92609da2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:34:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25311"}, "ts": "2023-07-25 16:34:56 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 16:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 16:34:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-25 16:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-25 16:35:23 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 0, "max": 2}, {"residue": "hex", "min": 0, "max": 6}, {"residue": "hexnac", "min": 0, "max": 5}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 0, "max": 0}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-25 16:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">79415a721812f7b80f11a6e8bad177e3", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":0,\"max\":2},{\"residue\":\"hex\",\"min\":0,\"max\":6},{\"residue\":\"hexnac\",\"min\":0,\"max\":5},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":0,\"max\":0},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-25 16:35:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "79415a721812f7b80f11a6e8bad177e3", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 16:35:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "79415a721812f7b80f11a6e8bad177e3", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:35:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-25 16:35:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 16:35:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-25 16:35:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79809MM"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30159WR"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58667NI"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27919IH"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-25 16:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:35:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-25 16:35:54 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 16:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 16:36:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "79415a721812f7b80f11a6e8bad177e3", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "79415a721812f7b80f11a6e8bad177e3", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 16:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13219", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:37:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13219"}, "ts": "2023-07-25 16:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "79415a721812f7b80f11a6e8bad177e3", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-25 16:37:17 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 2, "max": 2}, {"residue": "hex", "min": 6, "max": 6}, {"residue": "hexnac", "min": 5, "max": 5}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 0, "max": 0}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-25 16:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "79415a721812f7b80f11a6e8bad177e3>f0f9ab9084cda13f5ca11412e338130e", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":2,\"max\":2},{\"residue\":\"hex\",\"min\":6,\"max\":6},{\"residue\":\"hexnac\",\"min\":5,\"max\":5},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":0,\"max\":0},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-25 16:37:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f0f9ab9084cda13f5ca11412e338130e", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 16:37:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f0f9ab9084cda13f5ca11412e338130e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:37:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52567OL"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74264KM"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08709JB"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68283NG"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85098WU"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05746XD"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26142HL"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44825QL"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39052XF"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57937LQ"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62973JK"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36225RM"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52886CK"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29695SR"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58315CQ"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57762GE"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28436VD"}, "ts": "2023-07-25 16:37:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52003QG"}, "ts": "2023-07-25 16:37:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52782YT"}, "ts": "2023-07-25 16:37:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18286BM"}, "ts": "2023-07-25 16:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97520", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:37:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97520.329.329"}, "ts": "2023-07-25 16:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000120"}, "ts": "2023-07-25 16:37:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16220"}, "ts": "2023-07-25 16:38:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21941"}, "ts": "2023-07-25 16:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:38:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68363"}, "ts": "2023-07-25 16:38:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04233", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:39:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04233.148.148"}, "ts": "2023-07-25 16:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 16:39:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2831216", "type": "PubMed"}, "ts": "2023-07-25 16:39:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2831216", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 16:39:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:39:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000118"}, "ts": "2023-07-25 16:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16769-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16769-1"}, "ts": "2023-07-25 16:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15223", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:40:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15223.307.307"}, "ts": "2023-07-25 16:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49281", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00846"}, "ts": "2023-07-25 16:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:41:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEV4"}, "ts": "2023-07-25 16:41:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:42:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-25 16:42:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000047"}, "ts": "2023-07-25 16:42:27 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 16:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 16:42:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f0f9ab9084cda13f5ca11412e338130e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f0f9ab9084cda13f5ca11412e338130e", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-25 16:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f0f9ab9084cda13f5ca11412e338130e", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-25 16:43:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 0, "max": 1}, {"residue": "hex", "min": 7, "max": 7}, {"residue": "hexnac", "min": 7, "max": 7}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 0, "max": 0}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-25 16:43:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-25 16:43:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12842890", "type": "PubMed"}, "ts": "2023-07-25 16:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12842890", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 16:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f0f9ab9084cda13f5ca11412e338130e>80d1cb734272f074014696ef1877d847", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":0,\"max\":1},{\"residue\":\"hex\",\"min\":7,\"max\":7},{\"residue\":\"hexnac\",\"min\":7,\"max\":7},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":0,\"max\":0},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-25 16:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "80d1cb734272f074014696ef1877d847", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 16:43:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "80d1cb734272f074014696ef1877d847", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:43:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43131ZX"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44325XR"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85304RG"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75520NV"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35679TE"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88966ZO"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74324QB"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51956RJ"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89168LM"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75412QZ"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66098KC"}, "ts": "2023-07-25 16:43:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45883VE"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74093LU"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93237CR"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95801CS"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01868JD"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96852SM"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21159AT"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17032PX"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63561NG"}, "ts": "2023-07-25 16:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34936029", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 16:43:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34936029", "type": "PubMed"}, "ts": "2023-07-25 16:43:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "80d1cb734272f074014696ef1877d847", "offset": 21, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86471BL"}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47186PA"}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28235NF"}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44362OF"}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06809IG"}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38773BX"}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17650MH"}, "ts": "2023-07-25 16:43:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60521JM"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34399PU"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41045CU"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38051NL"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31712AB"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83133WF"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31736JO"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77181OD"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57748MK"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80733LA"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92697XR"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43230YB"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28622IK"}, "ts": "2023-07-25 16:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30550"}, "ts": "2023-07-25 16:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01033-1"}, "ts": "2023-07-25 16:43:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09211"}, "ts": "2023-07-25 16:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 16:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:44:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-25 16:44:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15465"}, "ts": "2023-07-25 16:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02461"}, "ts": "2023-07-25 16:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54767", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPR5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 16:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPR5"}, "ts": "2023-07-25 16:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:46:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EX2"}, "ts": "2023-07-25 16:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:46:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000068"}, "ts": "2023-07-25 16:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULI2"}, "ts": "2023-07-25 16:48:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:48:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:48:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-25 16:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:49:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-25 16:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54697", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:49:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54697"}, "ts": "2023-07-25 16:49:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYN0"}, "ts": "2023-07-25 16:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000078"}, "ts": "2023-07-25 16:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 16:50:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIM0"}, "ts": "2023-07-25 16:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIM0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 16:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:51:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000004"}, "ts": "2023-07-25 16:52:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98155.71.71"}, "ts": "2023-07-25 16:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 16:52:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29162720", "type": "PubMed"}, "ts": "2023-07-25 16:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29162720", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 16:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9P6"}, "ts": "2023-07-25 16:52:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15341729", "type": "PubMed"}, "ts": "2023-07-25 16:53:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15341729", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 16:53:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39032"}, "ts": "2023-07-25 16:54:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39032", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000104"}, "ts": "2023-07-25 16:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:54:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75056"}, "ts": "2023-07-25 16:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75056", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:54:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-25 16:56:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:56:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000108"}, "ts": "2023-07-25 16:57:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00846", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:57:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000114"}, "ts": "2023-07-25 16:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 16:59:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01346", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 16:59:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 16:59:53 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01346", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 16:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01346", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 16:59:54 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 17:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 17:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 17:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 17:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 17:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 17:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-25 17:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2X0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:00:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2X0"}, "ts": "2023-07-25 17:00:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 17:00:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 17:00:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-25 17:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-25 17:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15465", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02461", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:01:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BX17"}, "ts": "2023-07-25 17:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BX17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:01:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-25 17:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14859"}, "ts": "2023-07-25 17:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:02:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5F2"}, "ts": "2023-07-25 17:02:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22556278", "type": "PubMed"}, "ts": "2023-07-25 17:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22556278", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:02:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06400"}, "ts": "2023-07-25 17:02:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13726"}, "ts": "2023-07-25 17:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06400", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:02:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-25 17:04:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91WM3"}, "ts": "2023-07-25 17:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91WM3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 17:05:09 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 17:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 17:05:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVI7"}, "ts": "2023-07-25 17:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:05:45 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P02765", "term_category": "any"}, "ts": "2023-07-25 17:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 17:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b7db71fa029fbc4a86bd35bb0c5c4e70", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P02765\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 17:06:04 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 17:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b7db71fa029fbc4a86bd35bb0c5c4e70", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 17:06:04 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b7db71fa029fbc4a86bd35bb0c5c4e70", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 17:06:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02765-1"}, "ts": "2023-07-25 17:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02765-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:06:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05933EN"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10486CT"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12341GU"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15038BD"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18590ZR"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20425TQ"}, "ts": "2023-07-25 17:06:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-25 17:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-25 17:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-25 17:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27947YN"}, "ts": "2023-07-25 17:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31916IQ"}, "ts": "2023-07-25 17:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31986NC"}, "ts": "2023-07-25 17:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-25 17:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11835", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 17:06:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06804"}, "ts": "2023-07-25 17:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:07:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00747-1"}, "ts": "2023-07-25 17:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 17:07:50 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 17:07:50 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 17:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 17:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 17:07:51 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "albu_human", "term_category": "any"}, "ts": "2023-07-25 17:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 17:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">f3527bd087257bcd6fff808c53213466", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"albu_human\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 17:07:58 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 17:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f3527bd087257bcd6fff808c53213466", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 17:07:59 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "f3527bd087257bcd6fff808c53213466", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 17:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768-1"}, "ts": "2023-07-25 17:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:08:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 17:08:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 17:08:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 17:08:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-25 17:08:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 17:08:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53276NK"}, "ts": "2023-07-25 17:08:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 17:08:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73319KU"}, "ts": "2023-07-25 17:08:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-25 17:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:08:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GW7"}, "ts": "2023-07-25 17:08:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-25 17:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-25 17:09:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 17:09:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3L8U1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 17:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3L8U1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 17:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3L8U1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 17:09:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08247"}, "ts": "2023-07-25 17:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:11:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGY8"}, "ts": "2023-07-25 17:11:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV08"}, "ts": "2023-07-25 17:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:11:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97425-1"}, "ts": "2023-07-25 17:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15014", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:12:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15014"}, "ts": "2023-07-25 17:12:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97425-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:12:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-25 17:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:14:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-25 17:14:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95486", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:14:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95486.799.799"}, "ts": "2023-07-25 17:14:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17039"}, "ts": "2023-07-25 17:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17039", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSI4"}, "ts": "2023-07-25 17:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:15:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31749-1.34.34"}, "ts": "2023-07-25 17:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVF4-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:15:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVF4-1.1432.1432"}, "ts": "2023-07-25 17:15:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-25 17:15:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0V3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N0V3"}, "ts": "2023-07-25 17:16:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-25 17:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 17:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63239", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:16:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63239"}, "ts": "2023-07-25 17:16:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-25 17:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:16:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13219"}, "ts": "2023-07-25 17:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13219", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:16:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y210"}, "ts": "2023-07-25 17:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:17:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-25 17:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51125-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:17:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51125-1.605.605"}, "ts": "2023-07-25 17:17:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NC96"}, "ts": "2023-07-25 17:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NC96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:17:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-25 17:18:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5G5.443.443"}, "ts": "2023-07-25 17:18:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:18:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55287", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55287"}, "ts": "2023-07-25 17:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:19:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-25 17:19:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75094"}, "ts": "2023-07-25 17:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75094", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGN4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGN4"}, "ts": "2023-07-25 17:20:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:20:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ4"}, "ts": "2023-07-25 17:20:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.4076.4076"}, "ts": "2023-07-25 17:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:20:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78337.188.188"}, "ts": "2023-07-25 17:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78337", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:21:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11052OE"}, "ts": "2023-07-25 17:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11052OE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 17:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06804", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:23:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-25 17:23:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570"}, "ts": "2023-07-25 17:23:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11030-1"}, "ts": "2023-07-25 17:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11030-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-25 17:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:25:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 17:25:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 17:25:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-25 17:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYL4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 17:26:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYL4"}, "ts": "2023-07-25 17:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47962", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:26:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47962"}, "ts": "2023-07-25 17:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:27:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62258"}, "ts": "2023-07-25 17:27:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKK6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKK6-1"}, "ts": "2023-07-25 17:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XE9"}, "ts": "2023-07-25 17:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7H5"}, "ts": "2023-07-25 17:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:30:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV56"}, "ts": "2023-07-25 17:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:30:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71U36-1"}, "ts": "2023-07-25 17:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71U36-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:31:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26151"}, "ts": "2023-07-25 17:31:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 17:31:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71U36-1"}, "ts": "2023-07-25 17:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71U36-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:31:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z739"}, "ts": "2023-07-25 17:31:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56749GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 17:32:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71U36-1"}, "ts": "2023-07-25 17:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71U36-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:32:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50402"}, "ts": "2023-07-25 17:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:33:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4Q4"}, "ts": "2023-07-25 17:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4Q4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:33:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63252"}, "ts": "2023-07-25 17:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:34:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:34:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18827"}, "ts": "2023-07-25 17:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWY4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 17:35:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWY4"}, "ts": "2023-07-25 17:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17170702", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:36:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17170702", "type": "PubMed"}, "ts": "2023-07-25 17:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:37:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55056"}, "ts": "2023-07-25 17:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55056", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:37:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQ30.156.156"}, "ts": "2023-07-25 17:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ30", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:37:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JZZ8-1"}, "ts": "2023-07-25 17:38:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JZZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:38:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86"}, "ts": "2023-07-25 17:38:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86"}, "ts": "2023-07-25 17:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:38:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6D6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:38:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6D6.1728.1728"}, "ts": "2023-07-25 17:38:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04264"}, "ts": "2023-07-25 17:38:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:38:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:39:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDA2.1536.1536"}, "ts": "2023-07-25 17:39:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:39:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:40:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19386761", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:40:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19386761", "type": "PubMed"}, "ts": "2023-07-25 17:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00160", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:40:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00160.644.644"}, "ts": "2023-07-25 17:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60841", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:40:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60841.137.137"}, "ts": "2023-07-25 17:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:40:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 17:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 17:41:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5Y3"}, "ts": "2023-07-25 17:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:42:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27695"}, "ts": "2023-07-25 17:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04114", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:43:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66933CM"}, "ts": "2023-07-25 17:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66933CM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 17:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04114", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:44:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04114.2779.2779"}, "ts": "2023-07-25 17:44:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK65"}, "ts": "2023-07-25 17:44:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653"}, "ts": "2023-07-25 17:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:44:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UP0.468.468"}, "ts": "2023-07-25 17:45:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:45:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GW7"}, "ts": "2023-07-25 17:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5YLM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:45:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5YLM1.835.835"}, "ts": "2023-07-25 17:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18307765", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:47:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18307765", "type": "PubMed"}, "ts": "2023-07-25 17:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55196", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:47:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55196.216.216"}, "ts": "2023-07-25 17:47:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10148", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:47:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10148"}, "ts": "2023-07-25 17:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 17:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12235"}, "ts": "2023-07-25 17:49:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75534", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:49:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75534"}, "ts": "2023-07-25 17:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:50:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A7"}, "ts": "2023-07-25 17:50:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LXA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LXA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LXA3"}, "ts": "2023-07-25 17:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LXA3"}, "ts": "2023-07-25 17:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-25 17:51:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-25 17:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:51:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZJ3.67.67"}, "ts": "2023-07-25 17:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 17:51:58 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 17:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 17:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99784", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:52:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99784"}, "ts": "2023-07-25 17:52:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61927"}, "ts": "2023-07-25 17:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "yeast", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-25 17:52:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 17:52:36 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "yeast"}, "ts": "2023-07-25 17:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 17:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "yeast", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=yeast"}, "ts": "2023-07-25 17:52:37 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 17:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "09680d08f877b44f2f3893e53f1866ff", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 17:52:41 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "09680d08f877b44f2f3893e53f1866ff", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 17:52:41 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 17:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 17:52:57 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 17:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 17:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92731", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:53:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92731.501.501"}, "ts": "2023-07-25 17:53:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06126", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06126"}, "ts": "2023-07-25 17:53:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7757081", "type": "PubMed"}, "ts": "2023-07-25 17:53:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7757081", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:53:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13191", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:54:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13191"}, "ts": "2023-07-25 17:54:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73578JC"}, "ts": "2023-07-25 17:54:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43664YB"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07677VL"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-25 17:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-25 17:54:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29162837", "type": "PubMed"}, "ts": "2023-07-25 17:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29162837", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD6"}, "ts": "2023-07-25 17:55:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81827"}, "ts": "2023-07-25 17:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:55:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R2P8"}, "ts": "2023-07-25 17:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56UD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:57:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32594833", "type": "PubMed"}, "ts": "2023-07-25 17:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32594833", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 17:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNQ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:57:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56UD9"}, "ts": "2023-07-25 17:57:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95866"}, "ts": "2023-07-25 17:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95866", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW61", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:58:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NW61.57.57"}, "ts": "2023-07-25 17:58:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-25 17:58:13 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 17:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 17:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 17:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 17:58:29 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 17:58:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 17:58:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:58:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RT7"}, "ts": "2023-07-25 17:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RT7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:58:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:58:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:58:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:59:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Composition Search"}, "ts": "2023-07-25 17:59:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "dhex", "min": 0, "max": 0}, {"residue": "hex", "min": 5, "max": 5}, {"residue": "hexnac", "min": 4, "max": 4}, {"residue": "hexa", "min": 0, "max": 0}, {"residue": "hexn", "min": 0, "max": 0}, {"residue": "neuac", "min": 2, "max": 2}, {"residue": "neugc", "min": 0, "max": 0}, {"residue": "p", "min": 0, "max": 0}, {"residue": "pent", "min": 0, "max": 0}, {"residue": "s", "min": 0, "max": 0}, {"residue": "other", "min": 0, "max": 0}]}, "ts": "2023-07-25 17:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:59:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBG0"}, "ts": "2023-07-25 17:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">da173b083ba49007216f4c1225b0f394", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Composition Search query={\"composition\":[{\"residue\":\"dhex\",\"min\":0,\"max\":0},{\"residue\":\"hex\",\"min\":5,\"max\":5},{\"residue\":\"hexnac\",\"min\":4,\"max\":4},{\"residue\":\"hexa\",\"min\":0,\"max\":0},{\"residue\":\"hexn\",\"min\":0,\"max\":0},{\"residue\":\"neuac\",\"min\":2,\"max\":2},{\"residue\":\"neugc\",\"min\":0,\"max\":0},{\"residue\":\"p\",\"min\":0,\"max\":0},{\"residue\":\"pent\",\"min\":0,\"max\":0},{\"residue\":\"s\",\"min\":0,\"max\":0},{\"residue\":\"other\",\"min\":0,\"max\":0}]}"}, "ts": "2023-07-25 17:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "da173b083ba49007216f4c1225b0f394", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 17:59:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "da173b083ba49007216f4c1225b0f394", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 17:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-25 17:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95660LN"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59616TT"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00875VP"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80123ZU"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31668AP"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98205FV"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70898AL"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53276NK"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51793MY"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25067TK"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58489ZK"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47832TO"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37020YV"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20966IA"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34449FW"}, "ts": "2023-07-25 17:59:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:59:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TER0"}, "ts": "2023-07-25 17:59:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TER0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H008"}, "ts": "2023-07-25 17:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00560"}, "ts": "2023-07-25 17:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 17:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:59:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y487.406.406"}, "ts": "2023-07-25 17:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP61", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 17:59:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP61.20.20"}, "ts": "2023-07-25 17:59:57 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 18:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 18:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 18:00:01 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 18:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 18:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 18:00:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AP7"}, "ts": "2023-07-25 18:00:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2719931", "type": "PubMed"}, "ts": "2023-07-25 18:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2719931", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56102PZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56102PZ", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 18:00:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15223.307.307"}, "ts": "2023-07-25 18:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZ36", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:00:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C0C7"}, "ts": "2023-07-25 18:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C0C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:00:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 18:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84170WO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54762"}, "ts": "2023-07-25 18:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07359"}, "ts": "2023-07-25 18:01:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5F1.23.23"}, "ts": "2023-07-25 18:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 18:01:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51580"}, "ts": "2023-07-25 18:02:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZJ3.67.67"}, "ts": "2023-07-25 18:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:04:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG73-1"}, "ts": "2023-07-25 18:04:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG73-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:04:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92731.501.501"}, "ts": "2023-07-25 18:04:43 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 18:04:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:04:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:04:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0X9"}, "ts": "2023-07-25 18:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5A5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:05:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5A5"}, "ts": "2023-07-25 18:05:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A9QM74"}, "ts": "2023-07-25 18:06:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A9QM74", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:06:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:06:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0X9"}, "ts": "2023-07-25 18:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 18:06:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94855"}, "ts": "2023-07-25 18:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:07:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-25 18:07:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-25 18:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NK8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:08:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NK8"}, "ts": "2023-07-25 18:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULP9"}, "ts": "2023-07-25 18:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-25 18:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:09:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP61.20.20"}, "ts": "2023-07-25 18:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73578JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:10:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88488"}, "ts": "2023-07-25 18:10:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49225WK"}, "ts": "2023-07-25 18:10:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2K2"}, "ts": "2023-07-25 18:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2K2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:11:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBG7"}, "ts": "2023-07-25 18:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBG7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:11:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z2V5.21.21"}, "ts": "2023-07-25 18:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2V5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 18:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 18:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q4P1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 18:12:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q4P1"}, "ts": "2023-07-25 18:12:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5F1.23.23"}, "ts": "2023-07-25 18:12:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HF1"}, "ts": "2023-07-25 18:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HF1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:13:18 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 18:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:13:33 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 18:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-25 18:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:15:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21290RB"}, "ts": "2023-07-25 18:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:15:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02561FC"}, "ts": "2023-07-25 18:15:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75427"}, "ts": "2023-07-25 18:15:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12032"}, "ts": "2023-07-25 18:16:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12032", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:16:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:17:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14625"}, "ts": "2023-07-25 18:17:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13645"}, "ts": "2023-07-25 18:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13645", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:17:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZJ0.49.49"}, "ts": "2023-07-25 18:17:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 18:17:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-25 18:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51580", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:18:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-25 18:19:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451-1"}, "ts": "2023-07-25 18:19:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11948691", "type": "PubMed"}, "ts": "2023-07-25 18:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11948691", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:20:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493"}, "ts": "2023-07-25 18:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15063", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 18:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75487"}, "ts": "2023-07-25 18:20:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15063.358.358"}, "ts": "2023-07-25 18:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:20:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 18:20:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-25 18:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22333914", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:20:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22333914", "type": "PubMed"}, "ts": "2023-07-25 18:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9812984", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:20:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9812984", "type": "PubMed"}, "ts": "2023-07-25 18:20:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60329"}, "ts": "2023-07-25 18:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60329", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:21:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-25 18:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33214551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:21:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33214551", "type": "PubMed"}, "ts": "2023-07-25 18:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-25 18:22:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:22:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:22:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHP7"}, "ts": "2023-07-25 18:22:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHP7"}, "ts": "2023-07-25 18:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:23:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55735"}, "ts": "2023-07-25 18:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:23:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25979828", "type": "PubMed"}, "ts": "2023-07-25 18:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25979828", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:23:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-25 18:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V671", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 18:23:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V671"}, "ts": "2023-07-25 18:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESG3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:24:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESG3"}, "ts": "2023-07-25 18:24:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:24:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 18:24:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 18:24:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-25 18:24:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-25 18:24:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52209"}, "ts": "2023-07-25 18:25:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13797"}, "ts": "2023-07-25 18:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13797", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:26:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97798"}, "ts": "2023-07-25 18:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49225WK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:26:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-25 18:26:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-25 18:27:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63081.129.129"}, "ts": "2023-07-25 18:27:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63081", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 18:27:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14635"}, "ts": "2023-07-25 18:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14635", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:27:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-25 18:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:30:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68871"}, "ts": "2023-07-25 18:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:31:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2E2"}, "ts": "2023-07-25 18:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2E2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:31:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-25 18:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18337405", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 18:32:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18337405", "type": "PubMed"}, "ts": "2023-07-25 18:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZUE7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:33:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZUE7-1"}, "ts": "2023-07-25 18:33:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:33:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCN2"}, "ts": "2023-07-25 18:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:33:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-25 18:33:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:34:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGN1"}, "ts": "2023-07-25 18:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05724UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:34:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C595"}, "ts": "2023-07-25 18:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C595", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45209NR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:35:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-25 18:36:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BK62"}, "ts": "2023-07-25 18:36:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BK62", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 18:36:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYM0"}, "ts": "2023-07-25 18:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:36:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-25 18:37:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02425YO"}, "ts": "2023-07-25 18:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:38:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UL97"}, "ts": "2023-07-25 18:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UL97", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:38:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGP5"}, "ts": "2023-07-25 18:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:38:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-25 18:38:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-25 18:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01583", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:39:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31394-1"}, "ts": "2023-07-25 18:39:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48552"}, "ts": "2023-07-25 18:40:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30711"}, "ts": "2023-07-25 18:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:41:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTB5"}, "ts": "2023-07-25 18:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:41:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28347"}, "ts": "2023-07-25 18:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:41:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N157"}, "ts": "2023-07-25 18:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:42:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-25 18:42:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UW1"}, "ts": "2023-07-25 18:42:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70207"}, "ts": "2023-07-25 18:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99584-1"}, "ts": "2023-07-25 18:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99584-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:43:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60660BN"}, "ts": "2023-07-25 18:44:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23511"}, "ts": "2023-07-25 18:46:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q58DX5"}, "ts": "2023-07-25 18:46:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q58DX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:46:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51125-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 18:47:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51125-1.605.605"}, "ts": "2023-07-25 18:47:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18065"}, "ts": "2023-07-25 18:47:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-25 18:48:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-25 18:49:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94875"}, "ts": "2023-07-25 18:49:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61289"}, "ts": "2023-07-25 18:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43808", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:49:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43808"}, "ts": "2023-07-25 18:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 18:49:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PXP3"}, "ts": "2023-07-25 18:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PXP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:50:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54803", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:50:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54803"}, "ts": "2023-07-25 18:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:50:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 18:50:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 18:50:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-25 18:50:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-25 18:50:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15205"}, "ts": "2023-07-25 18:51:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-25 18:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:51:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52565"}, "ts": "2023-07-25 18:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-25 18:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:51:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 18:52:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:52:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 18:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43808"}, "ts": "2023-07-25 18:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43808", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:52:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-25 18:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-25 18:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:55:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 18:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:56:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35144-1"}, "ts": "2023-07-25 18:56:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35144-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:56:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-25 18:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LQ08-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 18:57:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LQ08-1"}, "ts": "2023-07-25 18:57:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D071"}, "ts": "2023-07-25 18:58:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:58:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:58:46 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 18:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 18:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:58:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZV3"}, "ts": "2023-07-25 18:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:59:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838"}, "ts": "2023-07-25 18:59:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48723"}, "ts": "2023-07-25 18:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48723", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 18:59:54 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 19:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 19:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 19:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 19:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 19:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 19:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60660BN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:00:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:00:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97929"}, "ts": "2023-07-25 19:00:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-25 19:01:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05112"}, "ts": "2023-07-25 19:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:01:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20023"}, "ts": "2023-07-25 19:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:02:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HF1"}, "ts": "2023-07-25 19:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HF1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:02:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-25 19:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94875", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:05:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78509"}, "ts": "2023-07-25 19:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:05:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:05:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SZL2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:05:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SZL2"}, "ts": "2023-07-25 19:05:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-25 19:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:06:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41222"}, "ts": "2023-07-25 19:06:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84170WO"}, "ts": "2023-07-25 19:06:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84170WO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPT8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:06:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPT8"}, "ts": "2023-07-25 19:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:07:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52565", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:07:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-25 19:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:09:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56102PZ"}, "ts": "2023-07-25 19:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56102PZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16762"}, "ts": "2023-07-25 19:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16762", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41208"}, "ts": "2023-07-25 19:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41208", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:13:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62968.334.334"}, "ts": "2023-07-25 19:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62968", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:13:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8C0Z1.120.120"}, "ts": "2023-07-25 19:13:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C0Z1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:13:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVJ0-1"}, "ts": "2023-07-25 19:13:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVJ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:13:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7L2"}, "ts": "2023-07-25 19:14:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7L2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:14:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QNQ9"}, "ts": "2023-07-25 19:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNQ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:14:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWE2"}, "ts": "2023-07-25 19:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWE2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 19:16:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00170"}, "ts": "2023-07-25 19:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00170", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 19:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:17:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:17:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AP7"}, "ts": "2023-07-25 19:17:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60565"}, "ts": "2023-07-25 19:18:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60565", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:18:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80U95"}, "ts": "2023-07-25 19:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80U95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30153-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D687", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:19:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D687"}, "ts": "2023-07-25 19:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12032", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:21:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12032"}, "ts": "2023-07-25 19:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:22:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6V1P9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:23:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6V1P9"}, "ts": "2023-07-25 19:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32004", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 19:24:44 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P32004", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 19:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 19:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32004", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 19:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBN6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:26:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBN6"}, "ts": "2023-07-25 19:26:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0K0K1A5"}, "ts": "2023-07-25 19:26:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0K0K1A5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:26:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:26:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07108"}, "ts": "2023-07-25 19:26:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-25 19:26:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01518"}, "ts": "2023-07-25 19:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01518", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:29:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NER1"}, "ts": "2023-07-25 19:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NER1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28843", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:31:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28843"}, "ts": "2023-07-25 19:31:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CFZ5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:31:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-25 19:32:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0X9"}, "ts": "2023-07-25 19:32:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:32:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:32:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DPA2"}, "ts": "2023-07-25 19:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:33:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM0"}, "ts": "2023-07-25 19:33:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04278"}, "ts": "2023-07-25 19:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04278", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:35:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z407.238.238"}, "ts": "2023-07-25 19:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z407", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 19:36:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:37:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000122"}, "ts": "2023-07-25 19:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:38:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X5"}, "ts": "2023-07-25 19:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:40:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VH5"}, "ts": "2023-07-25 19:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:40:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08189"}, "ts": "2023-07-25 19:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 19:40:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10884405", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 19:40:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10884405", "type": "PubMed"}, "ts": "2023-07-25 19:40:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D98"}, "ts": "2023-07-25 19:40:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04264"}, "ts": "2023-07-25 19:40:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15121"}, "ts": "2023-07-25 19:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:40:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33435"}, "ts": "2023-07-25 19:40:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14859"}, "ts": "2023-07-25 19:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:41:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05981"}, "ts": "2023-07-25 19:41:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:41:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08100"}, "ts": "2023-07-25 19:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49247"}, "ts": "2023-07-25 19:42:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMC9"}, "ts": "2023-07-25 19:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:42:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62000"}, "ts": "2023-07-25 19:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62000", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:42:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMC9"}, "ts": "2023-07-25 19:42:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMC9"}, "ts": "2023-07-25 19:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:43:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXV0"}, "ts": "2023-07-25 19:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGF7"}, "ts": "2023-07-25 19:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBT2"}, "ts": "2023-07-25 19:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:45:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRY4"}, "ts": "2023-07-25 19:45:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00571"}, "ts": "2023-07-25 19:45:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9BSW2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 19:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 19:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSW2", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 19:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32246"}, "ts": "2023-07-25 19:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CFE6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:47:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CFE6.258.258"}, "ts": "2023-07-25 19:47:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70424"}, "ts": "2023-07-25 19:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 19:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1I0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 19:47:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1I0"}, "ts": "2023-07-25 19:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:47:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZK4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:47:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZK4.25.25"}, "ts": "2023-07-25 19:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14114", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:49:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14114"}, "ts": "2023-07-25 19:49:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNP9"}, "ts": "2023-07-25 19:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29485866", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 19:49:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29485866", "type": "PubMed"}, "ts": "2023-07-25 19:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12872", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:50:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12872.743.743"}, "ts": "2023-07-25 19:50:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LD1"}, "ts": "2023-07-25 19:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:52:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LD1"}, "ts": "2023-07-25 19:52:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QR8"}, "ts": "2023-07-25 19:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:53:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07352.203.203"}, "ts": "2023-07-25 19:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07352", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14674", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:53:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14674"}, "ts": "2023-07-25 19:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QJU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:54:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QJU3"}, "ts": "2023-07-25 19:54:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30988"}, "ts": "2023-07-25 19:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:54:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFU1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:54:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFU1-1"}, "ts": "2023-07-25 19:54:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWJ2"}, "ts": "2023-07-25 19:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:56:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62484"}, "ts": "2023-07-25 19:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33435", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:56:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14562"}, "ts": "2023-07-25 19:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14562", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:56:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TT38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:56:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TT38"}, "ts": "2023-07-25 19:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:56:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-25 19:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20181", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:57:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20181"}, "ts": "2023-07-25 19:57:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31629"}, "ts": "2023-07-25 19:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Y9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:57:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5Y9.335.335"}, "ts": "2023-07-25 19:57:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYA8"}, "ts": "2023-07-25 19:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYA8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:58:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:58:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15155"}, "ts": "2023-07-25 19:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82987", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 19:58:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P82987.51.51"}, "ts": "2023-07-25 19:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 19:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15215304", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 19:58:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15215304", "type": "PubMed"}, "ts": "2023-07-25 19:58:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0JPL0"}, "ts": "2023-07-25 19:59:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0JPL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:59:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 19:59:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 19:59:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-25 19:59:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-25 19:59:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-25 19:59:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:59:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-25 19:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 19:59:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60235"}, "ts": "2023-07-25 19:59:52 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 20:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 20:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 20:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 20:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JR98"}, "ts": "2023-07-25 20:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JR98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02461", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:01:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02461.146.146"}, "ts": "2023-07-25 20:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWC1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:01:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWC1"}, "ts": "2023-07-25 20:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:01:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVI1"}, "ts": "2023-07-25 20:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:05:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TE7"}, "ts": "2023-07-25 20:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:06:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVF5"}, "ts": "2023-07-25 20:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15738", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:07:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15738.209.209"}, "ts": "2023-07-25 20:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T13", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:07:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86T13.46.46"}, "ts": "2023-07-25 20:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:07:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTX7"}, "ts": "2023-07-25 20:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28399410", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:08:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28399410", "type": "PubMed"}, "ts": "2023-07-25 20:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28399410", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 20:08:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8DUK4-1"}, "ts": "2023-07-25 20:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8DUK4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:09:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14220"}, "ts": "2023-07-25 20:09:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSC7"}, "ts": "2023-07-25 20:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAE2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:10:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAE2"}, "ts": "2023-07-25 20:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYI7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:11:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYI7"}, "ts": "2023-07-25 20:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46940", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 20:11:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P46940", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 20:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46940", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 20:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q45", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:12:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96Q45"}, "ts": "2023-07-25 20:12:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-25 20:12:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56962"}, "ts": "2023-07-25 20:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56962", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1658635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:12:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1658635", "type": "PubMed"}, "ts": "2023-07-25 20:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62484", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:12:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-25 20:12:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:12:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD9"}, "ts": "2023-07-25 20:12:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-25 20:12:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55286"}, "ts": "2023-07-25 20:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55286", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:13:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-25 20:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEF3"}, "ts": "2023-07-25 20:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:13:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFU4.21.21"}, "ts": "2023-07-25 20:13:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFU4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2B6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:13:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21554"}, "ts": "2023-07-25 20:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21554", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:13:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2B6-1"}, "ts": "2023-07-25 20:13:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2G8"}, "ts": "2023-07-25 20:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DJD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:15:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DJD8"}, "ts": "2023-07-25 20:15:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-25 20:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:16:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-25 20:16:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-25 20:16:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-25 20:16:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-25 20:16:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-25 20:16:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-25 20:16:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-25 20:16:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 20:16:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047-1.1170.1170"}, "ts": "2023-07-25 20:17:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:17:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKT3"}, "ts": "2023-07-25 20:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75818", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:18:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75818"}, "ts": "2023-07-25 20:18:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:18:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95372"}, "ts": "2023-07-25 20:18:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25862376", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:18:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25862376", "type": "PubMed"}, "ts": "2023-07-25 20:18:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04141"}, "ts": "2023-07-25 20:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04141", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:19:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66933CM"}, "ts": "2023-07-25 20:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66933CM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 20:19:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95970.110.110"}, "ts": "2023-07-25 20:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95970", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:20:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63ZY3.323.323"}, "ts": "2023-07-25 20:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63ZY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:20:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-25 20:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80UZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:20:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80UZ2"}, "ts": "2023-07-25 20:20:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880-1"}, "ts": "2023-07-25 20:21:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-25 20:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36542", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:22:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36542.20.20"}, "ts": "2023-07-25 20:22:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95925", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:22:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95925"}, "ts": "2023-07-25 20:22:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62765SF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 20:22:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62765SF"}, "ts": "2023-07-25 20:22:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13425"}, "ts": "2023-07-25 20:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13425", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TE4-1"}, "ts": "2023-07-25 20:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TE4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61019"}, "ts": "2023-07-25 20:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61019", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:23:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NVI7.292.292"}, "ts": "2023-07-25 20:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:24:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T440-1"}, "ts": "2023-07-25 20:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T440-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:24:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62955", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:25:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62955"}, "ts": "2023-07-25 20:25:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15952796", "type": "PubMed"}, "ts": "2023-07-25 20:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15952796", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:25:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31467083", "type": "PubMed"}, "ts": "2023-07-25 20:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31467083", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:25:51 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:27:05 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:27:17 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "undefined"}, "ts": "2023-07-25 20:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "undefined", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=undefined"}, "ts": "2023-07-25 20:27:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60602"}, "ts": "2023-07-25 20:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:27:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "be6a83d9f3ab3eeecae88c81ca9b378d", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-25 20:27:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14625-1.774.774"}, "ts": "2023-07-25 20:27:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70389", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:27:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70389"}, "ts": "2023-07-25 20:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:28:01 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "undefined"}, "ts": "2023-07-25 20:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "undefined", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=undefined"}, "ts": "2023-07-25 20:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:28:09 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "undefined"}, "ts": "2023-07-25 20:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "undefined", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=undefined"}, "ts": "2023-07-25 20:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:28:16 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:28:32 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:28:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14247"}, "ts": "2023-07-25 20:29:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28915803", "type": "PubMed"}, "ts": "2023-07-25 20:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28915803", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28915803", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 20:29:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 20:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2D0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:29:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2D0"}, "ts": "2023-07-25 20:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:29:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1717476"}, "ts": "2023-07-25 20:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 20:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:29:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92823.223.223"}, "ts": "2023-07-25 20:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:29:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01344", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGP4"}, "ts": "2023-07-25 20:29:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01344"}, "ts": "2023-07-25 20:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H008"}, "ts": "2023-07-25 20:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46777", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:30:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46777"}, "ts": "2023-07-25 20:30:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UY14.223.223"}, "ts": "2023-07-25 20:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY14", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:30:23 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-25 20:30:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-25 20:30:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-25 20:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-25 20:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:31:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6M5"}, "ts": "2023-07-25 20:31:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "\u30de\u30a6\u30b9", "user": "Undecided", "type": "user", "page": "try-me", "message": "Performing Global Search"}, "ts": "2023-07-25 20:31:17 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "\u30de\u30a6\u30b9"}, "ts": "2023-07-25 20:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "\u30de\u30a6\u30b9", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=\u30de\u30a6\u30b9"}, "ts": "2023-07-25 20:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:31:18 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:31:22 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:31:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49913"}, "ts": "2023-07-25 20:31:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18847.162.162"}, "ts": "2023-07-25 20:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18847", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-25 20:31:38 EDT-0400"}, {"api": "/usecases/species_to_glycosyltransferases/", "req": {"tax_id": 10090}, "ts": "2023-07-25 20:31:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1667507ac9814105fd2cd0a4ccc6b03b", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Quick Search Question_8 = /10090"}, "ts": "2023-07-25 20:31:39 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 20:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:31:39 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 20:31:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23919"}, "ts": "2023-07-25 20:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 20:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:32:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}]}, "ts": "2023-07-25 20:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6X4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:32:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H6X4.27.27"}, "ts": "2023-07-25 20:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:32:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 20:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:32:30 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 20:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34848482", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30003153", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:32:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34848482", "type": "PubMed"}, "ts": "2023-07-25 20:32:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30003153", "type": "PubMed"}, "ts": "2023-07-25 20:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34848482", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 20:32:36 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:32:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:32:37 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:32:37 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "offset": 1, "limit": 1, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 20:32:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:32:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-25 20:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 20:33:03 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 20:33:16 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 20:33:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y267"}, "ts": "2023-07-25 20:33:19 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:33:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 20:33:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-25 20:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-25 20:33:38 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "\u30de\u30a6\u30b9\u8133", "term_category": "any"}, "ts": "2023-07-25 20:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"\u30de\u30a6\u30b9\u8133\",\"term_category\":\"any\"}"}, "ts": "2023-07-25 20:33:38 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-25 20:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-25 20:33:59 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-25 20:33:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000072"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000116"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000083"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000016"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000042"}, "ts": "2023-07-25 20:34:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000112"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000010"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000076"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000062"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000087"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000106"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000014"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000053"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000093"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000004"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000021"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000050"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000049"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000017"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000051"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000006"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000044"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000033"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000043"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000102"}, "ts": "2023-07-25 20:34:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000066"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000097"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000028"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000063"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000037"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000096"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000056"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000067"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000092"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000103"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000117"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000073"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000082"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000026"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000032"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000029"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000041"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000011"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000113"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000077"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000086"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000122"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000061"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000088"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000105"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000054"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000079"}, "ts": "2023-07-25 20:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000039"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000047"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000058"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000027"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000040"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000046"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000252"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000030"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000057"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000025"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000065"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000007"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000101"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000098"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000119"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000094"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000074"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000118"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000095"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000100"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000064"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000078"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000091"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000089"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000104"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000060"}, "ts": "2023-07-25 20:34:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000085"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000108"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000071"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000115"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000110"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000069"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000121"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000059"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000081"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000068"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000075"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000084"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000080"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000109"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000120"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000111"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000013"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000114"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000070"}, "ts": "2023-07-25 20:34:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:34:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-25 20:34:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBS9"}, "ts": "2023-07-25 20:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBS9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-25 20:34:44 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:34:46 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:35:03 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:35:03 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:35:03 EDT-0400"}, {"api": "/typeahead/typeahead/", "req": {"field": "glytoucan_ac", "value": "G17689DH", "limit": 100}, "ts": "2023-07-25 20:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-25 20:35:21 EDT-0400"}, {"api": "/usecases/glycan_to_biosynthesis_enzymes/", "req": {"glytoucan_ac": "G17689DH", "tax_id": 9606}, "ts": "2023-07-25 20:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">2c73acfe5765766dab136735cbe55acc", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Quick Search Question_1 = /9606/G17689DH"}, "ts": "2023-07-25 20:35:22 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 20:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:35:22 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 20:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:35:39 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 20:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:35:39 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 20:35:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96F25-1"}, "ts": "2023-07-25 20:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F25-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:35:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99997WS"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99992LL"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99981ST"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99980WG"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99969SS"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99956MJ"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954ZJ"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954GW"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99952ON"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99950SF"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99943EE"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99935CU"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99927HL"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99897FQ"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99896CG"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99891PR"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99883ZA"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99876AH"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99873PN"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99866WK"}, "ts": "2023-07-25 20:35:58 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 20:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:35:59 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "2c73acfe5765766dab136735cbe55acc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 20:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08030", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:36:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08030"}, "ts": "2023-07-25 20:36:08 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:36:10 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:36:25 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-25 20:36:26 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-25 20:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-25 20:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4PZA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4PZA2"}, "ts": "2023-07-25 20:36:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-25 20:36:41 EDT-0400"}, {"api": "/usecases/species_to_glycosyltransferases/", "req": {"tax_id": 10090}, "ts": "2023-07-25 20:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1667507ac9814105fd2cd0a4ccc6b03b", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Quick Search Question_8 = /10090"}, "ts": "2023-07-25 20:36:42 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 20:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 20:36:42 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1667507ac9814105fd2cd0a4ccc6b03b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 20:36:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MOUSE", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-25 20:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:36:57 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "MOUSE"}, "ts": "2023-07-25 20:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MOUSE", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=MOUSE"}, "ts": "2023-07-25 20:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:37:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:37:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60230HH"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58667NI"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13282WA"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49446SO"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90784AP"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16873YG"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765SF"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92574YO"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45209NR"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45560HM"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56318NV"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90542MP"}, "ts": "2023-07-25 20:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:37:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}]}, "ts": "2023-07-25 20:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:37:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:37:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:37:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:37:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YW5"}, "ts": "2023-07-25 20:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YW5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:37:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48735"}, "ts": "2023-07-25 20:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:37:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:37:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76705YY"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93802RY"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70342DW"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22426TD"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68203DZ"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79302PB"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64894MA"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96868MB"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09744CN"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06327TZ"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36149QU"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65516CQ"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66106WQ"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00594AV"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26777RD"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80499JV"}, "ts": "2023-07-25 20:37:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20758LC"}, "ts": "2023-07-25 20:37:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53870ES"}, "ts": "2023-07-25 20:37:54 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-25 20:37:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20624LQ"}, "ts": "2023-07-25 20:37:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34749PQ"}, "ts": "2023-07-25 20:37:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78420WJ"}, "ts": "2023-07-25 20:37:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16522ZC"}, "ts": "2023-07-25 20:37:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16119YF"}, "ts": "2023-07-25 20:37:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45995IV"}, "ts": "2023-07-25 20:37:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38638WU"}, "ts": "2023-07-25 20:37:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84811LS"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83948CA"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47909JD"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77964WB"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06442NS"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56972PM"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18887FK"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84552CD"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23134YS"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77589SS"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02402FF"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55967NN"}, "ts": "2023-07-25 20:37:57 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fa39fa3d28e6fd174c4e0d73ce6d3d5a", "offset": 81, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-25 20:38:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96417PJ"}, "ts": "2023-07-25 20:38:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37664BH"}, "ts": "2023-07-25 20:38:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49889OJ"}, "ts": "2023-07-25 20:38:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79249GP"}, "ts": "2023-07-25 20:38:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19740UO"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59522PY"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41605VJ"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37364JG"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56977BH"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83131MU"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72108VJ"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17336FF"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32365IM"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89908RT"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL01"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10448ZR"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27995KI"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64965ZH"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10881VB"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66808JU"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54963QY"}, "ts": "2023-07-25 20:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGP5"}, "ts": "2023-07-25 20:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:38:33 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "MOUSE"}, "ts": "2023-07-25 20:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MOUSE", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=MOUSE"}, "ts": "2023-07-25 20:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:38:43 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:38:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30159WR"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66937TJ"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86696LV"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86753CK"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25392ZR"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16774YZ"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59742GY"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38022PE"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51562OR"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90348RI"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17168RO"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78030KJ"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57955DP"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82894XV"}, "ts": "2023-07-25 20:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:38:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:38:57 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}]}, "ts": "2023-07-25 20:38:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13698.687.687"}, "ts": "2023-07-25 20:38:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07162IJ"}, "ts": "2023-07-25 20:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13698", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:39:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:39:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14106-1"}, "ts": "2023-07-25 20:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14106-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:39:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:39:19 EDT-0400"}, {"api": "/data/list_download/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "download_type": "glycan_list", "format": "csv", "compressed": true, "filters": []}, "ts": "2023-07-25 20:39:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "csv"}, "ts": "2023-07-25 20:39:33 EDT-0400"}, {"api": "/data/list_download/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "download_type": "glycan_list", "format": "csv", "compressed": false, "filters": []}, "ts": "2023-07-25 20:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "csv"}, "ts": "2023-07-25 20:40:06 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08866CW"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02076VP"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67612NO"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62145FH"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14431ZQ"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45864QR"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23718VU"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78786BU"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44346CQ"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08629JA"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60105PY"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11528MV"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23577TY"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01304ZB"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38277AO"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01917CF"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86401DW"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82413XV"}, "ts": "2023-07-25 20:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ICH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ICH7"}, "ts": "2023-07-25 20:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R5M2"}, "ts": "2023-07-25 20:40:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R5M2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:40:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-25 20:40:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43547MI"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71388EZ"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23583KG"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57449OF"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30687DL"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50369EI"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86205HZ"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76108MN"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89290XU"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86601RH"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98166BT"}, "ts": "2023-07-25 20:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34220DL"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60415BS"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26983WI"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19886LH"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46626WO"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92355BR"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39419SX"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78727VW"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42552PM"}, "ts": "2023-07-25 20:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "csv"}, "ts": "2023-07-25 20:40:54 EDT-0400"}, {"api": "/data/list_download/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "download_type": "glycan_list", "format": "csv", "compressed": false, "filters": []}, "ts": "2023-07-25 20:40:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AZ6"}, "ts": "2023-07-25 20:41:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:41:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBT6.261.261"}, "ts": "2023-07-25 20:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBT6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75129", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75129"}, "ts": "2023-07-25 20:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80U95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80U95"}, "ts": "2023-07-25 20:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:42:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "11805077"}, "ts": "2023-07-25 20:42:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33766"}, "ts": "2023-07-25 20:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:42:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3K9"}, "ts": "2023-07-25 20:42:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVU0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:43:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BVU0"}, "ts": "2023-07-25 20:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 20:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:44:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:45:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18754016", "type": "PubMed"}, "ts": "2023-07-25 20:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18754016", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39019"}, "ts": "2023-07-25 20:46:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01833-1"}, "ts": "2023-07-25 20:46:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68133", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:47:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P68133.273.273"}, "ts": "2023-07-25 20:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1597196", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:47:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1597196", "type": "PubMed"}, "ts": "2023-07-25 20:47:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000109"}, "ts": "2023-07-25 20:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13620"}, "ts": "2023-07-25 20:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCX8"}, "ts": "2023-07-25 20:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:48:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99996"}, "ts": "2023-07-25 20:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:48:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BIQ6"}, "ts": "2023-07-25 20:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BIQ6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60673", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60673"}, "ts": "2023-07-25 20:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XHY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:49:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XHY5"}, "ts": "2023-07-25 20:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9662400", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:50:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9662400", "type": "PubMed"}, "ts": "2023-07-25 20:50:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3862104", "type": "PubMed"}, "ts": "2023-07-25 20:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3862104", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A5U3"}, "ts": "2023-07-25 20:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A5U3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11177", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:52:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11177"}, "ts": "2023-07-25 20:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:52:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43547MI"}, "ts": "2023-07-25 20:52:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71388EZ"}, "ts": "2023-07-25 20:52:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23583KG"}, "ts": "2023-07-25 20:52:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57449OF"}, "ts": "2023-07-25 20:52:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30687DL"}, "ts": "2023-07-25 20:52:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50369EI"}, "ts": "2023-07-25 20:52:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86205HZ"}, "ts": "2023-07-25 20:52:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76108MN"}, "ts": "2023-07-25 20:52:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89290XU"}, "ts": "2023-07-25 20:52:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86601RH"}, "ts": "2023-07-25 20:52:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98166BT"}, "ts": "2023-07-25 20:52:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34220DL"}, "ts": "2023-07-25 20:52:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60415BS"}, "ts": "2023-07-25 20:52:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26983WI"}, "ts": "2023-07-25 20:52:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19886LH"}, "ts": "2023-07-25 20:52:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46626WO"}, "ts": "2023-07-25 20:52:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92355BR"}, "ts": "2023-07-25 20:52:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39419SX"}, "ts": "2023-07-25 20:52:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78727VW"}, "ts": "2023-07-25 20:52:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42552PM"}, "ts": "2023-07-25 20:52:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 21, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-25 20:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81269JJ"}, "ts": "2023-07-25 20:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47594NS"}, "ts": "2023-07-25 20:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28685AE"}, "ts": "2023-07-25 20:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94156YI"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85041WE"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11974GJ"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48421GV"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11460AB"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23711JB"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77479VH"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25902PW"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75311GD"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98899DA"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62187QU"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09362PR"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88673AA"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96771UL"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23109YO"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93460NV"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85737WG"}, "ts": "2023-07-25 20:53:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 21, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:53:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67173FM"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69170UT"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72580QS"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42686NQ"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80319WU"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11671GQ"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82680EC"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51098AA"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59655SA"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63065KG"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12222NC"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88417ED"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52676LZ"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52428MJ"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06209KS"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40906DZ"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70511VE"}, "ts": "2023-07-25 20:53:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16679DU"}, "ts": "2023-07-25 20:53:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68758PE"}, "ts": "2023-07-25 20:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:53:18 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "MOUSE"}, "ts": "2023-07-25 20:53:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:53:23 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MOUSE", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "Global search term=MOUSE"}, "ts": "2023-07-25 20:53:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:53:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWX6"}, "ts": "2023-07-25 20:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWX6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:53:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-25 20:53:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:53:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:53:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}]}, "ts": "2023-07-25 20:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:53:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3b5d12c7cc4619f170c464eb818ec3f5", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:54:01 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "MOUSE"}, "ts": "2023-07-25 20:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 20:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MOUSE", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=MOUSE"}, "ts": "2023-07-25 20:54:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16157"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79809MM"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27919IH"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74859XI"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27844UM"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48109OV"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84390MS"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56516KW"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68892PJ"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40194MN"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89993FE"}, "ts": "2023-07-25 20:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16529MG"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80537QW"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14127XU"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14548ZL"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LS0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52880ZN"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60439QY"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LS0"}, "ts": "2023-07-25 20:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20489-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:54:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20489-1"}, "ts": "2023-07-25 20:54:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:54:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}]}, "ts": "2023-07-25 20:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:54:14 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:54:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:54:18 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:54:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95295"}, "ts": "2023-07-25 20:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95295", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:54:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-25 20:54:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02786XX"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81096RM"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25322UQ"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47037BZ"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50508SG"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35843HC"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02630BJ"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73663PS"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31787HV"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93655SG"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61718WP"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82557QP"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56571DA"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72043OX"}, "ts": "2023-07-25 20:54:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55890VR"}, "ts": "2023-07-25 20:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36626AJ"}, "ts": "2023-07-25 20:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54547RU"}, "ts": "2023-07-25 20:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78194GB"}, "ts": "2023-07-25 20:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12865317", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:54:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12865317", "type": "PubMed"}, "ts": "2023-07-25 20:54:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": []}, "ts": "2023-07-25 20:54:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00052MO"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34027VM"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62167DK"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30031BF"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44070VR"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68504BA"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61365NL"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15329MZ"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48039HE"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31616YD"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54569PE"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34442SS"}, "ts": "2023-07-25 20:54:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97023FS"}, "ts": "2023-07-25 20:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58809HG"}, "ts": "2023-07-25 20:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64803HZ"}, "ts": "2023-07-25 20:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09724ZC"}, "ts": "2023-07-25 20:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89738LW"}, "ts": "2023-07-25 20:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97078QF"}, "ts": "2023-07-25 20:54:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78769BZ"}, "ts": "2023-07-25 20:54:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19823.673.673"}, "ts": "2023-07-25 20:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:55:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}]}, "ts": "2023-07-25 20:55:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-25 20:55:13 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:55:13 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:55:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80056AS"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04959WS"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94959AA"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98863OA"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70442IZ"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82201IZ"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99135AC"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21420QH"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95462PR"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47252EW"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79416RI"}, "ts": "2023-07-25 20:55:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:55:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-25 20:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:55:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:55:23 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:55:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40915GX"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81906GK"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41510DX"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03109ER"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13168NE"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87308QC"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88455FN"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40452ID"}, "ts": "2023-07-25 20:55:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11123894", "type": "PubMed"}, "ts": "2023-07-25 20:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11123894", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:55:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34027VM"}, "ts": "2023-07-25 20:56:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-25 20:56:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30031BF"}, "ts": "2023-07-25 20:56:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68504BA"}, "ts": "2023-07-25 20:56:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61365NL"}, "ts": "2023-07-25 20:56:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48039HE"}, "ts": "2023-07-25 20:56:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54569PE"}, "ts": "2023-07-25 20:56:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97023FS"}, "ts": "2023-07-25 20:56:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58809HG"}, "ts": "2023-07-25 20:56:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09724ZC"}, "ts": "2023-07-25 20:56:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89738LW"}, "ts": "2023-07-25 20:56:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78769BZ"}, "ts": "2023-07-25 20:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81906GK"}, "ts": "2023-07-25 20:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41510DX"}, "ts": "2023-07-25 20:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40915GX"}, "ts": "2023-07-25 20:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03109ER"}, "ts": "2023-07-25 20:56:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13168NE"}, "ts": "2023-07-25 20:56:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87308QC"}, "ts": "2023-07-25 20:56:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88455FN"}, "ts": "2023-07-25 20:56:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40452ID"}, "ts": "2023-07-25 20:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11464", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:56:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 21, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:56:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11464.249.249"}, "ts": "2023-07-25 20:56:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51623PN"}, "ts": "2023-07-25 20:56:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10640ZR"}, "ts": "2023-07-25 20:56:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11176QN"}, "ts": "2023-07-25 20:56:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32104JU"}, "ts": "2023-07-25 20:56:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66630YF"}, "ts": "2023-07-25 20:56:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91471TQ"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59406KS"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40998MZ"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79771YZ"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97831CJ"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46720ZO"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01600VV"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64276SW"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27517DL"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63420HM"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45889JQ"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11908FF"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09952UD"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69987TD"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05241IE"}, "ts": "2023-07-25 20:56:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51623PN"}, "ts": "2023-07-25 20:56:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10640ZR"}, "ts": "2023-07-25 20:56:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32104JU"}, "ts": "2023-07-25 20:56:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11176QN"}, "ts": "2023-07-25 20:56:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66630YF"}, "ts": "2023-07-25 20:56:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91471TQ"}, "ts": "2023-07-25 20:56:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59406KS"}, "ts": "2023-07-25 20:56:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05241IE"}, "ts": "2023-07-25 20:56:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69987TD"}, "ts": "2023-07-25 20:56:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09952UD"}, "ts": "2023-07-25 20:56:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11908FF"}, "ts": "2023-07-25 20:56:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63420HM"}, "ts": "2023-07-25 20:56:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45889JQ"}, "ts": "2023-07-25 20:56:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27517DL"}, "ts": "2023-07-25 20:56:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64276SW"}, "ts": "2023-07-25 20:56:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46720ZO"}, "ts": "2023-07-25 20:56:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40998MZ"}, "ts": "2023-07-25 20:56:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97831CJ"}, "ts": "2023-07-25 20:56:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01600VV"}, "ts": "2023-07-25 20:56:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79771YZ"}, "ts": "2023-07-25 20:56:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-25 20:56:43 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 41, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:56:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75818UO"}, "ts": "2023-07-25 20:56:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69542CQ"}, "ts": "2023-07-25 20:56:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08589UC"}, "ts": "2023-07-25 20:56:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18233AE"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90922MJ"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60634GK"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21825UH"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60026QM"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95575GS"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88876JQ"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62922WK"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86386QT"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56400AL"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00978TF"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14985NB"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08550XN"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00030MO"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05027SR"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32814EW"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52849RL"}, "ts": "2023-07-25 20:56:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 41, "sort": "glytoucan_ac", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:56:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94410DN"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94331DR"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93788SW"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93284HQ"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92918JF"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92854IJ"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92709XT"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92477LS"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92348LW"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92101NE"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91865AW"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91842WH"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91623TN"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91599FN"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91365ZH"}, "ts": "2023-07-25 20:56:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91322IG"}, "ts": "2023-07-25 20:56:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91302LT"}, "ts": "2023-07-25 20:56:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91130VE"}, "ts": "2023-07-25 20:56:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90987JA"}, "ts": "2023-07-25 20:56:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 41, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:56:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18013WR"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50462VS"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57984PA"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25890BU"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43953LS"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86782KC"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97770GP"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31532GK"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08486RO"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78391CU"}, "ts": "2023-07-25 20:57:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 41, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98450JT"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09696LD"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90755RV"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626KE"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99247US"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66932MV"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34982PS"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89685ZW"}, "ts": "2023-07-25 20:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14798", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 20:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14798"}, "ts": "2023-07-25 20:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60469", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:57:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60469.512.512"}, "ts": "2023-07-25 20:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75818UO"}, "ts": "2023-07-25 20:57:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69542CQ"}, "ts": "2023-07-25 20:57:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08589UC"}, "ts": "2023-07-25 20:57:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18233AE"}, "ts": "2023-07-25 20:57:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90922MJ"}, "ts": "2023-07-25 20:57:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60634GK"}, "ts": "2023-07-25 20:57:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21825UH"}, "ts": "2023-07-25 20:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86386QT"}, "ts": "2023-07-25 20:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56400AL"}, "ts": "2023-07-25 20:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00978TF"}, "ts": "2023-07-25 20:57:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14985NB"}, "ts": "2023-07-25 20:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08550XN"}, "ts": "2023-07-25 20:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00030MO"}, "ts": "2023-07-25 20:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05027SR"}, "ts": "2023-07-25 20:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32814EW"}, "ts": "2023-07-25 20:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52849RL"}, "ts": "2023-07-25 20:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88876JQ"}, "ts": "2023-07-25 20:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60026QM"}, "ts": "2023-07-25 20:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62922WK"}, "ts": "2023-07-25 20:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95575GS"}, "ts": "2023-07-25 20:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:58:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRP7"}, "ts": "2023-07-25 20:58:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:58:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15800-1"}, "ts": "2023-07-25 20:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8K855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15800-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:58:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8K855"}, "ts": "2023-07-25 20:58:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 61, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 20:58:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9109675", "type": "PubMed"}, "ts": "2023-07-25 20:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9109675", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08520NM"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00017IP"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34914SZ"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88569LV"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62083JR"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22981GY"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48442VP"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52622SW"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47498FQ"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21438LK"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85726QE"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76924RW"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07224ZK"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21284IS"}, "ts": "2023-07-25 20:58:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16417CU"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42565GH"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58315IU"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02511.170.170"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73089GA"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59358BQ"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12071VW"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02511", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:58:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JQ2.689.689"}, "ts": "2023-07-25 20:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 20:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42166", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:58:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42166"}, "ts": "2023-07-25 20:58:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3X1"}, "ts": "2023-07-25 20:58:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00017IP"}, "ts": "2023-07-25 20:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34914SZ"}, "ts": "2023-07-25 20:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88569LV"}, "ts": "2023-07-25 20:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62083JR"}, "ts": "2023-07-25 20:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22981GY"}, "ts": "2023-07-25 20:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48442VP"}, "ts": "2023-07-25 20:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85726QE"}, "ts": "2023-07-25 20:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76924RW"}, "ts": "2023-07-25 20:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07224ZK"}, "ts": "2023-07-25 20:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21284IS"}, "ts": "2023-07-25 20:58:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16417CU"}, "ts": "2023-07-25 20:58:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42565GH"}, "ts": "2023-07-25 20:58:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58315IU"}, "ts": "2023-07-25 20:58:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73089GA"}, "ts": "2023-07-25 20:58:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59358BQ"}, "ts": "2023-07-25 20:58:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12071VW"}, "ts": "2023-07-25 20:58:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21438LK"}, "ts": "2023-07-25 20:58:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52622SW"}, "ts": "2023-07-25 20:58:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47498FQ"}, "ts": "2023-07-25 20:58:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08520NM"}, "ts": "2023-07-25 20:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX97", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 20:59:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CX97"}, "ts": "2023-07-25 20:59:35 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 21:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 21:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 21:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 21:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 21:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 21:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRJ4"}, "ts": "2023-07-25 21:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:00:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 81, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75688"}, "ts": "2023-07-25 21:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKU9"}, "ts": "2023-07-25 21:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:00:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89756YF"}, "ts": "2023-07-25 21:00:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38047QV"}, "ts": "2023-07-25 21:00:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72035XH"}, "ts": "2023-07-25 21:00:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29407ZG"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21195ZJ"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78838PJ"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17336WC"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76219EF"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78520ZK"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10374FO"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32810TH"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90364OQ"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81397LO"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95776JG"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85843WY"}, "ts": "2023-07-25 21:00:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06550JR"}, "ts": "2023-07-25 21:00:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54079AB"}, "ts": "2023-07-25 21:00:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89756YF"}, "ts": "2023-07-25 21:00:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72035XH"}, "ts": "2023-07-25 21:00:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29407ZG"}, "ts": "2023-07-25 21:00:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21195ZJ"}, "ts": "2023-07-25 21:00:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78838PJ"}, "ts": "2023-07-25 21:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17336WC"}, "ts": "2023-07-25 21:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76219EF"}, "ts": "2023-07-25 21:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78520ZK"}, "ts": "2023-07-25 21:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10374FO"}, "ts": "2023-07-25 21:00:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32810TH"}, "ts": "2023-07-25 21:00:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92709XT"}, "ts": "2023-07-25 21:00:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90364OQ"}, "ts": "2023-07-25 21:00:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81397LO"}, "ts": "2023-07-25 21:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91599FN"}, "ts": "2023-07-25 21:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95776JG"}, "ts": "2023-07-25 21:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89993FE"}, "ts": "2023-07-25 21:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85843WY"}, "ts": "2023-07-25 21:00:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06550JR"}, "ts": "2023-07-25 21:00:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54079AB"}, "ts": "2023-07-25 21:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38047QV"}, "ts": "2023-07-25 21:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:00:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UQ4"}, "ts": "2023-07-25 21:00:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 101, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69082TL"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59471TH"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97483RC"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40198OD"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55677OQ"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97129CF"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85425ER"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83653PM"}, "ts": "2023-07-25 21:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87776HI"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90584SZ"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54846SY"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99075EP"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36216PA"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44534DB"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77085GN"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82529OA"}, "ts": "2023-07-25 21:00:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21982KM"}, "ts": "2023-07-25 21:00:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09057YJ"}, "ts": "2023-07-25 21:00:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98338IO"}, "ts": "2023-07-25 21:00:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87418CY"}, "ts": "2023-07-25 21:00:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69082TL"}, "ts": "2023-07-25 21:01:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59471TH"}, "ts": "2023-07-25 21:01:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97483RC"}, "ts": "2023-07-25 21:01:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40198OD"}, "ts": "2023-07-25 21:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:01:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z602"}, "ts": "2023-07-25 21:01:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55677OQ"}, "ts": "2023-07-25 21:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97129CF"}, "ts": "2023-07-25 21:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85425ER"}, "ts": "2023-07-25 21:01:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99075EP"}, "ts": "2023-07-25 21:01:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36216PA"}, "ts": "2023-07-25 21:01:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44534DB"}, "ts": "2023-07-25 21:01:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77085GN"}, "ts": "2023-07-25 21:01:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82529OA"}, "ts": "2023-07-25 21:01:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21982KM"}, "ts": "2023-07-25 21:01:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09057YJ"}, "ts": "2023-07-25 21:01:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87418CY"}, "ts": "2023-07-25 21:01:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98338IO"}, "ts": "2023-07-25 21:01:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87776HI"}, "ts": "2023-07-25 21:01:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83653PM"}, "ts": "2023-07-25 21:01:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90584SZ"}, "ts": "2023-07-25 21:01:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54846SY"}, "ts": "2023-07-25 21:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C5R2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C5R2"}, "ts": "2023-07-25 21:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01833-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02462", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:02:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02462"}, "ts": "2023-07-25 21:02:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 121, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:02:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28347RJ"}, "ts": "2023-07-25 21:02:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61182RU"}, "ts": "2023-07-25 21:02:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73573GX"}, "ts": "2023-07-25 21:02:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44747CU"}, "ts": "2023-07-25 21:02:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32915BP"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02945KQ"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87139MR"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47242QB"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88651GV"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13292BE"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61937QU"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68957QP"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44413JJ"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43159MH"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98112EU"}, "ts": "2023-07-25 21:02:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55653UQ"}, "ts": "2023-07-25 21:02:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57153UY"}, "ts": "2023-07-25 21:02:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75632DB"}, "ts": "2023-07-25 21:02:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21168QR"}, "ts": "2023-07-25 21:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRA0"}, "ts": "2023-07-25 21:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:03:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 141, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60238-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:03:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60238-1"}, "ts": "2023-07-25 21:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:03:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98178JY"}, "ts": "2023-07-25 21:03:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32692TS"}, "ts": "2023-07-25 21:03:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88884NJ"}, "ts": "2023-07-25 21:03:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49900EU"}, "ts": "2023-07-25 21:03:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34723UV"}, "ts": "2023-07-25 21:03:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29568VE"}, "ts": "2023-07-25 21:03:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38404PP"}, "ts": "2023-07-25 21:03:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23087XI"}, "ts": "2023-07-25 21:03:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10179FS"}, "ts": "2023-07-25 21:03:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74120KH"}, "ts": "2023-07-25 21:03:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62591VF"}, "ts": "2023-07-25 21:03:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87695KR"}, "ts": "2023-07-25 21:03:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55488PJ"}, "ts": "2023-07-25 21:03:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 21:03:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82878DH"}, "ts": "2023-07-25 21:03:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54578EI"}, "ts": "2023-07-25 21:03:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58386NJ"}, "ts": "2023-07-25 21:03:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22432GF"}, "ts": "2023-07-25 21:03:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46961WO"}, "ts": "2023-07-25 21:03:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67878GN"}, "ts": "2023-07-25 21:03:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14480-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:04:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14480-1"}, "ts": "2023-07-25 21:04:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32692TS"}, "ts": "2023-07-25 21:04:39 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 161, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:04:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27196XM"}, "ts": "2023-07-25 21:04:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56238AO"}, "ts": "2023-07-25 21:04:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67888MA"}, "ts": "2023-07-25 21:04:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38002XF"}, "ts": "2023-07-25 21:04:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29972ZX"}, "ts": "2023-07-25 21:04:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54811KN"}, "ts": "2023-07-25 21:04:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37986HU"}, "ts": "2023-07-25 21:04:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146MY"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46759WS"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96063MG"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72533FB"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81150TA"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90426CG"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42096BU"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63480NF"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50293EM"}, "ts": "2023-07-25 21:04:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74246AM"}, "ts": "2023-07-25 21:04:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77198CF"}, "ts": "2023-07-25 21:04:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45578XY"}, "ts": "2023-07-25 21:04:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18410UY"}, "ts": "2023-07-25 21:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6EBC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:05:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6EBC2"}, "ts": "2023-07-25 21:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NM36", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:06:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NM36"}, "ts": "2023-07-25 21:06:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQK2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:06:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PQK2-1"}, "ts": "2023-07-25 21:06:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21964"}, "ts": "2023-07-25 21:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:07:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15620"}, "ts": "2023-07-25 21:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15620", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:07:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJC7"}, "ts": "2023-07-25 21:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09470", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:07:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09470"}, "ts": "2023-07-25 21:07:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:07:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8BL74", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 21:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BL74", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BL74", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 21:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15833747", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:08:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15833747", "type": "PubMed"}, "ts": "2023-07-25 21:08:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0PMD2"}, "ts": "2023-07-25 21:08:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0PMD2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:08:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80SS6"}, "ts": "2023-07-25 21:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80SS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:08:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80SS5"}, "ts": "2023-07-25 21:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80SS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:08:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04791QM"}, "ts": "2023-07-25 21:09:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82914", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:09:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82914"}, "ts": "2023-07-25 21:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TYX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:10:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TYX0"}, "ts": "2023-07-25 21:10:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 181, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:10:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86347EY"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33269XL"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05312EE"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26264HC"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72393PG"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41824PC"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79835GX"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55811AY"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79754SY"}, "ts": "2023-07-25 21:10:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08256MX"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38329HC"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45256SO"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83062JW"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15369VN"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76583MP"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11960UF"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20030CU"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21573FN"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85176IW"}, "ts": "2023-07-25 21:10:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y235"}, "ts": "2023-07-25 21:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PINK1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 21:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y235", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:11:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 201, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:11:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:11:12 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "PINK1"}, "ts": "2023-07-25 21:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PINK1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=PINK1"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04930QT"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03558PU"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15683CN"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89343RJ"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69963GQ"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68345FH"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09684AX"}, "ts": "2023-07-25 21:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19600YQ"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67191UH"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14389GJ"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67983WD"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83204BU"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90725ZC"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07323UU"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07584GT"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60689VV"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58574AT"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62779OI"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00396IE"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9857d6b5189da1c415a39501ff60043a", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:11:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "9857d6b5189da1c415a39501ff60043a", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:11:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:11:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEM1.1101.1101"}, "ts": "2023-07-25 21:11:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UY14.453.453"}, "ts": "2023-07-25 21:11:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 221, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:12:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70246WA"}, "ts": "2023-07-25 21:12:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87073UP"}, "ts": "2023-07-25 21:12:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58169YV"}, "ts": "2023-07-25 21:12:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05948HK"}, "ts": "2023-07-25 21:12:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26265RM"}, "ts": "2023-07-25 21:12:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40786FB"}, "ts": "2023-07-25 21:12:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84689MX"}, "ts": "2023-07-25 21:12:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81554CS"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31561GU"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08161JQ"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53786US"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20079RG"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0Y5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63036JK"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23132GK"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68043NM"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66570YR"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28136CO"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21508HF"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28978TP"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41739KR"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0Y5"}, "ts": "2023-07-25 21:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TNA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:12:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TNA1"}, "ts": "2023-07-25 21:12:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60755", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:12:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60755.45.45"}, "ts": "2023-07-25 21:12:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4K0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:13:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4K0"}, "ts": "2023-07-25 21:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXM7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-25 21:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:13:17 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q9BXM7"}, "ts": "2023-07-25 21:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXM7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q9BXM7"}, "ts": "2023-07-25 21:13:18 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:13:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "53e2dd8457d162a0236b0e186aff76fb", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:13:19 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "53e2dd8457d162a0236b0e186aff76fb", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:13:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:13:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXS5.28.28"}, "ts": "2023-07-25 21:13:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXS5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:13:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 241, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:14:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15938BX"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07380TS"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06772YH"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80762EP"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04508HC"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74575XC"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60078FW"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17978LE"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84622HC"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43137UY"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83258AP"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39617JJ"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24191XX"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85542KD"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49369WH"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03512HG"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49872TN"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75090UL"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36807HJ"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39431MA"}, "ts": "2023-07-25 21:14:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30422870", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:14:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30422870", "type": "PubMed"}, "ts": "2023-07-25 21:14:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48058.698.698"}, "ts": "2023-07-25 21:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48058", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:15:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51885"}, "ts": "2023-07-25 21:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51885", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:15:45 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "53e2dd8457d162a0236b0e186aff76fb", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:15:46 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "53e2dd8457d162a0236b0e186aff76fb", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:15:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13336", "cluster_type": "unselected"}, "ts": "2023-07-25 21:15:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13336", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:15:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13336", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 21:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXM7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-25 21:15:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:15:55 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q9BXM7"}, "ts": "2023-07-25 21:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:15:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXM7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q9BXM7"}, "ts": "2023-07-25 21:15:56 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f817d7e0ef74425432dbcbd5c32e65d2", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:15:58 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "f817d7e0ef74425432dbcbd5c32e65d2", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXM7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXM7-1"}, "ts": "2023-07-25 21:16:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RU3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:16:10 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96RU3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 21:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RU3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 21:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBX9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:17:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBX9.138.138"}, "ts": "2023-07-25 21:17:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-25 21:17:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23528-1"}, "ts": "2023-07-25 21:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04792"}, "ts": "2023-07-25 21:17:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62418.299.299"}, "ts": "2023-07-25 21:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62418", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75037"}, "ts": "2023-07-25 21:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60346", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:18:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60346.495.495"}, "ts": "2023-07-25 21:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88600", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:18:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88600"}, "ts": "2023-07-25 21:18:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00746", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:19:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00746"}, "ts": "2023-07-25 21:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17535", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:20:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17535.119.119"}, "ts": "2023-07-25 21:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDD5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:20:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDD5-1"}, "ts": "2023-07-25 21:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31468711", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:21:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31468711", "type": "PubMed"}, "ts": "2023-07-25 21:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21964", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:22:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KTX7", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 21:24:52 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q7KTX7"}, "ts": "2023-07-25 21:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KTX7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q7KTX7"}, "ts": "2023-07-25 21:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1c5fbd9bb1a2a6ac4bf02fc901b13f54", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:24:56 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1c5fbd9bb1a2a6ac4bf02fc901b13f54", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:24:56 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:24:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2V5-1"}, "ts": "2023-07-25 21:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2V5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:24:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98161"}, "ts": "2023-07-25 21:25:02 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1c5fbd9bb1a2a6ac4bf02fc901b13f54", "offset": 21, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBK3"}, "ts": "2023-07-25 21:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:25:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1c5fbd9bb1a2a6ac4bf02fc901b13f54", "offset": 41, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04791QM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 21:25:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Parkin", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-25 21:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:25:31 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Parkin"}, "ts": "2023-07-25 21:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Parkin", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Parkin"}, "ts": "2023-07-25 21:25:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b3b7389be9413fa0aafee75fa4059473", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:25:33 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b3b7389be9413fa0aafee75fa4059473", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94813", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:25:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94813.1212.1212"}, "ts": "2023-07-25 21:25:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75369"}, "ts": "2023-07-25 21:25:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60260-1"}, "ts": "2023-07-25 21:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60260-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:26:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-25 21:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:26:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13728QT"}, "ts": "2023-07-25 21:26:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YZ3"}, "ts": "2023-07-25 21:26:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL51", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:26:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UL51.757.757"}, "ts": "2023-07-25 21:26:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:27:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16070.599.599"}, "ts": "2023-07-25 21:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70309", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:27:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70309"}, "ts": "2023-07-25 21:27:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q07157", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 21:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07157", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07157", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 21:27:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZR52"}, "ts": "2023-07-25 21:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZR52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:28:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6G9.419.419"}, "ts": "2023-07-25 21:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6G9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15194196", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:28:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15194196", "type": "PubMed"}, "ts": "2023-07-25 21:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15194196", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 21:28:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23743"}, "ts": "2023-07-25 21:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23743", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:28:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60524"}, "ts": "2023-07-25 21:28:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60524", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:28:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD2"}, "ts": "2023-07-25 21:28:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75443", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:29:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75443"}, "ts": "2023-07-25 21:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTW8"}, "ts": "2023-07-25 21:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07900"}, "ts": "2023-07-25 21:29:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34165155", "type": "PubMed"}, "ts": "2023-07-25 21:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34165155", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3Y3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:30:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3Y3"}, "ts": "2023-07-25 21:30:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27796283", "type": "PubMed"}, "ts": "2023-07-25 21:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27796283", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:31:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55073"}, "ts": "2023-07-25 21:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFY4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:31:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFY4.633.633"}, "ts": "2023-07-25 21:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2G2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:32:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2G2"}, "ts": "2023-07-25 21:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQ73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:32:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQ73"}, "ts": "2023-07-25 21:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z895-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:32:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z895-1"}, "ts": "2023-07-25 21:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:33:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBJ2"}, "ts": "2023-07-25 21:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:33:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08133"}, "ts": "2023-07-25 21:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08133", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27361-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:33:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27361-1"}, "ts": "2023-07-25 21:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23528-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60266-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:34:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60266-1"}, "ts": "2023-07-25 21:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31431"}, "ts": "2023-07-25 21:34:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H492", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 21:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:34:20 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q9H492"}, "ts": "2023-07-25 21:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H492", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q9H492"}, "ts": "2023-07-25 21:34:20 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2df530c7d004865895e376490eb8f19f", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:34:23 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "2df530c7d004865895e376490eb8f19f", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:34:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H492-1"}, "ts": "2023-07-25 21:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H492-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84078", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84078"}, "ts": "2023-07-25 21:35:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25205"}, "ts": "2023-07-25 21:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:35:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A368"}, "ts": "2023-07-25 21:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A368", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:36:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09923.185.185"}, "ts": "2023-07-25 21:36:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VIC9"}, "ts": "2023-07-25 21:36:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11590207", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:36:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11590207", "type": "PubMed"}, "ts": "2023-07-25 21:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VIC9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00888", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:36:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00888.417.417"}, "ts": "2023-07-25 21:36:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V9P3"}, "ts": "2023-07-25 21:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V9P3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:37:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXH8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:37:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IXH8.325.325"}, "ts": "2023-07-25 21:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RSQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:37:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2RSQ0.178.178"}, "ts": "2023-07-25 21:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P032-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:38:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZ42"}, "ts": "2023-07-25 21:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P032-1"}, "ts": "2023-07-25 21:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96N66"}, "ts": "2023-07-25 21:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N66", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17431-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:39:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17431-1"}, "ts": "2023-07-25 21:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:39:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5F1.548.548"}, "ts": "2023-07-25 21:39:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19320.275.275"}, "ts": "2023-07-25 21:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19320", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:39:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-25 21:40:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63340"}, "ts": "2023-07-25 21:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63340", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:40:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92545-1"}, "ts": "2023-07-25 21:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92545-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4A3"}, "ts": "2023-07-25 21:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12983", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 21:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7780197", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:41:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7780197", "type": "PubMed"}, "ts": "2023-07-25 21:41:29 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q12983"}, "ts": "2023-07-25 21:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12983", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q12983"}, "ts": "2023-07-25 21:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:41:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d728921240868fdb6d2c6cc87972af16", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:41:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d728921240868fdb6d2c6cc87972af16", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:41:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12983-1"}, "ts": "2023-07-25 21:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12983-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q2I4-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:41:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q2I4-1"}, "ts": "2023-07-25 21:41:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18754.344.344"}, "ts": "2023-07-25 21:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18754", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G87310ZF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 21:42:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87310ZF"}, "ts": "2023-07-25 21:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 21:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQN3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:43:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EQN3.189.189"}, "ts": "2023-07-25 21:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13003", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:43:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13003.76.76"}, "ts": "2023-07-25 21:43:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16719"}, "ts": "2023-07-25 21:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16719", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PD26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:44:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PD26.370.370"}, "ts": "2023-07-25 21:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:44:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80511"}, "ts": "2023-07-25 21:44:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08047"}, "ts": "2023-07-25 21:44:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14627671", "type": "PubMed"}, "ts": "2023-07-25 21:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60238", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 21:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:45:52 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "O60238"}, "ts": "2023-07-25 21:45:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:45:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60238", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=O60238"}, "ts": "2023-07-25 21:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "99160460fbabf35b6f46785f9dd3583e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:45:55 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "99160460fbabf35b6f46785f9dd3583e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:45:55 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:45:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60238-1"}, "ts": "2023-07-25 21:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60238-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28411811", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:46:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:46:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28411811", "type": "PubMed"}, "ts": "2023-07-25 21:46:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-25 21:46:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21810"}, "ts": "2023-07-25 21:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21810", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28411811", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:46:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28411811", "type": "PubMed"}, "ts": "2023-07-25 21:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESB3"}, "ts": "2023-07-25 21:47:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESB3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:47:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33486722", "type": "PubMed"}, "ts": "2023-07-25 21:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33486722", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:47:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-25 21:47:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22789990", "type": "PubMed"}, "ts": "2023-07-25 21:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22789990", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02094", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:47:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q02094", "cluster_type": "unselected"}, "ts": "2023-07-25 21:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02094", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 21:47:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BF6"}, "ts": "2023-07-25 21:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BF6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00268", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:48:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00268.532.532"}, "ts": "2023-07-25 21:48:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ65"}, "ts": "2023-07-25 21:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2G1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:48:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2G1.836.836"}, "ts": "2023-07-25 21:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:49:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T7W7"}, "ts": "2023-07-25 21:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:49:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98164"}, "ts": "2023-07-25 21:49:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58710"}, "ts": "2023-07-25 21:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58710", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVP5", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 21:49:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:50:00 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q8IVP5"}, "ts": "2023-07-25 21:50:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVP5", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q8IVP5"}, "ts": "2023-07-25 21:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:50:02 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:50:02 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "57315041258e6a775b3e46886139db8f", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "57315041258e6a775b3e46886139db8f", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35556", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:50:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35556.588.588"}, "ts": "2023-07-25 21:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVP5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:50:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVP5-1"}, "ts": "2023-07-25 21:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15498874", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADA5-1"}, "ts": "2023-07-25 21:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADA5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:50:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5T7W7", "cluster_type": "unselected"}, "ts": "2023-07-25 21:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 21:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18669648", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:50:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T7W7.464.464"}, "ts": "2023-07-25 21:50:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23186163", "type": "PubMed"}, "ts": "2023-07-25 21:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23186163", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-25 21:50:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T7W7.468.468"}, "ts": "2023-07-25 21:50:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T7W7.474.474"}, "ts": "2023-07-25 21:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17924679", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17924679", "type": "PubMed"}, "ts": "2023-07-25 21:50:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18669648", "type": "PubMed"}, "ts": "2023-07-25 21:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 21:50:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T7W7.269.269"}, "ts": "2023-07-25 21:50:18 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5T7W7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 21:50:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "how-to-cite", "message": "page access"}, "ts": "2023-07-25 21:50:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "how-to-cite", "message": "page access"}, "ts": "2023-07-25 21:50:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15498874", "type": "PubMed"}, "ts": "2023-07-25 21:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22918957", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:50:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22918957", "type": "PubMed"}, "ts": "2023-07-25 21:50:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBF4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:50:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBF4.685.685"}, "ts": "2023-07-25 21:50:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGL1"}, "ts": "2023-07-25 21:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDG6"}, "ts": "2023-07-25 21:51:13 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "57315041258e6a775b3e46886139db8f", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:51:15 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "57315041258e6a775b3e46886139db8f", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYR6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:51:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYR6"}, "ts": "2023-07-25 21:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVP5", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-25 21:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:51:31 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q8IVP5"}, "ts": "2023-07-25 21:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVP5", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q8IVP5"}, "ts": "2023-07-25 21:51:31 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e07cf7a107308824917d1d69770b4f8", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e07cf7a107308824917d1d69770b4f8", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:51:33 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14566", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:51:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14566"}, "ts": "2023-07-25 21:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:51:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30520"}, "ts": "2023-07-25 21:51:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UY5.4.4"}, "ts": "2023-07-25 21:51:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:52:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15007"}, "ts": "2023-07-25 21:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N126", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:52:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N126.33.33"}, "ts": "2023-07-25 21:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16807684", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:52:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16807684", "type": "PubMed"}, "ts": "2023-07-25 21:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KTX7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-25 21:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:52:57 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q7KTX7"}, "ts": "2023-07-25 21:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KTX7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q7KTX7"}, "ts": "2023-07-25 21:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12983", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-25 21:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:53:10 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q12983"}, "ts": "2023-07-25 21:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12983", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q12983"}, "ts": "2023-07-25 21:53:11 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:53:13 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fee850fc4e241ccd60615b1ba7bb4887", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fee850fc4e241ccd60615b1ba7bb4887", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12983-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:53:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12983-1"}, "ts": "2023-07-25 21:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30210497", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:53:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30210497", "type": "PubMed"}, "ts": "2023-07-25 21:53:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30210497", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 21:53:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27808-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:53:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27808-1"}, "ts": "2023-07-25 21:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:54:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46098"}, "ts": "2023-07-25 21:54:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96M27.159.159"}, "ts": "2023-07-25 21:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96M27", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31751", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 21:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:54:38 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "P31751"}, "ts": "2023-07-25 21:54:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 21:54:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31751", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=P31751"}, "ts": "2023-07-25 21:54:39 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 21:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "855c97d62d789258fb2511e2dad990fe", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 21:54:41 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "855c97d62d789258fb2511e2dad990fe", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 21:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31751-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31751-1"}, "ts": "2023-07-25 21:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWK6"}, "ts": "2023-07-25 21:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556"}, "ts": "2023-07-25 21:55:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34514543", "type": "PubMed"}, "ts": "2023-07-25 21:55:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34514543", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34514543", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 21:55:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2G6"}, "ts": "2023-07-25 21:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2G6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:55:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLY8"}, "ts": "2023-07-25 21:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80VR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:55:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047-1.1170.1170"}, "ts": "2023-07-25 21:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11047-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28411811", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:56:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28411811", "type": "PubMed"}, "ts": "2023-07-25 21:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18728220", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:56:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18728220", "type": "PubMed"}, "ts": "2023-07-25 21:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BQM4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 21:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BQM4"}, "ts": "2023-07-25 21:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H841", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:57:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 261, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:57:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H841.274.274"}, "ts": "2023-07-25 21:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46584GY"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19310VN"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12143FS"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04146DI"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39482QN"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47613FH"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70548CP"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08185DV"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34861PV"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50782HI"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06601SQ"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46768QH"}, "ts": "2023-07-25 21:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63787RZ"}, "ts": "2023-07-25 21:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54380FJ"}, "ts": "2023-07-25 21:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68937TM"}, "ts": "2023-07-25 21:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71782CJ"}, "ts": "2023-07-25 21:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87433AX"}, "ts": "2023-07-25 21:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68512SN"}, "ts": "2023-07-25 21:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47669IJ"}, "ts": "2023-07-25 21:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCN8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 21:57:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCN8.211.211"}, "ts": "2023-07-25 21:57:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 281, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:58:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28189ZX"}, "ts": "2023-07-25 21:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94486VG"}, "ts": "2023-07-25 21:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43553YK"}, "ts": "2023-07-25 21:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36639KI"}, "ts": "2023-07-25 21:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48768LA"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31576LD"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61388TL"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95140CC"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84148GL"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27170BX"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50739NP"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95172ZM"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96342WK"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54151YB"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65945PP"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49495MH"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45259OX"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70052MF"}, "ts": "2023-07-25 21:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:58:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70704"}, "ts": "2023-07-25 21:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70704", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 21:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9771752", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 21:58:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9771752", "type": "PubMed"}, "ts": "2023-07-25 21:58:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28189ZX"}, "ts": "2023-07-25 21:58:37 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b679d3b3d6f244d8c750a5d21b387350", "offset": 301, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Mus musculus"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-25 21:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96168ED"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13345HJ"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46799MV"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49991UY"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86705PH"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70258ML"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02841EM"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58517TJ"}, "ts": "2023-07-25 21:58:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29025AG"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08439GP"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22511QL"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68969GZ"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10898KH"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10820KD"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99382AP"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47837MS"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60468EV"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95489LN"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66684PX"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24660HK"}, "ts": "2023-07-25 21:58:45 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 22:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 22:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 22:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 22:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 22:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 22:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:00:47 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 22:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 22:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 22:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "contact-us", "message": "page access"}, "ts": "2023-07-25 22:02:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "contact-us", "message": "page access"}, "ts": "2023-07-25 22:02:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99623", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 22:02:15 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q99623"}, "ts": "2023-07-25 22:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99623", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q99623"}, "ts": "2023-07-25 22:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:02:17 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b0b898f654334f723e5a024b58e8523b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:02:19 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b0b898f654334f723e5a024b58e8523b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9165094", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:02:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9165094", "type": "PubMed"}, "ts": "2023-07-25 22:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-25 22:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-25 22:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99623-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:02:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99623-1"}, "ts": "2023-07-25 22:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 22:02:28 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 22:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 22:02:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13275"}, "ts": "2023-07-25 22:02:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13275", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:02:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-policy", "message": "page access"}, "ts": "2023-07-25 22:02:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-policy", "message": "page access"}, "ts": "2023-07-25 22:02:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-25 22:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-25 22:02:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3X9V8-1"}, "ts": "2023-07-25 22:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "feedback", "message": "page access"}, "ts": "2023-07-25 22:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "feedback", "message": "page access"}, "ts": "2023-07-25 22:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3X9V8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:02:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-25 22:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29973", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:03:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29973.424.424"}, "ts": "2023-07-25 22:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:03:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYI4"}, "ts": "2023-07-25 22:03:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33987909", "type": "PubMed"}, "ts": "2023-07-25 22:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33987909", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQH3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQH3"}, "ts": "2023-07-25 22:05:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-25 22:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTA9"}, "ts": "2023-07-25 22:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-25 22:06:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31949"}, "ts": "2023-07-25 22:08:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVE6"}, "ts": "2023-07-25 22:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVE6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY09", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:08:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UY09.105.105"}, "ts": "2023-07-25 22:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZX6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:08:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZX6"}, "ts": "2023-07-25 22:08:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY5"}, "ts": "2023-07-25 22:09:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K394"}, "ts": "2023-07-25 22:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K394", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969V3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969V3"}, "ts": "2023-07-25 22:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:09:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16728727", "type": "PubMed"}, "ts": "2023-07-25 22:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16728727", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:09:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16111919", "type": "PubMed"}, "ts": "2023-07-25 22:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16111919", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3B1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:11:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3B1.307.307"}, "ts": "2023-07-25 22:11:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-25 22:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1638633", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:12:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1638633", "type": "PubMed"}, "ts": "2023-07-25 22:12:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:12:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11279.121.121"}, "ts": "2023-07-25 22:12:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20983SP"}, "ts": "2023-07-25 22:12:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00584"}, "ts": "2023-07-25 22:12:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:12:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62000"}, "ts": "2023-07-25 22:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62000", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:12:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q810Z1"}, "ts": "2023-07-25 22:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810Z1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26510530", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:12:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26510530", "type": "PubMed"}, "ts": "2023-07-25 22:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:13:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54277"}, "ts": "2023-07-25 22:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:13:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M864"}, "ts": "2023-07-25 22:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M864", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UF33", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:13:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:13:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UF33"}, "ts": "2023-07-25 22:13:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PYQ5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PYQ5-1"}, "ts": "2023-07-25 22:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34085602", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:14:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34085602", "type": "PubMed"}, "ts": "2023-07-25 22:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14318", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 22:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:14:32 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q14318"}, "ts": "2023-07-25 22:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14318", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q14318"}, "ts": "2023-07-25 22:14:33 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f5a185b46e55063a11815d3a419b9df0", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:14:34 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "f5a185b46e55063a11815d3a419b9df0", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:14:57 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q14318"}, "ts": "2023-07-25 22:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14318", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q14318"}, "ts": "2023-07-25 22:14:57 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "dee52d9b895b399e6d8ad1e304b91076", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:14:58 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "dee52d9b895b399e6d8ad1e304b91076", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:14:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14318-1"}, "ts": "2023-07-25 22:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14318-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:15:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NR3"}, "ts": "2023-07-25 22:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25079LO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:15:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25079LO"}, "ts": "2023-07-25 22:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-25 22:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RTY3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:15:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RTY3"}, "ts": "2023-07-25 22:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03167", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:16:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03167.369.369"}, "ts": "2023-07-25 22:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60825-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 22:16:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P60825-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 22:16:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60825-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-25 22:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCD3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:17:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCD3"}, "ts": "2023-07-25 22:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U3X7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:17:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U3X7"}, "ts": "2023-07-25 22:17:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HP0"}, "ts": "2023-07-25 22:17:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:17:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 22:17:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q15032", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 22:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15032", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 22:17:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15032", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 22:17:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PK18"}, "ts": "2023-07-25 22:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VU97", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:17:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VU97.455.455"}, "ts": "2023-07-25 22:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66K74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:18:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q66K74.472.472"}, "ts": "2023-07-25 22:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:18:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-25 22:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:18:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48307"}, "ts": "2023-07-25 22:18:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14047PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:18:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-25 22:19:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62993"}, "ts": "2023-07-25 22:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62993", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PG6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:19:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99PG6.88.88"}, "ts": "2023-07-25 22:19:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70220"}, "ts": "2023-07-25 22:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C7", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 22:19:11 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q9C0C7"}, "ts": "2023-07-25 22:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q9C0C7"}, "ts": "2023-07-25 22:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:19:13 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:19:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "61f24a3bedba061a2dd2605a0a7e47ef", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:19:16 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "61f24a3bedba061a2dd2605a0a7e47ef", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:19:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0C7-1"}, "ts": "2023-07-25 22:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51617"}, "ts": "2023-07-25 22:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51617", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAV5"}, "ts": "2023-07-25 22:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAV5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:20:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-25 22:20:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94956"}, "ts": "2023-07-25 22:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:21:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920R3"}, "ts": "2023-07-25 22:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920R3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29460"}, "ts": "2023-07-25 22:21:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-25 22:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15116", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:23:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15116.156.156"}, "ts": "2023-07-25 22:23:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:24:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25837HW"}, "ts": "2023-07-25 22:24:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16143"}, "ts": "2023-07-25 22:25:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16143", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:25:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TCG1.427.427"}, "ts": "2023-07-25 22:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCG1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:25:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10070", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:25:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10070.1011.1011"}, "ts": "2023-07-25 22:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-25 22:25:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0L2"}, "ts": "2023-07-25 22:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0L2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:25:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-25 22:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:26:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15379"}, "ts": "2023-07-25 22:26:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:27:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:27:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-25 22:27:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-25 22:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:27:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12869586", "type": "PubMed"}, "ts": "2023-07-25 22:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12869586", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27193682", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:28:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27193682", "type": "PubMed"}, "ts": "2023-07-25 22:28:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03461SC"}, "ts": "2023-07-25 22:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20983SP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1L5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:28:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P1L5-1.106.106"}, "ts": "2023-07-25 22:28:37 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01106", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 22:28:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 22:28:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 22:28:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:29:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJC7"}, "ts": "2023-07-25 22:29:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-25 22:29:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96T58"}, "ts": "2023-07-25 22:29:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPT5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:30:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPT5-1"}, "ts": "2023-07-25 22:30:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULB5.9.9"}, "ts": "2023-07-25 22:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULB5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:30:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NCC5.199.199"}, "ts": "2023-07-25 22:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCC5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:31:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46531"}, "ts": "2023-07-25 22:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64519"}, "ts": "2023-07-25 22:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08101-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:31:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08101-1"}, "ts": "2023-07-25 22:31:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9585423", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:32:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9585423", "type": "PubMed"}, "ts": "2023-07-25 22:32:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35550"}, "ts": "2023-07-25 22:32:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M8X9"}, "ts": "2023-07-25 22:32:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08462.550.550"}, "ts": "2023-07-25 22:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M8X9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54753", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:33:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54753"}, "ts": "2023-07-25 22:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:33:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLF7"}, "ts": "2023-07-25 22:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z4R1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:35:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z4R1"}, "ts": "2023-07-25 22:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ffzkhsjbctnfnh3zfu8lu6u6tvf0et8c", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 22:36:06 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ffzkhsjbctnfnh3zfu8lu6u6tvf0et8c", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-25 22:36:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14828"}, "ts": "2023-07-25 22:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14828", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:36:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCE7", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 22:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:36:19 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q9HCE7"}, "ts": "2023-07-25 22:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCE7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q9HCE7"}, "ts": "2023-07-25 22:36:20 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9121749aa5f29b05b740ac623edc1ffd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:36:22 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "9121749aa5f29b05b740ac623edc1ffd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:36:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCE7-1"}, "ts": "2023-07-25 22:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCE7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:36:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06280"}, "ts": "2023-07-25 22:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:37:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75717.387.387"}, "ts": "2023-07-25 22:38:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-25 22:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:39:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G38015EF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:39:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38015EF"}, "ts": "2023-07-25 22:39:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-25 22:39:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60843"}, "ts": "2023-07-25 22:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60843", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:40:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 22:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:40:30 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q9BXK5"}, "ts": "2023-07-25 22:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXK5", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q9BXK5"}, "ts": "2023-07-25 22:40:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3665c1999c5efd006ed0dd88500b0f4c", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:40:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3665c1999c5efd006ed0dd88500b0f4c", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXK5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:40:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXK5-1"}, "ts": "2023-07-25 22:40:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210"}, "ts": "2023-07-25 22:41:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35367.186.186"}, "ts": "2023-07-25 22:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35367", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:41:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18846", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18846"}, "ts": "2023-07-25 22:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4J2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:43:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z4J2.4.4"}, "ts": "2023-07-25 22:43:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-25 22:43:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25940", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:43:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25940.55.55"}, "ts": "2023-07-25 22:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M632", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:44:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M632"}, "ts": "2023-07-25 22:44:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14692", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:44:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14692.348.348"}, "ts": "2023-07-25 22:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6U6G5"}, "ts": "2023-07-25 22:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6U6G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5W0Z9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:44:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5W0Z9"}, "ts": "2023-07-25 22:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38445-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:45:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38445-1"}, "ts": "2023-07-25 22:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYW2"}, "ts": "2023-07-25 22:46:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYW2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:46:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XX4"}, "ts": "2023-07-25 22:46:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:46:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14145", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:46:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14145"}, "ts": "2023-07-25 22:46:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:47:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X78"}, "ts": "2023-07-25 22:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFX3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFX3"}, "ts": "2023-07-25 22:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYP7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:47:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYP7"}, "ts": "2023-07-25 22:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:47:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62967"}, "ts": "2023-07-25 22:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62967", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60750", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 22:47:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60750"}, "ts": "2023-07-25 22:47:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-25 22:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CV9", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 22:49:01 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q96CV9"}, "ts": "2023-07-25 22:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CV9", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q96CV9"}, "ts": "2023-07-25 22:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:49:03 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "96e46ecdfdaf5d0ddf047577da5cd256", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:49:05 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "96e46ecdfdaf5d0ddf047577da5cd256", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:49:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CV9-1"}, "ts": "2023-07-25 22:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CV9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12353073", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:49:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12353073", "type": "PubMed"}, "ts": "2023-07-25 22:49:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12126934", "type": "PubMed"}, "ts": "2023-07-25 22:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12126934", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00206-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00206-1"}, "ts": "2023-07-25 22:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32971", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:51:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32971.111.111"}, "ts": "2023-07-25 22:51:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00742"}, "ts": "2023-07-25 22:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:51:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27426725", "type": "PubMed"}, "ts": "2023-07-25 22:51:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27426725", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 22:52:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-25 22:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59538", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59538"}, "ts": "2023-07-25 22:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H221-1"}, "ts": "2023-07-25 22:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H221-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:52:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3YEC7.252.252"}, "ts": "2023-07-25 22:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3YEC7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:53:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00993"}, "ts": "2023-07-25 22:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00993", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13137", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 22:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:53:59 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Q13137"}, "ts": "2023-07-25 22:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 22:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13137", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Q13137"}, "ts": "2023-07-25 22:54:00 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 22:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d78404d9e2476c6e912cbe2c4a6496ef", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 22:54:01 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d78404d9e2476c6e912cbe2c4a6496ef", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 22:54:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13137-1"}, "ts": "2023-07-25 22:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13137-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:54:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-25 22:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:54:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42568"}, "ts": "2023-07-25 22:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00033MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 22:55:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-25 22:55:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09017", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:55:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09017"}, "ts": "2023-07-25 22:55:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:55:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97772"}, "ts": "2023-07-25 22:55:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMV9"}, "ts": "2023-07-25 22:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97772", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:56:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TB30"}, "ts": "2023-07-25 22:56:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-25 22:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:59:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5MCW4-1"}, "ts": "2023-07-25 22:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5MCW4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 22:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48066", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 22:59:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48066.299.299"}, "ts": "2023-07-25 22:59:48 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-25 23:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-25 23:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-25 23:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-25 23:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-25 23:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-25 23:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q658P3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:00:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q658P3.474.474"}, "ts": "2023-07-25 23:00:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-25 23:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3P7"}, "ts": "2023-07-25 23:01:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3P7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:01:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:01:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIG0"}, "ts": "2023-07-25 23:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:01:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-25 23:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SQSTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 23:01:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:01:55 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SQSTM1"}, "ts": "2023-07-25 23:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SQSTM1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SQSTM1"}, "ts": "2023-07-25 23:01:55 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-25 23:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b497a50d22f316fe21310c1231331e11", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-25 23:01:57 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b497a50d22f316fe21310c1231331e11", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-25 23:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q504Y2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:02:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q504Y2"}, "ts": "2023-07-25 23:02:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501-1"}, "ts": "2023-07-25 23:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81315DD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:02:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81315DD"}, "ts": "2023-07-25 23:02:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14672"}, "ts": "2023-07-25 23:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:03:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5G9"}, "ts": "2023-07-25 23:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:03:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86T13.330.330"}, "ts": "2023-07-25 23:03:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T13", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:03:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6N8"}, "ts": "2023-07-25 23:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GG9"}, "ts": "2023-07-25 23:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:06:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155-1"}, "ts": "2023-07-25 23:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32766"}, "ts": "2023-07-25 23:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20639862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:06:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20639862", "type": "PubMed"}, "ts": "2023-07-25 23:06:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-25 23:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:08:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23945"}, "ts": "2023-07-25 23:08:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "4952632", "type": "PubMed"}, "ts": "2023-07-25 23:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4952632", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:08:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JK39"}, "ts": "2023-07-25 23:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK39", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:08:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Atg", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-25 23:09:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:09:39 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Atg"}, "ts": "2023-07-25 23:09:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Atg", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Atg"}, "ts": "2023-07-25 23:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P1P4"}, "ts": "2023-07-25 23:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P1P4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Atg32", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-25 23:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:09:56 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Atg32"}, "ts": "2023-07-25 23:09:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:09:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Atg32", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Atg32"}, "ts": "2023-07-25 23:09:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-25 23:10:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23528"}, "ts": "2023-07-25 23:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Atg32", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-25 23:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:10:41 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Atg32"}, "ts": "2023-07-25 23:10:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-25 23:10:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Atg32", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Atg32"}, "ts": "2023-07-25 23:10:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZMS3-1"}, "ts": "2023-07-25 23:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZMS3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:11:11 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-25 23:11:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000034", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-25 23:11:23 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-25 23:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRQ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:11:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRQ2"}, "ts": "2023-07-25 23:11:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70208.1074.1074"}, "ts": "2023-07-25 23:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70208", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:11:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSD5"}, "ts": "2023-07-25 23:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CHP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:12:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CHP5"}, "ts": "2023-07-25 23:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:12:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21290RB"}, "ts": "2023-07-25 23:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:12:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2E9"}, "ts": "2023-07-25 23:12:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-25 23:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11201", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:12:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11201"}, "ts": "2023-07-25 23:12:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10716"}, "ts": "2023-07-25 23:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:13:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27421EI"}, "ts": "2023-07-25 23:13:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27421EI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:13:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27421EI"}, "ts": "2023-07-25 23:13:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21194PE"}, "ts": "2023-07-25 23:13:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-25 23:13:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14676HX"}, "ts": "2023-07-25 23:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:13:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2136732"}, "ts": "2023-07-25 23:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 23:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 23:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZI74", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:13:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZI74"}, "ts": "2023-07-25 23:13:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71TY3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:13:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71TY3"}, "ts": "2023-07-25 23:13:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UWN5.65.65"}, "ts": "2023-07-25 23:13:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWN5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:13:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U3Y9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:14:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U3Y9"}, "ts": "2023-07-25 23:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18434324", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:14:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18434324", "type": "PubMed"}, "ts": "2023-07-25 23:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMG0"}, "ts": "2023-07-25 23:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04466", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:15:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04466"}, "ts": "2023-07-25 23:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16233", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:16:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16233"}, "ts": "2023-07-25 23:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CC6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:16:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96CC6.462.462"}, "ts": "2023-07-25 23:16:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHI7.591.591"}, "ts": "2023-07-25 23:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHI7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:16:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14543-1"}, "ts": "2023-07-25 23:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37868ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21945940", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:16:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21945940", "type": "PubMed"}, "ts": "2023-07-25 23:16:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TM6"}, "ts": "2023-07-25 23:16:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:17:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P63128", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 23:17:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63128", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 23:17:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63128", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-25 23:17:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95071"}, "ts": "2023-07-25 23:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95071", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:17:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18077"}, "ts": "2023-07-25 23:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18077", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:17:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36363"}, "ts": "2023-07-25 23:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46459"}, "ts": "2023-07-25 23:18:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047-1.1024.1024"}, "ts": "2023-07-25 23:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11047-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:18:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LI72"}, "ts": "2023-07-25 23:18:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:18:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXE9"}, "ts": "2023-07-25 23:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "K9J6X0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:18:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "K9J6X0"}, "ts": "2023-07-25 23:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14672", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:19:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XKP0"}, "ts": "2023-07-25 23:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XKP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:19:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-25 23:19:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-25 23:20:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCP0"}, "ts": "2023-07-25 23:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCP0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:20:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23396"}, "ts": "2023-07-25 23:20:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V01"}, "ts": "2023-07-25 23:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZN1"}, "ts": "2023-07-25 23:21:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:21:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:21:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:21:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11277.767.767"}, "ts": "2023-07-25 23:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11277", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:21:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XKP0"}, "ts": "2023-07-25 23:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XKP0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZN1"}, "ts": "2023-07-25 23:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67870"}, "ts": "2023-07-25 23:22:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67870", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:22:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63474", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:22:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63474"}, "ts": "2023-07-25 23:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:22:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPX6.291.291"}, "ts": "2023-07-25 23:23:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPX6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:23:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22198669", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:23:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22198669", "type": "PubMed"}, "ts": "2023-07-25 23:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWF2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:23:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWF2"}, "ts": "2023-07-25 23:23:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ84-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZ84-1"}, "ts": "2023-07-25 23:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70994MS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:24:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-25 23:24:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 23:26:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:26:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18938DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23528", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:26:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.114.114"}, "ts": "2023-07-25 23:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:27:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12579WK"}, "ts": "2023-07-25 23:28:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06330"}, "ts": "2023-07-25 23:28:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 23:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:28:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-25 23:28:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:29:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-25 23:29:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12277"}, "ts": "2023-07-25 23:30:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12277"}, "ts": "2023-07-25 23:30:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60882"}, "ts": "2023-07-25 23:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:30:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-25 23:30:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8887485", "type": "PubMed"}, "ts": "2023-07-25 23:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8887485", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:30:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13323-1"}, "ts": "2023-07-25 23:31:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13323-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:31:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.191.191"}, "ts": "2023-07-25 23:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:31:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-25 23:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 23:31:36 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8TE60", "cluster_type": "unselected"}, "ts": "2023-07-25 23:31:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE60", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 23:31:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE60", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 23:31:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-25 23:31:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25789606", "type": "PubMed"}, "ts": "2023-07-25 23:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25789606", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54926"}, "ts": "2023-07-25 23:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14543-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54926", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:32:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25789606", "type": "PubMed"}, "ts": "2023-07-25 23:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25789606", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:32:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99848OC"}, "ts": "2023-07-25 23:32:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25789606", "type": "PubMed"}, "ts": "2023-07-25 23:33:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:33:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25789606", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:33:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63173"}, "ts": "2023-07-25 23:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4LFA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4LFA9"}, "ts": "2023-07-25 23:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66JY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:33:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583-1"}, "ts": "2023-07-25 23:33:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66JY6"}, "ts": "2023-07-25 23:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01583-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:33:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:34:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60477.369.369"}, "ts": "2023-07-25 23:34:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60477", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35030-1"}, "ts": "2023-07-25 23:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35030-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:34:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U4B4-1"}, "ts": "2023-07-25 23:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U4B4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:34:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAP2"}, "ts": "2023-07-25 23:34:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAP2"}, "ts": "2023-07-25 23:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18858"}, "ts": "2023-07-25 23:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QVP9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:35:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04071"}, "ts": "2023-07-25 23:35:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QVP9"}, "ts": "2023-07-25 23:35:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15508AW"}, "ts": "2023-07-25 23:35:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-25 23:36:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.114.114"}, "ts": "2023-07-25 23:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23396", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:36:36 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9QUM4", "cluster_type": "unselected"}, "ts": "2023-07-25 23:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUM4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 23:36:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.117.117"}, "ts": "2023-07-25 23:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUM4", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 23:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:37:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JC9"}, "ts": "2023-07-25 23:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:37:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-25 23:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80SS5-1"}, "ts": "2023-07-25 23:37:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80SS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:37:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T5A4"}, "ts": "2023-07-25 23:37:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T5A4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:37:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02091-1"}, "ts": "2023-07-25 23:38:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08254", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:38:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08254"}, "ts": "2023-07-25 23:38:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15052.564.564"}, "ts": "2023-07-25 23:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:39:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46013"}, "ts": "2023-07-25 23:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEZ7-1"}, "ts": "2023-07-25 23:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEZ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:40:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43307"}, "ts": "2023-07-25 23:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:40:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY64"}, "ts": "2023-07-25 23:40:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34333403", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:41:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34333403", "type": "PubMed"}, "ts": "2023-07-25 23:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34333403", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 23:41:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6T3"}, "ts": "2023-07-25 23:41:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6T3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:41:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BUV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:41:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BUV6"}, "ts": "2023-07-25 23:41:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70371"}, "ts": "2023-07-25 23:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70371", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-25 23:41:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-25 23:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BS31", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:41:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BS31.229.229"}, "ts": "2023-07-25 23:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXS5"}, "ts": "2023-07-25 23:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:42:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23416.350.350"}, "ts": "2023-07-25 23:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23416", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41217", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-25 23:43:34 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P41217", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-25 23:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41217", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 23:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVA1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:43:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVA1-1"}, "ts": "2023-07-25 23:43:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000006"}, "ts": "2023-07-25 23:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20141836", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:44:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20141836", "type": "PubMed"}, "ts": "2023-07-25 23:44:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:44:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULU4"}, "ts": "2023-07-25 23:45:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULU4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:45:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7619499", "type": "PubMed"}, "ts": "2023-07-25 23:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7619499", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60882", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2VCV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:46:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2VCV8"}, "ts": "2023-07-25 23:46:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:46:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTL9"}, "ts": "2023-07-25 23:46:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1L1L2"}, "ts": "2023-07-25 23:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L1L2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:47:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TP1"}, "ts": "2023-07-25 23:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31151"}, "ts": "2023-07-25 23:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TP1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29120", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:47:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29120.335.335"}, "ts": "2023-07-25 23:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01031-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:47:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-25 23:47:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:48:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGR2"}, "ts": "2023-07-25 23:48:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "8027558"}, "ts": "2023-07-25 23:49:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:49:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43497.1331.1331"}, "ts": "2023-07-25 23:50:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:50:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BTV4.328.328"}, "ts": "2023-07-25 23:50:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-25 23:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:51:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60547"}, "ts": "2023-07-25 23:51:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60547", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:51:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCW9"}, "ts": "2023-07-25 23:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18187566", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:51:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18187566", "type": "PubMed"}, "ts": "2023-07-25 23:51:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18187566", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 23:51:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3YZF7"}, "ts": "2023-07-25 23:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YZF7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:52:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34597997", "type": "PubMed"}, "ts": "2023-07-25 23:52:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34597997", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-25 23:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34597997", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-25 23:52:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30049"}, "ts": "2023-07-25 23:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30049", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:52:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-25 23:52:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZI8.181.181"}, "ts": "2023-07-25 23:52:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:53:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P62807.36.36"}, "ts": "2023-07-25 23:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62807", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:56:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D806"}, "ts": "2023-07-25 23:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D806", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8K7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:56:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8K7"}, "ts": "2023-07-25 23:56:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32971.190.190"}, "ts": "2023-07-25 23:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32971", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-25 23:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:57:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6L6"}, "ts": "2023-07-25 23:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:57:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51934ND"}, "ts": "2023-07-25 23:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51934ND", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-25 23:57:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3VQM3-1"}, "ts": "2023-07-25 23:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:58:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25106"}, "ts": "2023-07-25 23:58:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25106", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:58:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3VQM3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-25 23:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YX1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-25 23:58:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80YX1"}, "ts": "2023-07-25 23:58:25 EDT-0400"}]