[{"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 00:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 00:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 00:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 00:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 00:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 00:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A5X5Y0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:00:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A5X5Y0"}, "ts": "2023-07-14 00:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27031383", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:00:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27031383", "type": "PubMed"}, "ts": "2023-07-14 00:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB29"}, "ts": "2023-07-14 00:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75UR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:01:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75UR0"}, "ts": "2023-07-14 00:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:01:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:01:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20061"}, "ts": "2023-07-14 00:01:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11171.85.85"}, "ts": "2023-07-14 00:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11171", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:01:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-14 00:01:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47748JZ"}, "ts": "2023-07-14 00:01:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-14 00:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-14 00:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 00:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-14 00:01:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P97432-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 00:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97432-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 00:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21220098", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:02:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21220098", "type": "PubMed"}, "ts": "2023-07-14 00:02:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15998779", "type": "PubMed"}, "ts": "2023-07-14 00:02:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15998779", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:02:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09693"}, "ts": "2023-07-14 00:02:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09693", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:02:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CXK8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:03:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CXK8"}, "ts": "2023-07-14 00:03:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:03:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17858.770.770"}, "ts": "2023-07-14 00:03:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12931", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12931"}, "ts": "2023-07-14 00:03:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23458.108.108"}, "ts": "2023-07-14 00:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23458", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:05:54 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 00:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:05:54 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 00:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:05:54 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": ").", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 00:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "error", "page": "glycan-search", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-14 00:05:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63881.575.575"}, "ts": "2023-07-14 00:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63881", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MV24"}, "ts": "2023-07-14 00:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MV24", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:06:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23474986", "type": "PubMed"}, "ts": "2023-07-14 00:06:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23474986", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:06:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBC3"}, "ts": "2023-07-14 00:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6Z4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:07:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6Z4"}, "ts": "2023-07-14 00:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:07:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "12899622"}, "ts": "2023-07-14 00:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:08:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Q1.614.614"}, "ts": "2023-07-14 00:08:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10408784", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:08:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10408784", "type": "PubMed"}, "ts": "2023-07-14 00:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53GQ0"}, "ts": "2023-07-14 00:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53GQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE28", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:09:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NE28.198.198"}, "ts": "2023-07-14 00:09:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53446FI"}, "ts": "2023-07-14 00:09:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53446FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 00:09:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GQ7"}, "ts": "2023-07-14 00:09:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:10:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CWR8"}, "ts": "2023-07-14 00:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CWR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:10:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97805"}, "ts": "2023-07-14 00:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75880", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:10:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75880.25.25"}, "ts": "2023-07-14 00:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:10:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW08"}, "ts": "2023-07-14 00:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15762"}, "ts": "2023-07-14 00:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15762", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60765"}, "ts": "2023-07-14 00:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:12:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40190.477.477"}, "ts": "2023-07-14 00:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40190", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60674", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60674"}, "ts": "2023-07-14 00:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BIH0"}, "ts": "2023-07-14 00:14:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BIH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKC6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:14:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKC6"}, "ts": "2023-07-14 00:14:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MIW9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:14:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3MIW9.76.76"}, "ts": "2023-07-14 00:14:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:15:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UY5.362.362"}, "ts": "2023-07-14 00:15:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55211.99.99"}, "ts": "2023-07-14 00:15:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55211", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:15:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:15:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17858.246.246"}, "ts": "2023-07-14 00:15:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34294787", "type": "PubMed"}, "ts": "2023-07-14 00:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34294787", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7K7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:16:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7K7-1"}, "ts": "2023-07-14 00:16:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31306055", "type": "PubMed"}, "ts": "2023-07-14 00:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31306055", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H426"}, "ts": "2023-07-14 00:16:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H426", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6V0-5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:17:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6V0-5"}, "ts": "2023-07-14 00:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:17:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06481.750.750"}, "ts": "2023-07-14 00:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2P6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:17:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2P6-1"}, "ts": "2023-07-14 00:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12716890", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:18:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12716890", "type": "PubMed"}, "ts": "2023-07-14 00:18:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68366"}, "ts": "2023-07-14 00:18:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68366", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39748", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:19:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39748.303.303"}, "ts": "2023-07-14 00:19:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H4Q4.286.286"}, "ts": "2023-07-14 00:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4Q4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70SY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:19:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q70SY1"}, "ts": "2023-07-14 00:19:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9452111", "type": "PubMed"}, "ts": "2023-07-14 00:20:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9452111", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:20:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99933-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:21:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99933-1"}, "ts": "2023-07-14 00:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:21:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBP4"}, "ts": "2023-07-14 00:21:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJU6"}, "ts": "2023-07-14 00:22:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJU6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:22:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22859821", "type": "PubMed"}, "ts": "2023-07-14 00:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22859821", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:22:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23327-1"}, "ts": "2023-07-14 00:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23327-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12235145", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:23:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12235145", "type": "PubMed"}, "ts": "2023-07-14 00:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:24:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXN9"}, "ts": "2023-07-14 00:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82930", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:24:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82930"}, "ts": "2023-07-14 00:24:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNF0"}, "ts": "2023-07-14 00:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:25:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04275.1263.1263"}, "ts": "2023-07-14 00:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:25:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97710-1"}, "ts": "2023-07-14 00:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97710-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHC7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:26:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHC7"}, "ts": "2023-07-14 00:26:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4LDE5.1176.1176"}, "ts": "2023-07-14 00:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4LDE5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2108441", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:26:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2108441", "type": "PubMed"}, "ts": "2023-07-14 00:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6I8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:26:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6I8"}, "ts": "2023-07-14 00:26:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14108.153.153"}, "ts": "2023-07-14 00:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14108", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:26:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYC2"}, "ts": "2023-07-14 00:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPX8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:26:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPX8-1"}, "ts": "2023-07-14 00:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95528", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:26:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95528.334.334"}, "ts": "2023-07-14 00:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07498"}, "ts": "2023-07-14 00:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08999", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:27:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08999.662.662"}, "ts": "2023-07-14 00:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7B0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:27:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z7B0.542.542"}, "ts": "2023-07-14 00:27:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BLN5-1"}, "ts": "2023-07-14 00:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BLN5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:28:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:28:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEI8"}, "ts": "2023-07-14 00:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J265", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:28:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A0B4J265.40.40"}, "ts": "2023-07-14 00:28:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3X1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3X1"}, "ts": "2023-07-14 00:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13395", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:31:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13395.1407.1407"}, "ts": "2023-07-14 00:31:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15541", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 00:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 00:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-14 00:31:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10068037", "type": "PubMed"}, "ts": "2023-07-14 00:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10068037", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TF21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:32:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TF21"}, "ts": "2023-07-14 00:32:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.358.358"}, "ts": "2023-07-14 00:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25378657", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:35:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25378657", "type": "PubMed"}, "ts": "2023-07-14 00:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:35:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51610.1239.1239"}, "ts": "2023-07-14 00:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54910-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:35:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54910-1"}, "ts": "2023-07-14 00:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91W78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:37:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91W78"}, "ts": "2023-07-14 00:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47929", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:37:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47929.82.82"}, "ts": "2023-07-14 00:37:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "A6NDL7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 00:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NDL7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 00:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 00:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JXU5"}, "ts": "2023-07-14 00:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JXU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NDL7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-14 00:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16645022", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:39:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16645022", "type": "PubMed"}, "ts": "2023-07-14 00:39:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00746"}, "ts": "2023-07-14 00:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00746", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:39:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZG09"}, "ts": "2023-07-14 00:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZG09", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50554", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:40:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50554"}, "ts": "2023-07-14 00:40:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76024", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:40:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O76024.138.138"}, "ts": "2023-07-14 00:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00571"}, "ts": "2023-07-14 00:40:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00571"}, "ts": "2023-07-14 00:40:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00688"}, "ts": "2023-07-14 00:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1KZ92", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:41:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A1KZ92.493.493"}, "ts": "2023-07-14 00:41:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48960", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:41:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48960.265.265"}, "ts": "2023-07-14 00:41:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15389-1"}, "ts": "2023-07-14 00:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15389-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:41:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69892", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:42:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P69892.13.13"}, "ts": "2023-07-14 00:42:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33954185", "type": "PubMed"}, "ts": "2023-07-14 00:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33954185", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:42:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33854173", "type": "PubMed"}, "ts": "2023-07-14 00:42:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33854173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:42:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33854173", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 00:42:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z0T9.97.97"}, "ts": "2023-07-14 00:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0T9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41219", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:43:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41219.100.100"}, "ts": "2023-07-14 00:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26727489", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:43:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26727489", "type": "PubMed"}, "ts": "2023-07-14 00:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MZW2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:43:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6MZW2.318.318"}, "ts": "2023-07-14 00:43:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:43:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54318"}, "ts": "2023-07-14 00:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54318", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13569", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13569"}, "ts": "2023-07-14 00:43:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19934039", "type": "PubMed"}, "ts": "2023-07-14 00:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19934039", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:43:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MUK1"}, "ts": "2023-07-14 00:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MUK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:44:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3164476", "type": "PubMed"}, "ts": "2023-07-14 00:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3164476", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60602", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:44:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60602.37.37"}, "ts": "2023-07-14 00:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:44:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15052.484.484"}, "ts": "2023-07-14 00:44:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94901"}, "ts": "2023-07-14 00:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94901", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:45:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14982"}, "ts": "2023-07-14 00:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14982", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3B9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:46:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y3B9.67.67"}, "ts": "2023-07-14 00:46:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPC7.605.605"}, "ts": "2023-07-14 00:46:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:46:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPC7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BQ86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:47:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BQ86"}, "ts": "2023-07-14 00:47:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27274"}, "ts": "2023-07-14 00:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27274", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:47:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FW52-1"}, "ts": "2023-07-14 00:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FW52-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:48:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08473"}, "ts": "2023-07-14 00:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08473", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:48:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49959.403.403"}, "ts": "2023-07-14 00:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50575-1"}, "ts": "2023-07-14 00:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15404", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:48:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15404"}, "ts": "2023-07-14 00:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50575-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:49:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61711"}, "ts": "2023-07-14 00:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:49:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VX5"}, "ts": "2023-07-14 00:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88703", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:50:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88703.119.119"}, "ts": "2023-07-14 00:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2R6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:51:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z2R6.41.41"}, "ts": "2023-07-14 00:51:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1696731", "type": "PubMed"}, "ts": "2023-07-14 00:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1696731", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK81", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:51:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PK81.22.22"}, "ts": "2023-07-14 00:51:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P5G3"}, "ts": "2023-07-14 00:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P5G3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:51:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19876"}, "ts": "2023-07-14 00:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:51:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACA6"}, "ts": "2023-07-14 00:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:52:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92832.40.40"}, "ts": "2023-07-14 00:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92832", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS84-1"}, "ts": "2023-07-14 00:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS84-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:53:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21892158", "type": "PubMed"}, "ts": "2023-07-14 00:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21892158", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:53:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBH1.172.172"}, "ts": "2023-07-14 00:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:53:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33631610", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:53:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33631610", "type": "PubMed"}, "ts": "2023-07-14 00:53:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24445538", "type": "PubMed"}, "ts": "2023-07-14 00:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24445538", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BR21", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:53:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BR21"}, "ts": "2023-07-14 00:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 00:54:12 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 00:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:54:13 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 00:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19909832", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:54:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19909832", "type": "PubMed"}, "ts": "2023-07-14 00:54:23 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(2)HexNAc(4)NeuAc(4)", "term_category": "any"}, "ts": "2023-07-14 00:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 00:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">3aeda93646c57bafb8ab113a5da98a03", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(2)HexNAc(4)NeuAc(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 00:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3aeda93646c57bafb8ab113a5da98a03", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 00:55:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3aeda93646c57bafb8ab113a5da98a03", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 00:55:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25459WN"}, "ts": "2023-07-14 00:55:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02244ID"}, "ts": "2023-07-14 00:55:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02860LZ"}, "ts": "2023-07-14 00:55:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81371RJ"}, "ts": "2023-07-14 00:55:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99632DB"}, "ts": "2023-07-14 00:55:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55698SS"}, "ts": "2023-07-14 00:55:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36045MZ"}, "ts": "2023-07-14 00:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25459WN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 00:55:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25459WN"}, "ts": "2023-07-14 00:55:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22643ZM"}, "ts": "2023-07-14 00:55:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 00:55:26 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 00:55:26 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 00:55:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:55:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 00:55:27 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(2)HexNAc(1)NeuAc(4)", "term_category": "any"}, "ts": "2023-07-14 00:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 00:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(2)HexNAc(1)NeuAc(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 00:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58896AZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 00:55:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58896AZ"}, "ts": "2023-07-14 00:55:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75954"}, "ts": "2023-07-14 00:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75954", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:56:36 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(2)HexNAc(1)NeuGc(4)", "term_category": "any"}, "ts": "2023-07-14 00:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 00:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(2)HexNAc(1)NeuGc(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 00:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28938432", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:57:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28938432", "type": "PubMed"}, "ts": "2023-07-14 00:57:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGI6"}, "ts": "2023-07-14 00:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGI6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:57:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZS1"}, "ts": "2023-07-14 00:58:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZS1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 00:58:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23944.60.60"}, "ts": "2023-07-14 00:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23944", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05193", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:58:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05193.695.695"}, "ts": "2023-07-14 00:58:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14974.578.578"}, "ts": "2023-07-14 00:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14974", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 00:58:55 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(1)NeuGc(5)", "term_category": "any"}, "ts": "2023-07-14 00:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 00:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(1)NeuGc(5)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 00:59:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2F8"}, "ts": "2023-07-14 00:59:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2F8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 00:59:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25216327", "type": "PubMed"}, "ts": "2023-07-14 00:59:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25216327", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 00:59:57 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 01:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 01:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 01:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 01:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 01:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 01:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6W8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:00:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6W8.91.91"}, "ts": "2023-07-14 01:00:09 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(6)", "term_category": "any"}, "ts": "2023-07-14 01:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 01:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">d6d9c7d948851b73f31156e8d98aec53", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(6)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 01:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d6d9c7d948851b73f31156e8d98aec53", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:01:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d6d9c7d948851b73f31156e8d98aec53", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 01:01:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-14 01:01:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79809MM"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89877QI"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45209NR"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33241WC"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17168RO"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78030KJ"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65890UA"}, "ts": "2023-07-14 01:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d6d9c7d948851b73f31156e8d98aec53", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:01:12 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d6d9c7d948851b73f31156e8d98aec53", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:01:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50755IT"}, "ts": "2023-07-14 01:01:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53303ZX"}, "ts": "2023-07-14 01:01:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01464ES"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23193CN"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76154QC"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78790NZ"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02452RJ"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08772WL"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25733QB"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17454VN"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89854YO"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19121KH"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35319OJ"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28649NI"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10341DR"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01714TP"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80518RB"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12709VH"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49906RN"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87416MP"}, "ts": "2023-07-14 01:01:14 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d6d9c7d948851b73f31156e8d98aec53", "offset": 1, "sort": "hit_score", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:01:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03018QF"}, "ts": "2023-07-14 01:01:22 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d6d9c7d948851b73f31156e8d98aec53", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:01:23 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d6d9c7d948851b73f31156e8d98aec53", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8M5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:01:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H8M5.112.112"}, "ts": "2023-07-14 01:01:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P82673.203.203"}, "ts": "2023-07-14 01:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15911", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:02:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15911.919.919"}, "ts": "2023-07-14 01:02:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWZ1.44.44"}, "ts": "2023-07-14 01:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWZ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:02:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:02:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZZ1"}, "ts": "2023-07-14 01:02:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 01:02:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20008512", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:03:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20008512", "type": "PubMed"}, "ts": "2023-07-14 01:03:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62328"}, "ts": "2023-07-14 01:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62328", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9373149", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:04:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9373149", "type": "PubMed"}, "ts": "2023-07-14 01:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X46-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X46-1"}, "ts": "2023-07-14 01:05:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31513549", "type": "PubMed"}, "ts": "2023-07-14 01:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31513549", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 01:05:42 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 01:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:05:43 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 01:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 01:06:00 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(1)HexNAc(2)dHex(1)NeuAc(2)", "term_category": "any"}, "ts": "2023-07-14 01:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">ff44a59b5b2cce65d0567d0f433b6069", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(1)HexNAc(2)dHex(1)NeuAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 01:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ff44a59b5b2cce65d0567d0f433b6069", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:06:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ff44a59b5b2cce65d0567d0f433b6069", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 01:06:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315BS"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64712UU"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40737EA"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71121NN"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43220WQ"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85366AQ"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43648PG"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66162WI"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07641UW"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13585VS"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16269RR"}, "ts": "2023-07-14 01:06:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33772BZ"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48367ZH"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64965PX"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55925YH"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20176SH"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32853SP"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91084QX"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87051PY"}, "ts": "2023-07-14 01:06:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ff44a59b5b2cce65d0567d0f433b6069", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:06:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ff44a59b5b2cce65d0567d0f433b6069", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:06:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35749JN"}, "ts": "2023-07-14 01:06:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94510EL"}, "ts": "2023-07-14 01:06:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12510ID"}, "ts": "2023-07-14 01:06:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25024JR"}, "ts": "2023-07-14 01:06:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13885FQ"}, "ts": "2023-07-14 01:06:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66917BW"}, "ts": "2023-07-14 01:06:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13260WK"}, "ts": "2023-07-14 01:06:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37827QF"}, "ts": "2023-07-14 01:06:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83415OS"}, "ts": "2023-07-14 01:06:14 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ff44a59b5b2cce65d0567d0f433b6069", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:06:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10508JF"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26400XV"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90089OR"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69041CZ"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25322NY"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36944VG"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83831AS"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36431RU"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05690OR"}, "ts": "2023-07-14 01:06:17 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ff44a59b5b2cce65d0567d0f433b6069", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:06:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13488-1"}, "ts": "2023-07-14 01:06:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53457WM"}, "ts": "2023-07-14 01:06:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01476LL"}, "ts": "2023-07-14 01:06:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43375FB"}, "ts": "2023-07-14 01:06:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57543JK"}, "ts": "2023-07-14 01:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13488-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66162WI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:06:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66162WI"}, "ts": "2023-07-14 01:06:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-14 01:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28769WQ"}, "ts": "2023-07-14 01:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-14 01:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-14 01:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:07:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEF2"}, "ts": "2023-07-14 01:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:07:47 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 01:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:07:47 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(2)HexNAc(2)dHex(1)NeuAc(6)", "term_category": "any"}, "ts": "2023-07-14 01:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 01:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(2)HexNAc(2)dHex(1)NeuAc(6)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 01:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:08:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-14 01:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923W4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:09:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923W4-1"}, "ts": "2023-07-14 01:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ABB2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ABB2-1"}, "ts": "2023-07-14 01:09:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12960.457.457"}, "ts": "2023-07-14 01:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12960", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:09:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55265"}, "ts": "2023-07-14 01:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55265", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BIV7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:10:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BIV7-1"}, "ts": "2023-07-14 01:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 01:10:55 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(4)HexNAc(5)", "term_category": "any"}, "ts": "2023-07-14 01:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">3a9518b4afddce5e6523f61ed96b071d", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(4)HexNAc(5)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 01:10:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3a9518b4afddce5e6523f61ed96b071d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 01:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3a9518b4afddce5e6523f61ed96b071d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:10:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85767HW"}, "ts": "2023-07-14 01:10:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-14 01:10:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24413UY"}, "ts": "2023-07-14 01:10:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43346PX"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10258MC"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32659RY"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11535IB"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88417ED"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25835MT"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53985AY"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54956ME"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38217AM"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82753OZ"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10820KD"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96063MG"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67942CH"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78890OB"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43299SD"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36581MF"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80578OK"}, "ts": "2023-07-14 01:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3a9518b4afddce5e6523f61ed96b071d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:10:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3a9518b4afddce5e6523f61ed96b071d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:10:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54612UD"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95977AE"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37412TK"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70418MS"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81198YO"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95835XS"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70087PV"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19379ID"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65807AE"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56427WT"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77136XW"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59930AW"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60461BM"}, "ts": "2023-07-14 01:11:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17667YX"}, "ts": "2023-07-14 01:11:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75376YT"}, "ts": "2023-07-14 01:11:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44236OL"}, "ts": "2023-07-14 01:11:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92179IH"}, "ts": "2023-07-14 01:11:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07405CY"}, "ts": "2023-07-14 01:11:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09367JM"}, "ts": "2023-07-14 01:11:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4A3"}, "ts": "2023-07-14 01:11:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3a9518b4afddce5e6523f61ed96b071d", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34989PA"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02161CI"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74632SL"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96576WB"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70048IK"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92803WT"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14955CK"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84821OV"}, "ts": "2023-07-14 01:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59544AR"}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10119AX"}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3a9518b4afddce5e6523f61ed96b071d", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58954YZ"}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83192EO"}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35218UM"}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00895EF"}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20785YF"}, "ts": "2023-07-14 01:11:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8037205", "type": "PubMed"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99725YQ"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02985MG"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79667NI"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18603ZQ"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21147BK"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17346NI"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98200VV"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8037205", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07755XJ"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22970UG"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24303LM"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77633IZ"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94817WU"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98383AS"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78757VY"}, "ts": "2023-07-14 01:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CHI8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:11:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CHI8-1"}, "ts": "2023-07-14 01:11:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95428"}, "ts": "2023-07-14 01:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJT7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:11:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PJT7.360.360"}, "ts": "2023-07-14 01:11:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9845361", "type": "PubMed"}, "ts": "2023-07-14 01:12:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9845361", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:12:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:12:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63553", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:12:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63553"}, "ts": "2023-07-14 01:12:10 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 01:12:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:12:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15116"}, "ts": "2023-07-14 01:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 01:12:27 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(5)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-14 01:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(5)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 01:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:12:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 01:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:12:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 01:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7604266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:12:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7604266", "type": "PubMed"}, "ts": "2023-07-14 01:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0C5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:12:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5I0C5"}, "ts": "2023-07-14 01:12:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02774"}, "ts": "2023-07-14 01:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02774", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:13:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-14 01:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969G6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 01:13:31 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q969G6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 01:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 01:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:13:59 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 01:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:13:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-14 01:14:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62484"}, "ts": "2023-07-14 01:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 01:14:17 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(3)HexNAc(6)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-14 01:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b4c2bde6d1b5f1b8b1282a9355358ae8", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(3)HexNAc(6)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 01:14:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b4c2bde6d1b5f1b8b1282a9355358ae8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 01:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b4c2bde6d1b5f1b8b1282a9355358ae8", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-14 01:14:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27058447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:14:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27058447", "type": "PubMed"}, "ts": "2023-07-14 01:14:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09467"}, "ts": "2023-07-14 01:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09467", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:15:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46455GO"}, "ts": "2023-07-14 01:15:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73418FX"}, "ts": "2023-07-14 01:15:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00743WU"}, "ts": "2023-07-14 01:15:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81877PA"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48848IF"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75269BP"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64706DG"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58268WC"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30542PN"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62866HT"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02473HY"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46945LQ"}, "ts": "2023-07-14 01:15:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59149SL"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57084IU"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76225JQ"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98549NZ"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58932AD"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01522FD"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52776UT"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92337QR"}, "ts": "2023-07-14 01:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVK6"}, "ts": "2023-07-14 01:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:15:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8G8"}, "ts": "2023-07-14 01:15:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-14 01:15:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 01:15:36 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 01:15:36 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 01:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 01:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 01:15:45 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(6)HexNAc(4)", "term_category": "any"}, "ts": "2023-07-14 01:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1e4c1cf453fc6507046a0c80493c6bb9", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(6)HexNAc(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 01:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1e4c1cf453fc6507046a0c80493c6bb9", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 01:15:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1e4c1cf453fc6507046a0c80493c6bb9", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 01:15:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86555OF"}, "ts": "2023-07-14 01:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87535DG"}, "ts": "2023-07-14 01:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08242BT"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23824AT"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82955EQ"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49299ZV"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73408MO"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95198OA"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99610EG"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82388RB"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20113TH"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35952BG"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08673AT"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84908OR"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36701GV"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89058RF"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19615BB"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11509RN"}, "ts": "2023-07-14 01:15:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08502EX"}, "ts": "2023-07-14 01:15:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91511MZ"}, "ts": "2023-07-14 01:15:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96370VA"}, "ts": "2023-07-14 01:16:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-14 01:16:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04166"}, "ts": "2023-07-14 01:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04166", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:17:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-14 01:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:17:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08575.997.997"}, "ts": "2023-07-14 01:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08642-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:17:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08642-1"}, "ts": "2023-07-14 01:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z304", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:17:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z304.381.381"}, "ts": "2023-07-14 01:17:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N130.299.299"}, "ts": "2023-07-14 01:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N130", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:18:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15300854", "type": "PubMed"}, "ts": "2023-07-14 01:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15300854", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3D3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:18:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3D3"}, "ts": "2023-07-14 01:18:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q1WIM2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:18:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q1WIM2"}, "ts": "2023-07-14 01:18:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16665"}, "ts": "2023-07-14 01:19:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-14 01:19:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:19:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7689224", "type": "PubMed"}, "ts": "2023-07-14 01:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7689224", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97412", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97412"}, "ts": "2023-07-14 01:21:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VH1"}, "ts": "2023-07-14 01:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:21:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61451"}, "ts": "2023-07-14 01:22:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:22:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAV4"}, "ts": "2023-07-14 01:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:23:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33795637", "type": "PubMed"}, "ts": "2023-07-14 01:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75386-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33795637", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:23:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75386-1"}, "ts": "2023-07-14 01:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33795637", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 01:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:23:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-14 01:23:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11087-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:25:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11087-1"}, "ts": "2023-07-14 01:25:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01033-1"}, "ts": "2023-07-14 01:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16764853", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:25:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16764853", "type": "PubMed"}, "ts": "2023-07-14 01:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1V9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:26:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHD8.38.38"}, "ts": "2023-07-14 01:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHD8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:26:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:26:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21860.250.250"}, "ts": "2023-07-14 01:26:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGX3"}, "ts": "2023-07-14 01:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGX3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:27:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3G9"}, "ts": "2023-07-14 01:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3G9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60938", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 01:27:34 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O60938", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 01:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60938", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-14 01:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-14 01:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:27:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6C2.65.65"}, "ts": "2023-07-14 01:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6C2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:27:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51805.585.585"}, "ts": "2023-07-14 01:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51805", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYG0"}, "ts": "2023-07-14 01:28:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4X1"}, "ts": "2023-07-14 01:28:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:28:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZTR7"}, "ts": "2023-07-14 01:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZTR7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:29:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKP5.529.529"}, "ts": "2023-07-14 01:29:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:29:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62484", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:30:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10716"}, "ts": "2023-07-14 01:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H943"}, "ts": "2023-07-14 01:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:31:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36159AI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36159AI", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 01:31:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9675246", "type": "PubMed"}, "ts": "2023-07-14 01:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9675246", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:32:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14609"}, "ts": "2023-07-14 01:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14609", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:32:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08572", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:32:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08572"}, "ts": "2023-07-14 01:32:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2K2"}, "ts": "2023-07-14 01:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2K2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:32:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96370VA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:32:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZT9"}, "ts": "2023-07-14 01:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26255772", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:33:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26255772", "type": "PubMed"}, "ts": "2023-07-14 01:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK10", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:34:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK10"}, "ts": "2023-07-14 01:34:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UM11.36.36"}, "ts": "2023-07-14 01:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM11", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:34:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31424", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:34:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31424.88.88"}, "ts": "2023-07-14 01:34:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B6SEH9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:34:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B6SEH9.474.474"}, "ts": "2023-07-14 01:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16665", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34384670", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:35:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34384670", "type": "PubMed"}, "ts": "2023-07-14 01:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZI44-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZI44-1"}, "ts": "2023-07-14 01:35:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-14 01:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19696745", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:36:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19696745", "type": "PubMed"}, "ts": "2023-07-14 01:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01579", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:36:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01579.122.122"}, "ts": "2023-07-14 01:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14616", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:36:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14616.898.898"}, "ts": "2023-07-14 01:36:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22272"}, "ts": "2023-07-14 01:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22272", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:37:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07321"}, "ts": "2023-07-14 01:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07321", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:37:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8900089", "type": "PubMed"}, "ts": "2023-07-14 01:38:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8900089", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:38:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62318"}, "ts": "2023-07-14 01:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62318", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:40:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 01:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCE0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:40:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCE0.241.241"}, "ts": "2023-07-14 01:40:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00738.241.241"}, "ts": "2023-07-14 01:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00738", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:40:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12767-1"}, "ts": "2023-07-14 01:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12767-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H694", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:41:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H694.937.937"}, "ts": "2023-07-14 01:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:41:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39213VZ"}, "ts": "2023-07-14 01:41:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39213VZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:41:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68EA5"}, "ts": "2023-07-14 01:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68EA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YI28"}, "ts": "2023-07-14 01:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YI28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:41:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:41:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92859.1194.1194"}, "ts": "2023-07-14 01:42:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92859", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:42:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2M0"}, "ts": "2023-07-14 01:42:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2M0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:42:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26101352", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:43:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26101352", "type": "PubMed"}, "ts": "2023-07-14 01:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22735451", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:43:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22735451", "type": "PubMed"}, "ts": "2023-07-14 01:43:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "36288343", "type": "PubMed"}, "ts": "2023-07-14 01:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "36288343", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:43:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-14 01:44:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q77", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:44:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96Q77.3.3"}, "ts": "2023-07-14 01:44:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09022-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 01:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09022-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 01:44:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96MN2.708.708"}, "ts": "2023-07-14 01:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MN2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C739", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:44:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8C739.234.234"}, "ts": "2023-07-14 01:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:45:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46695"}, "ts": "2023-07-14 01:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:45:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14563.552.552"}, "ts": "2023-07-14 01:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14563", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:45:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-14 01:45:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3URQ4"}, "ts": "2023-07-14 01:45:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3URQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:46:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PJG2.227.227"}, "ts": "2023-07-14 01:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJG2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:46:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35225"}, "ts": "2023-07-14 01:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:46:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:47:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQD8"}, "ts": "2023-07-14 01:47:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75951"}, "ts": "2023-07-14 01:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75951", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:47:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C7I0"}, "ts": "2023-07-14 01:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7I0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:47:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PZ7"}, "ts": "2023-07-14 01:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PZ7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06683", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06683"}, "ts": "2023-07-14 01:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZI7"}, "ts": "2023-07-14 01:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJX3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:48:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJX3.66.66"}, "ts": "2023-07-14 01:48:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:49:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25421750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:49:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25421750", "type": "PubMed"}, "ts": "2023-07-14 01:49:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12894857", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:49:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12894857", "type": "PubMed"}, "ts": "2023-07-14 01:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59808", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:49:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P59808.813.813"}, "ts": "2023-07-14 01:49:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05186.430.430"}, "ts": "2023-07-14 01:49:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05186", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:49:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19033661", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:49:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19033661", "type": "PubMed"}, "ts": "2023-07-14 01:49:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTR6-1"}, "ts": "2023-07-14 01:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTR6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:50:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13069"}, "ts": "2023-07-14 01:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP64-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EP64-1"}, "ts": "2023-07-14 01:50:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7539425", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:50:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7539425", "type": "PubMed"}, "ts": "2023-07-14 01:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61289"}, "ts": "2023-07-14 01:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61289", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MN2-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:51:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96MN2-1.606.606"}, "ts": "2023-07-14 01:51:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08413-1.287.287"}, "ts": "2023-07-14 01:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08413-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30415267", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:51:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30415267", "type": "PubMed"}, "ts": "2023-07-14 01:51:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30415267", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 01:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A935", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:51:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A935"}, "ts": "2023-07-14 01:51:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1829116", "type": "PubMed"}, "ts": "2023-07-14 01:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1829116", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:51:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62491"}, "ts": "2023-07-14 01:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62491", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVK1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:51:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UVK1.121.121"}, "ts": "2023-07-14 01:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PPM7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:51:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PPM7"}, "ts": "2023-07-14 01:51:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-14 01:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BRG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:52:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BRG6"}, "ts": "2023-07-14 01:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54907"}, "ts": "2023-07-14 01:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08146BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:52:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03756VW"}, "ts": "2023-07-14 01:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03756VW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UQ44", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:53:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UQ44"}, "ts": "2023-07-14 01:53:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23434"}, "ts": "2023-07-14 01:54:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01756"}, "ts": "2023-07-14 01:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:54:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2M8"}, "ts": "2023-07-14 01:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2M8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:55:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01019.466.466"}, "ts": "2023-07-14 01:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67809", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:55:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P67809.158.158"}, "ts": "2023-07-14 01:55:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60953.536.536"}, "ts": "2023-07-14 01:55:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60953", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00238"}, "ts": "2023-07-14 01:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-14 01:56:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35590.603.603"}, "ts": "2023-07-14 01:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35590", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48414YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 01:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53609-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:56:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53609-1"}, "ts": "2023-07-14 01:56:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-14 01:56:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WTH5-1"}, "ts": "2023-07-14 01:57:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WTH5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:57:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95747-1.331.331"}, "ts": "2023-07-14 01:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95747-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92820"}, "ts": "2023-07-14 01:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92820", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:57:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-14 01:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28827", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:57:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28827.430.430"}, "ts": "2023-07-14 01:57:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGU5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 01:57:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGU5"}, "ts": "2023-07-14 01:57:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63618.531.531"}, "ts": "2023-07-14 01:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63618", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10707987", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 01:58:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10707987", "type": "PubMed"}, "ts": "2023-07-14 01:58:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VST9.722.722"}, "ts": "2023-07-14 01:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VST9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:58:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09022-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 01:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 01:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09022-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 01:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13371", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 01:59:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13371.68.68"}, "ts": "2023-07-14 01:59:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85767HW"}, "ts": "2023-07-14 01:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:59:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ65"}, "ts": "2023-07-14 01:59:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "H7BZ55"}, "ts": "2023-07-14 01:59:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-14 01:59:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "H7BZ55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:59:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 01:59:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:00:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42226.723.723"}, "ts": "2023-07-14 02:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 02:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 02:00:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04920", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 02:00:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04920.590.590"}, "ts": "2023-07-14 02:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 02:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 02:00:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22207760", "type": "PubMed"}, "ts": "2023-07-14 02:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 02:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22207760", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:00:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9657148", "type": "PubMed"}, "ts": "2023-07-14 02:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9657148", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A9G5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:00:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A9G5-1"}, "ts": "2023-07-14 02:00:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14841-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TC92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:01:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TC92"}, "ts": "2023-07-14 02:01:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15379"}, "ts": "2023-07-14 02:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16695", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:01:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16695.39.39"}, "ts": "2023-07-14 02:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0X4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:01:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5I0X4"}, "ts": "2023-07-14 02:01:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34323105", "type": "PubMed"}, "ts": "2023-07-14 02:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34323105", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:01:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NT68"}, "ts": "2023-07-14 02:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NT68", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 02:01:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11171", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:01:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11171.539.539"}, "ts": "2023-07-14 02:01:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41806QY"}, "ts": "2023-07-14 02:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41806QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:01:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X5"}, "ts": "2023-07-14 02:02:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15471852", "type": "PubMed"}, "ts": "2023-07-14 02:02:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T6X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:02:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15471852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:02:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25101980", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:02:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25101980", "type": "PubMed"}, "ts": "2023-07-14 02:02:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04350.269.269"}, "ts": "2023-07-14 02:02:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04350", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21825151", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:03:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21825151", "type": "PubMed"}, "ts": "2023-07-14 02:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56485", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:03:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56485"}, "ts": "2023-07-14 02:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:05:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03351"}, "ts": "2023-07-14 02:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-14 02:05:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94875"}, "ts": "2023-07-14 02:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12956", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:06:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12956.455.455"}, "ts": "2023-07-14 02:06:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P67809.120.120"}, "ts": "2023-07-14 02:07:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67809", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:07:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02724"}, "ts": "2023-07-14 02:07:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02724", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15466", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:08:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15466.85.85"}, "ts": "2023-07-14 02:08:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1899321", "type": "PubMed"}, "ts": "2023-07-14 02:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1899321", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32970", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:08:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32970.63.63"}, "ts": "2023-07-14 02:08:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5W7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 02:08:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5W7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z129-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:08:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEQ0.250.250"}, "ts": "2023-07-14 02:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:09:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50990-1"}, "ts": "2023-07-14 02:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:09:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15144"}, "ts": "2023-07-14 02:09:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26756OQ"}, "ts": "2023-07-14 02:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26756OQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:10:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75911-1"}, "ts": "2023-07-14 02:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75911-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:10:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51174"}, "ts": "2023-07-14 02:10:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NF37.516.516"}, "ts": "2023-07-14 02:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NF37", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:10:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60658-1"}, "ts": "2023-07-14 02:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60658-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:10:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q62011", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 02:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62011", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:11:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06213.485.485"}, "ts": "2023-07-14 02:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07808-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:11:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07808-1"}, "ts": "2023-07-14 02:11:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19261606", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:11:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19261606", "type": "PubMed"}, "ts": "2023-07-14 02:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWZ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:11:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWZ8.184.184"}, "ts": "2023-07-14 02:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A59", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:11:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A59"}, "ts": "2023-07-14 02:11:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98161"}, "ts": "2023-07-14 02:11:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54219.87.87"}, "ts": "2023-07-14 02:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54219", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:12:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29401", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29401"}, "ts": "2023-07-14 02:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60239-1"}, "ts": "2023-07-14 02:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60239-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:12:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13257.185.185"}, "ts": "2023-07-14 02:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13257", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:12:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H772.40.40"}, "ts": "2023-07-14 02:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H772", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:12:51 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "G00031MO"}, "ts": "2023-07-14 02:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 02:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 02:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=G00031MO"}, "ts": "2023-07-14 02:13:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-14 02:13:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ZB89"}, "ts": "2023-07-14 02:13:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ZB89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:13:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05193", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:14:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05193.597.597"}, "ts": "2023-07-14 02:14:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 02:14:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 02:14:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAI0"}, "ts": "2023-07-14 02:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KQU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:15:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHY2"}, "ts": "2023-07-14 02:15:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KQU3"}, "ts": "2023-07-14 02:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15661", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:15:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15661"}, "ts": "2023-07-14 02:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85767HW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:15:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27291422", "type": "PubMed"}, "ts": "2023-07-14 02:15:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27291422", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03164"}, "ts": "2023-07-14 02:15:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVM6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVM6-1"}, "ts": "2023-07-14 02:16:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K2S6"}, "ts": "2023-07-14 02:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K2S6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:16:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294"}, "ts": "2023-07-14 02:16:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH69-1"}, "ts": "2023-07-14 02:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH69-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13987", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:16:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987"}, "ts": "2023-07-14 02:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26006"}, "ts": "2023-07-14 02:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26006", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:17:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8792217", "type": "PubMed"}, "ts": "2023-07-14 02:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8792217", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:17:47 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-14 02:17:53 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-14 02:17:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000034", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 02:17:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10390541", "type": "PubMed"}, "ts": "2023-07-14 02:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10390541", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23944", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:18:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23944"}, "ts": "2023-07-14 02:18:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UNA4-1"}, "ts": "2023-07-14 02:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UNA4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:18:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-14 02:19:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BVG8-1"}, "ts": "2023-07-14 02:19:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVG8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13308", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:20:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13308.1064.1064"}, "ts": "2023-07-14 02:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TA78", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:20:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TA78.91.91"}, "ts": "2023-07-14 02:20:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y3S1-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 02:21:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3S1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:21:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-14 02:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7E9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:21:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7E9-1"}, "ts": "2023-07-14 02:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZ96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZ96"}, "ts": "2023-07-14 02:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "13679367", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:22:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "13679367", "type": "PubMed"}, "ts": "2023-07-14 02:22:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYG7"}, "ts": "2023-07-14 02:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYG7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-14 02:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94875", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51690"}, "ts": "2023-07-14 02:22:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29197662", "type": "PubMed"}, "ts": "2023-07-14 02:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29197662", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29197662", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 02:22:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BV99"}, "ts": "2023-07-14 02:23:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BV99", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:23:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11362"}, "ts": "2023-07-14 02:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3182841", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:23:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3182841", "type": "PubMed"}, "ts": "2023-07-14 02:23:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43364", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:23:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43364.284.284"}, "ts": "2023-07-14 02:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LRQ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:24:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LRQ6-1"}, "ts": "2023-07-14 02:24:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P246.695.695"}, "ts": "2023-07-14 02:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4FU28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P246", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:24:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4FU28"}, "ts": "2023-07-14 02:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-14 02:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-14 02:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25520XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50990-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21542132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:25:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21542132", "type": "PubMed"}, "ts": "2023-07-14 02:25:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75554-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:25:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75554-1"}, "ts": "2023-07-14 02:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-14 02:25:45 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-14 02:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 02:26:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16186.15.15"}, "ts": "2023-07-14 02:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16186", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:26:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UWF7.415.415"}, "ts": "2023-07-14 02:26:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWF7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:26:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16477006", "type": "PubMed"}, "ts": "2023-07-14 02:26:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16477006", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:26:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99MT7.33.33"}, "ts": "2023-07-14 02:27:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MT7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:27:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-14 02:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48775-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:27:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48775-1"}, "ts": "2023-07-14 02:27:14 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09429", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 02:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12032298", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:27:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12032298", "type": "PubMed"}, "ts": "2023-07-14 02:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21807-1"}, "ts": "2023-07-14 02:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Z22-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:28:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91Z22-1"}, "ts": "2023-07-14 02:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21807-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:28:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQ89"}, "ts": "2023-07-14 02:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:28:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83461WR"}, "ts": "2023-07-14 02:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65562ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q65CL1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:29:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q65CL1.637.637"}, "ts": "2023-07-14 02:29:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 02:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63168", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:30:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P63168.88.88"}, "ts": "2023-07-14 02:30:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70101JE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:30:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00876GU"}, "ts": "2023-07-14 02:30:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03019FG"}, "ts": "2023-07-14 02:30:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01096QY"}, "ts": "2023-07-14 02:30:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00798PL"}, "ts": "2023-07-14 02:30:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07569NS"}, "ts": "2023-07-14 02:30:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18447KU"}, "ts": "2023-07-14 02:30:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13847GJ"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10987MU"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18544DI"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20463HA"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26508HK"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18614BQ"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28615QI"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30517YN"}, "ts": "2023-07-14 02:30:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39338NX"}, "ts": "2023-07-14 02:30:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34220QA"}, "ts": "2023-07-14 02:30:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36581PT"}, "ts": "2023-07-14 02:30:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39578OU"}, "ts": "2023-07-14 02:30:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32780LD"}, "ts": "2023-07-14 02:30:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39687WG"}, "ts": "2023-07-14 02:30:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-14 02:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70281", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:30:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70281"}, "ts": "2023-07-14 02:30:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM45-1"}, "ts": "2023-07-14 02:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:31:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW66"}, "ts": "2023-07-14 02:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM45-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:31:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQW6"}, "ts": "2023-07-14 02:31:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-14 02:31:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15160"}, "ts": "2023-07-14 02:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15160", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFQ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:31:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BFQ3.8.8"}, "ts": "2023-07-14 02:31:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26572.419.419"}, "ts": "2023-07-14 02:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26572", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92615", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:32:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92615"}, "ts": "2023-07-14 02:32:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16650"}, "ts": "2023-07-14 02:32:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34555226", "type": "PubMed"}, "ts": "2023-07-14 02:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34555226", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:33:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60610.28.28"}, "ts": "2023-07-14 02:33:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VZL5.1064.1064"}, "ts": "2023-07-14 02:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZL5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80858MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6B9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:34:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6B9"}, "ts": "2023-07-14 02:34:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12672490", "type": "PubMed"}, "ts": "2023-07-14 02:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12672490", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7M5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:35:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7M5-1"}, "ts": "2023-07-14 02:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TN88", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:35:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TN88"}, "ts": "2023-07-14 02:35:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6N8"}, "ts": "2023-07-14 02:35:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G24381FI"}, "ts": "2023-07-14 02:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G24381FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29483644", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:35:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29483644", "type": "PubMed"}, "ts": "2023-07-14 02:35:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35626"}, "ts": "2023-07-14 02:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23863VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56945", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:37:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56945.128.128"}, "ts": "2023-07-14 02:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:37:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZM7"}, "ts": "2023-07-14 02:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZM7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:37:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20301658", "type": "PubMed"}, "ts": "2023-07-14 02:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20301658", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20301658", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 02:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51690", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:38:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22095910", "type": "PubMed"}, "ts": "2023-07-14 02:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22095910", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:39:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYG7"}, "ts": "2023-07-14 02:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYG7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:39:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Q5.133.133"}, "ts": "2023-07-14 02:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVF4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 02:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVF4"}, "ts": "2023-07-14 02:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16204NU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:40:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16204NU"}, "ts": "2023-07-14 02:40:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88574.138.138"}, "ts": "2023-07-14 02:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88574", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y617", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:42:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y617"}, "ts": "2023-07-14 02:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:43:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVJ6.77.77"}, "ts": "2023-07-14 02:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVJ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:43:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9110362", "type": "PubMed"}, "ts": "2023-07-14 02:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9110362", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:43:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JWF2.803.803"}, "ts": "2023-07-14 02:44:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:44:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-14 02:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83461WR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:44:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16220"}, "ts": "2023-07-14 02:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61290", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:45:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61290", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-14 02:45:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30711"}, "ts": "2023-07-14 02:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00206"}, "ts": "2023-07-14 02:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00206", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:46:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H7Z7.66.66"}, "ts": "2023-07-14 02:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7Z7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34583750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:46:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34583750", "type": "PubMed"}, "ts": "2023-07-14 02:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11517-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:46:05 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P11517-1", "cluster_type": "unselected"}, "ts": "2023-07-14 02:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11517-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-14 02:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22310AV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 02:46:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:46:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17803912", "type": "PubMed"}, "ts": "2023-07-14 02:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17803912", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53602"}, "ts": "2023-07-14 02:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:47:06 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 02:47:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-14 02:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 02:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-14 02:47:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-14 02:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:47:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394"}, "ts": "2023-07-14 02:47:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:48:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-14 02:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13726"}, "ts": "2023-07-14 02:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:49:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y210"}, "ts": "2023-07-14 02:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02585", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 02:49:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P02585", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 02:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:49:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V01"}, "ts": "2023-07-14 02:49:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08588"}, "ts": "2023-07-14 02:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UEU0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:51:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UEU0.179.179"}, "ts": "2023-07-14 02:51:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:51:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-14 02:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2A9"}, "ts": "2023-07-14 02:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D1I2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JXX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:54:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JXX7"}, "ts": "2023-07-14 02:54:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-14 02:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33727061", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 02:54:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33727061", "type": "PubMed"}, "ts": "2023-07-14 02:54:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33727061", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 02:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78347", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:55:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78347.634.634"}, "ts": "2023-07-14 02:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16557", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:55:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16557"}, "ts": "2023-07-14 02:55:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:56:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXH0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 02:56:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXH0.6485.6485"}, "ts": "2023-07-14 02:56:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43121"}, "ts": "2023-07-14 02:56:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-14 02:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 02:59:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ84"}, "ts": "2023-07-14 02:59:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-14 02:59:17 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 03:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 03:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 03:00:01 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 03:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 03:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 03:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6R0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:00:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N6R0.359.359"}, "ts": "2023-07-14 03:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:00:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 03:00:55 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 03:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 03:00:55 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 03:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 03:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 03:01:08 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(5)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-14 03:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(5)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 03:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 03:01:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 03:01:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 03:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 03:01:14 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 03:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL52"}, "ts": "2023-07-14 03:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:01:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08069"}, "ts": "2023-07-14 03:01:22 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 03:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWZ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWZ3-1"}, "ts": "2023-07-14 03:01:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00268"}, "ts": "2023-07-14 03:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00268", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:02:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BTY7.369.369"}, "ts": "2023-07-14 03:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTY7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:02:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5H7"}, "ts": "2023-07-14 03:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GTS8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3SWU4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:03:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3SWU4"}, "ts": "2023-07-14 03:03:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6GTS8-1"}, "ts": "2023-07-14 03:03:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4Q2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:05:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-14 03:05:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WTK3.203.203"}, "ts": "2023-07-14 03:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTK3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHX0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:05:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UHX0.365.365"}, "ts": "2023-07-14 03:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:06:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99436.50.50"}, "ts": "2023-07-14 03:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99436", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZXS8"}, "ts": "2023-07-14 03:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZXS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:06:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5PQX1.231.231"}, "ts": "2023-07-14 03:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQX1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:06:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EY8"}, "ts": "2023-07-14 03:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:07:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 03:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:07:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-14 03:08:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:08:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18827", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:08:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18827.92.92"}, "ts": "2023-07-14 03:08:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32179243", "type": "PubMed"}, "ts": "2023-07-14 03:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:08:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTA9"}, "ts": "2023-07-14 03:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32179243", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYQ5"}, "ts": "2023-07-14 03:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8K855", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:08:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8K855"}, "ts": "2023-07-14 03:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01730-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:08:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01730-1"}, "ts": "2023-07-14 03:08:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P22087", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 03:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22087", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2S0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:09:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2S0"}, "ts": "2023-07-14 03:09:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T0T0"}, "ts": "2023-07-14 03:09:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T0T0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:09:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16150.50.50"}, "ts": "2023-07-14 03:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:10:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15796", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:10:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15796"}, "ts": "2023-07-14 03:10:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:10:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN78"}, "ts": "2023-07-14 03:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:10:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 03:10:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16473.198.198"}, "ts": "2023-07-14 03:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16473", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:11:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25843720", "type": "PubMed"}, "ts": "2023-07-14 03:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25843720", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:11:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGD9-1"}, "ts": "2023-07-14 03:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGD9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:11:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-14 03:11:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-14 03:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:12:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:12:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-14 03:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUM4"}, "ts": "2023-07-14 03:13:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUM4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08253", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08253"}, "ts": "2023-07-14 03:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H773", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:13:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H773", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 03:13:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JYZ1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:14:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JYZ1"}, "ts": "2023-07-14 03:14:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23978"}, "ts": "2023-07-14 03:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23978", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BG84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BG84"}, "ts": "2023-07-14 03:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:15:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHP9"}, "ts": "2023-07-14 03:15:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 03:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:15:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28890073", "type": "PubMed"}, "ts": "2023-07-14 03:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28890073", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:15:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-14 03:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:15:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YD7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:15:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YD7"}, "ts": "2023-07-14 03:15:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05556-1.212.212"}, "ts": "2023-07-14 03:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:15:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35580", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:15:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P35580", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 03:15:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EY8"}, "ts": "2023-07-14 03:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:16:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23511"}, "ts": "2023-07-14 03:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:16:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-14 03:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09791GF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:16:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09791GF"}, "ts": "2023-07-14 03:16:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20826345", "type": "PubMed"}, "ts": "2023-07-14 03:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20826345", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:16:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NW7"}, "ts": "2023-07-14 03:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NW7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:17:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-14 03:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTR0"}, "ts": "2023-07-14 03:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTR0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:17:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:17:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15375.620.620"}, "ts": "2023-07-14 03:17:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15375", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18564", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:17:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18564.463.463"}, "ts": "2023-07-14 03:17:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BLD6-1"}, "ts": "2023-07-14 03:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BLD6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34903", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:17:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P34903.281.281"}, "ts": "2023-07-14 03:17:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07205.205.205"}, "ts": "2023-07-14 03:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07205", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8651289", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:18:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8651289", "type": "PubMed"}, "ts": "2023-07-14 03:18:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97805"}, "ts": "2023-07-14 03:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVN8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:18:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVN8.164.164"}, "ts": "2023-07-14 03:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21918", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:18:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21918.137.137"}, "ts": "2023-07-14 03:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50443", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:18:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50443.16.16"}, "ts": "2023-07-14 03:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93079", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:19:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93079"}, "ts": "2023-07-14 03:19:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-14 03:19:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3Y2-1"}, "ts": "2023-07-14 03:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3Y2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:19:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1412421", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:20:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1412421", "type": "PubMed"}, "ts": "2023-07-14 03:20:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21672573", "type": "PubMed"}, "ts": "2023-07-14 03:20:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21672573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:20:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14C87", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:20:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14C87.578.578"}, "ts": "2023-07-14 03:20:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JRA6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:20:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JRA6.813.813"}, "ts": "2023-07-14 03:20:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24530.97.97"}, "ts": "2023-07-14 03:21:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24530", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14763"}, "ts": "2023-07-14 03:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:21:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34030913", "type": "PubMed"}, "ts": "2023-07-14 03:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34030913", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34030913", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 03:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:21:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30543"}, "ts": "2023-07-14 03:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG30", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:21:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0CG30.196.196"}, "ts": "2023-07-14 03:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-14 03:21:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6I6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:21:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z6I6.129.129"}, "ts": "2023-07-14 03:21:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:22:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N584"}, "ts": "2023-07-14 03:22:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-14 03:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42666HT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:22:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-14 03:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-14 03:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54064OC"}, "ts": "2023-07-14 03:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19234OH"}, "ts": "2023-07-14 03:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:22:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02763"}, "ts": "2023-07-14 03:22:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01236"}, "ts": "2023-07-14 03:22:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01236", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:22:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86V35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86V35"}, "ts": "2023-07-14 03:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:22:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06727"}, "ts": "2023-07-14 03:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17115030", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:23:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17115030", "type": "PubMed"}, "ts": "2023-07-14 03:23:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37802"}, "ts": "2023-07-14 03:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNE9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:23:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZNE9.385.385"}, "ts": "2023-07-14 03:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PVD3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:24:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "E9PVD3.3048.3048"}, "ts": "2023-07-14 03:24:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34111567", "type": "PubMed"}, "ts": "2023-07-14 03:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34111567", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34111567", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 03:24:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:24:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06756.615.615"}, "ts": "2023-07-14 03:24:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15661742", "type": "PubMed"}, "ts": "2023-07-14 03:25:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15661742", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:25:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29476.847.847"}, "ts": "2023-07-14 03:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29476", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:25:02 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 03:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 03:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 03:25:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19453293", "type": "PubMed"}, "ts": "2023-07-14 03:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19453293", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:26:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50135"}, "ts": "2023-07-14 03:26:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20356844", "type": "PubMed"}, "ts": "2023-07-14 03:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20356844", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:26:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62789"}, "ts": "2023-07-14 03:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:26:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31554661", "type": "PubMed"}, "ts": "2023-07-14 03:27:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31554661", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:27:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12873", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:27:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12873.892.892"}, "ts": "2023-07-14 03:27:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:27:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30249802", "type": "PubMed"}, "ts": "2023-07-14 03:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30249802", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:28:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZJ1"}, "ts": "2023-07-14 03:28:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRA2.72.72"}, "ts": "2023-07-14 03:28:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRA2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:28:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47937"}, "ts": "2023-07-14 03:28:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47937", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:28:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98158.4658.4658"}, "ts": "2023-07-14 03:28:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98158", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:28:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08423", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:28:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08423"}, "ts": "2023-07-14 03:28:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X29.406.406"}, "ts": "2023-07-14 03:28:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10920397", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:29:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10920397", "type": "PubMed"}, "ts": "2023-07-14 03:29:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q1HG43"}, "ts": "2023-07-14 03:29:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q1HG43", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:29:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02771"}, "ts": "2023-07-14 03:29:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02774.288.288"}, "ts": "2023-07-14 03:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02774", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:29:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6X8.531.531"}, "ts": "2023-07-14 03:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6X8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:29:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VSI4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:30:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VSI4-1"}, "ts": "2023-07-14 03:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13418-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:30:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13418-1"}, "ts": "2023-07-14 03:30:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10981"}, "ts": "2023-07-14 03:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRU9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:30:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRU9"}, "ts": "2023-07-14 03:30:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGJ0"}, "ts": "2023-07-14 03:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XP3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:30:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86XP3.325.325"}, "ts": "2023-07-14 03:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P99026", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:31:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P99026"}, "ts": "2023-07-14 03:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIF9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:31:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIF9"}, "ts": "2023-07-14 03:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67809"}, "ts": "2023-07-14 03:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67809", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U70", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:31:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U70"}, "ts": "2023-07-14 03:31:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23819.256.256"}, "ts": "2023-07-14 03:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:32:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43763"}, "ts": "2023-07-14 03:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTR1-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:32:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WTR1-1.77.77"}, "ts": "2023-07-14 03:32:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NLX4"}, "ts": "2023-07-14 03:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NLX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:32:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4JLT5-1"}, "ts": "2023-07-14 03:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4JLT5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM45-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:33:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM45-1"}, "ts": "2023-07-14 03:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:33:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X55"}, "ts": "2023-07-14 03:34:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O76024.32.32"}, "ts": "2023-07-14 03:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76024", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:34:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49247"}, "ts": "2023-07-14 03:34:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01844", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:34:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01844.412.412"}, "ts": "2023-07-14 03:34:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16112"}, "ts": "2023-07-14 03:34:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75449.109.109"}, "ts": "2023-07-14 03:35:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75449", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:35:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-14 03:35:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01901"}, "ts": "2023-07-14 03:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01901", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:35:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPY3"}, "ts": "2023-07-14 03:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43300", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:35:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43300"}, "ts": "2023-07-14 03:35:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923Y9"}, "ts": "2023-07-14 03:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33665735", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:35:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33665735", "type": "PubMed"}, "ts": "2023-07-14 03:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923Y9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10858305", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:35:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10858305", "type": "PubMed"}, "ts": "2023-07-14 03:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33665735", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 03:35:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P11517-1", "cluster_type": "unselected"}, "ts": "2023-07-14 03:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11517-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11517-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 03:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI12", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:36:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UI12.438.438"}, "ts": "2023-07-14 03:36:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75604.459.459"}, "ts": "2023-07-14 03:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75604", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04941", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:36:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04941.141.141"}, "ts": "2023-07-14 03:36:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62318"}, "ts": "2023-07-14 03:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62318", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:36:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q7Z4W1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 03:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4W1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82979", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:37:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P82979", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 03:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00744", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:38:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00744"}, "ts": "2023-07-14 03:38:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL46"}, "ts": "2023-07-14 03:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:38:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10069803", "type": "PubMed"}, "ts": "2023-07-14 03:38:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10069803", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:38:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKA4.884.884"}, "ts": "2023-07-14 03:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKA4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19590036", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:38:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19590036", "type": "PubMed"}, "ts": "2023-07-14 03:38:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9525617", "type": "PubMed"}, "ts": "2023-07-14 03:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9525617", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13619", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:39:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13619"}, "ts": "2023-07-14 03:40:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU74-1"}, "ts": "2023-07-14 03:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU74-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:40:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EBA1"}, "ts": "2023-07-14 03:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EBA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:40:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-14 03:40:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A577", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:40:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10346978", "type": "PubMed"}, "ts": "2023-07-14 03:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10346978", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:40:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFG4"}, "ts": "2023-07-14 03:40:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A577"}, "ts": "2023-07-14 03:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M4J1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:41:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M4J1-1"}, "ts": "2023-07-14 03:41:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 03:41:10 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 03:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESE1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:41:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ESE1.979.979"}, "ts": "2023-07-14 03:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15234", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:41:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15234"}, "ts": "2023-07-14 03:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2105906", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:41:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2105906", "type": "PubMed"}, "ts": "2023-07-14 03:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50135", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:42:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BI1"}, "ts": "2023-07-14 03:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43747", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:42:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43747.198.198"}, "ts": "2023-07-14 03:42:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09651.362.362"}, "ts": "2023-07-14 03:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09651", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08579", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:43:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08579.176.176"}, "ts": "2023-07-14 03:43:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-14 03:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15494207", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:44:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15494207", "type": "PubMed"}, "ts": "2023-07-14 03:44:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-14 03:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12123587", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:45:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12123587", "type": "PubMed"}, "ts": "2023-07-14 03:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:45:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B23"}, "ts": "2023-07-14 03:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:45:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULQ1.616.616"}, "ts": "2023-07-14 03:45:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B21-1"}, "ts": "2023-07-14 03:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:45:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02524-1"}, "ts": "2023-07-14 03:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02524-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:45:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-14 03:45:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEE4"}, "ts": "2023-07-14 03:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28070", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:46:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28070"}, "ts": "2023-07-14 03:46:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:46:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-14 03:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55226", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:46:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O55226", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 03:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55226", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 03:46:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-14 03:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:46:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P63142.449.449"}, "ts": "2023-07-14 03:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63142", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-14 03:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:47:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13639"}, "ts": "2023-07-14 03:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92583", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:47:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92583"}, "ts": "2023-07-14 03:47:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14791", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:47:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14791"}, "ts": "2023-07-14 03:47:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54840"}, "ts": "2023-07-14 03:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61289"}, "ts": "2023-07-14 03:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34207", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:48:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34207"}, "ts": "2023-07-14 03:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ50", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 03:49:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NQ50", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 03:49:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ50", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 03:49:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95222"}, "ts": "2023-07-14 03:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:50:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80303"}, "ts": "2023-07-14 03:50:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G74609HP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:50:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G74609HP"}, "ts": "2023-07-14 03:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TRY2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:50:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TRY2-1"}, "ts": "2023-07-14 03:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D6RBQ6"}, "ts": "2023-07-14 03:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D6RBQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27751653", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:50:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27751653", "type": "PubMed"}, "ts": "2023-07-14 03:50:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0D5"}, "ts": "2023-07-14 03:50:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K561-1"}, "ts": "2023-07-14 03:50:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K561-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92545", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:51:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92545.1363.1363"}, "ts": "2023-07-14 03:51:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13315"}, "ts": "2023-07-14 03:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10090723", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:52:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10090723", "type": "PubMed"}, "ts": "2023-07-14 03:52:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q78T81"}, "ts": "2023-07-14 03:52:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q78T81", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:52:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-14 03:52:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31629", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:52:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31629.251.251"}, "ts": "2023-07-14 03:52:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A597"}, "ts": "2023-07-14 03:52:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05187.180.180"}, "ts": "2023-07-14 03:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05187", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:52:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUI6"}, "ts": "2023-07-14 03:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDV9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:53:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDV9"}, "ts": "2023-07-14 03:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RR4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RR4"}, "ts": "2023-07-14 03:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG48", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:54:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG48"}, "ts": "2023-07-14 03:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JU34"}, "ts": "2023-07-14 03:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JU34", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04216", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:54:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04216"}, "ts": "2023-07-14 03:54:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34522210", "type": "PubMed"}, "ts": "2023-07-14 03:54:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34522210", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:54:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34522210", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 03:54:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M0Y6-1"}, "ts": "2023-07-14 03:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M0Y6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:55:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XX4-1"}, "ts": "2023-07-14 03:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XX4-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 03:55:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHC0"}, "ts": "2023-07-14 03:55:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:55:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12946.34.34"}, "ts": "2023-07-14 03:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12946", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21930935", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:55:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21930935", "type": "PubMed"}, "ts": "2023-07-14 03:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:56:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UND0-1"}, "ts": "2023-07-14 03:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UND0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:56:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 03:56:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-14 03:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:56:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20335265", "type": "PubMed"}, "ts": "2023-07-14 03:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20335265", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 03:56:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01857.154.154"}, "ts": "2023-07-14 03:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:57:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48307"}, "ts": "2023-07-14 03:57:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JY26", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JY26"}, "ts": "2023-07-14 03:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:57:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-14 03:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:57:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27352.100.100"}, "ts": "2023-07-14 03:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27352", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 03:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:57:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5I0"}, "ts": "2023-07-14 03:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5I0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DFV3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 03:58:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DFV3-1"}, "ts": "2023-07-14 03:58:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 03:59:27 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 04:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 04:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 04:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 04:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPI5-1"}, "ts": "2023-07-14 04:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPI5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:00:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12388"}, "ts": "2023-07-14 04:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12388", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:00:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12445133", "type": "PubMed"}, "ts": "2023-07-14 04:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12445133", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:01:24 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:01:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14508-1"}, "ts": "2023-07-14 04:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14508-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:01:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9497245", "type": "PubMed"}, "ts": "2023-07-14 04:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9497245", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13639", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:02:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13639.435.435"}, "ts": "2023-07-14 04:02:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12416996", "type": "PubMed"}, "ts": "2023-07-14 04:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12416996", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TJ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TJ1-1"}, "ts": "2023-07-14 04:02:31 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(5)", "term_category": "any"}, "ts": "2023-07-14 04:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">4f47d6c261ad583d7687cb0ac270bc8f", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(5)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:02:59 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:03:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:03:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95373.615.615"}, "ts": "2023-07-14 04:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95373", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18214MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:03:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18214MO"}, "ts": "2023-07-14 04:03:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000004"}, "ts": "2023-07-14 04:03:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88620WF"}, "ts": "2023-07-14 04:03:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19243BC"}, "ts": "2023-07-14 04:03:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:03:48 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:03:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:03:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A6L0"}, "ts": "2023-07-14 04:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A6L0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:03:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6433976", "type": "PubMed"}, "ts": "2023-07-14 04:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6433976", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:03:59 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(3)HexNAc(6)dHex(1)", "term_category": "any"}, "ts": "2023-07-14 04:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">53a9ec7cd8d6b09260dfc7fb6114c89b", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(3)HexNAc(6)dHex(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "53a9ec7cd8d6b09260dfc7fb6114c89b", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:04:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "53a9ec7cd8d6b09260dfc7fb6114c89b", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:04:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85542KD"}, "ts": "2023-07-14 04:04:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00176HZ"}, "ts": "2023-07-14 04:04:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53322JT"}, "ts": "2023-07-14 04:04:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97832IV"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89941FZ"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29676WX"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34838RM"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04077XA"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35808UX"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59277TZ"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99952ON"}, "ts": "2023-07-14 04:04:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83892WB"}, "ts": "2023-07-14 04:04:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07493GF"}, "ts": "2023-07-14 04:04:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83710ZZ"}, "ts": "2023-07-14 04:04:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49369WH"}, "ts": "2023-07-14 04:04:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "53a9ec7cd8d6b09260dfc7fb6114c89b", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:04:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74575XC"}, "ts": "2023-07-14 04:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "53a9ec7cd8d6b09260dfc7fb6114c89b", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:04:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51140AE"}, "ts": "2023-07-14 04:04:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50757KG"}, "ts": "2023-07-14 04:04:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69233PF"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26915XM"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63543FL"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55382TU"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33740YL"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97452SL"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92302BV"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58959YB"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63135DD"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42889MJ"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53611QW"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60849TG"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78015OA"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76329LA"}, "ts": "2023-07-14 04:04:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94470IW"}, "ts": "2023-07-14 04:04:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01485JJ"}, "ts": "2023-07-14 04:04:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07145VL"}, "ts": "2023-07-14 04:04:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33877TL"}, "ts": "2023-07-14 04:04:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51140AE"}, "ts": "2023-07-14 04:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51140AE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:04:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-14 04:04:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-14 04:04:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-14 04:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84440YT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:04:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84440YT"}, "ts": "2023-07-14 04:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:04:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C002"}, "ts": "2023-07-14 04:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C002", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:05:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24046.432.432"}, "ts": "2023-07-14 04:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24046", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:05:23 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:05:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:05:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23169667", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:05:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23169667", "type": "PubMed"}, "ts": "2023-07-14 04:05:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:05:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43699"}, "ts": "2023-07-14 04:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43699", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:05:32 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(4)HexNAc(6)", "term_category": "any"}, "ts": "2023-07-14 04:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">25e3c504e00be49f151b42c426d8e7af", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(4)HexNAc(6)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:05:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:05:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-14 04:05:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88948CY"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39540XG"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52676LZ"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07262RR"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93994MR"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83945MQ"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55521GY"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91425YG"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87505EW"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26371XR"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45045RU"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19099PA"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42826YI"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44369QM"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70958LU"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46991EQ"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57295PS"}, "ts": "2023-07-14 04:05:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08597BP"}, "ts": "2023-07-14 04:05:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03605AV"}, "ts": "2023-07-14 04:05:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38997JB"}, "ts": "2023-07-14 04:05:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:05:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:05:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50003EV"}, "ts": "2023-07-14 04:05:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39100MY"}, "ts": "2023-07-14 04:05:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75397RL"}, "ts": "2023-07-14 04:05:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23975EE"}, "ts": "2023-07-14 04:05:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89996XH"}, "ts": "2023-07-14 04:05:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44772RK"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39260NC"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20966PQ"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463EY"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07808ZA"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57324EP"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89265JH"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70422GF"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27692NT"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34558ED"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96038NV"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43061MO"}, "ts": "2023-07-14 04:05:43 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:05:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5NBX1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:06:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5NBX1.1128.1128"}, "ts": "2023-07-14 04:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G5E8K5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:06:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "G5E8K5.850.850"}, "ts": "2023-07-14 04:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:06:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXS5-1"}, "ts": "2023-07-14 04:06:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWB7"}, "ts": "2023-07-14 04:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:06:50 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:06:50 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(4)HexNAc(4)dHex(3)", "term_category": "any"}, "ts": "2023-07-14 04:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:06:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55066.1175.1175"}, "ts": "2023-07-14 04:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6e697cbe880dee4241946f205b10c981", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(4)HexNAc(4)dHex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:06:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55066", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:06:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6e697cbe880dee4241946f205b10c981", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:06:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6e697cbe880dee4241946f205b10c981", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:06:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00978GW"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59658KK"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47448YK"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77550KK"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11009FR"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25278BX"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21672MV"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69774ND"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98073MH"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16739XD"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60615ZD"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55638XL"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23463KX"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14346JI"}, "ts": "2023-07-14 04:07:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59810YR"}, "ts": "2023-07-14 04:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97650EC"}, "ts": "2023-07-14 04:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28136FA"}, "ts": "2023-07-14 04:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03462LS"}, "ts": "2023-07-14 04:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73440TD"}, "ts": "2023-07-14 04:07:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24475OY"}, "ts": "2023-07-14 04:07:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6e697cbe880dee4241946f205b10c981", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6e697cbe880dee4241946f205b10c981", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:07:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76505ZE"}, "ts": "2023-07-14 04:07:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74012IM"}, "ts": "2023-07-14 04:07:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08308ZP"}, "ts": "2023-07-14 04:07:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6e697cbe880dee4241946f205b10c981", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:07:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09781FH"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95495MU"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18995MT"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95203RC"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48941WE"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53426PR"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64236WJ"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47868BO"}, "ts": "2023-07-14 04:07:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99770FX"}, "ts": "2023-07-14 04:07:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67147CZ"}, "ts": "2023-07-14 04:07:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6e697cbe880dee4241946f205b10c981", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:07:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25935VE"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46029TT"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03140AX"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68637SE"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75851ZW"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55282VK"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24120OI"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08382XT"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35644NQ"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84862VB"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95448VV"}, "ts": "2023-07-14 04:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08224KD"}, "ts": "2023-07-14 04:07:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79083TY"}, "ts": "2023-07-14 04:07:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66166BF"}, "ts": "2023-07-14 04:07:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45402WV"}, "ts": "2023-07-14 04:07:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25025", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:07:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25025"}, "ts": "2023-07-14 04:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13315", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:08:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N883.69.69"}, "ts": "2023-07-14 04:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N883", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:08:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMG9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:08:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMG9.121.121"}, "ts": "2023-07-14 04:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:08:19 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 04:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:08:20 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VEZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VEZ1"}, "ts": "2023-07-14 04:08:25 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(3)dHex(1)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-14 04:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c1a4321357c61f5591052742144f76e1", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(3)dHex(1)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c1a4321357c61f5591052742144f76e1", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:08:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c1a4321357c61f5591052742144f76e1", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35599NO"}, "ts": "2023-07-14 04:08:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10300DY"}, "ts": "2023-07-14 04:08:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83258AP"}, "ts": "2023-07-14 04:08:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36807HJ"}, "ts": "2023-07-14 04:08:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30439IP"}, "ts": "2023-07-14 04:08:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85121UD"}, "ts": "2023-07-14 04:08:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75090UL"}, "ts": "2023-07-14 04:08:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17978LE"}, "ts": "2023-07-14 04:08:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17268FT"}, "ts": "2023-07-14 04:08:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28024NV"}, "ts": "2023-07-14 04:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86822MM"}, "ts": "2023-07-14 04:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08380AT"}, "ts": "2023-07-14 04:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24191XX"}, "ts": "2023-07-14 04:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36766KS"}, "ts": "2023-07-14 04:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09051DN"}, "ts": "2023-07-14 04:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39431MA"}, "ts": "2023-07-14 04:08:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46946SC"}, "ts": "2023-07-14 04:08:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34730YF"}, "ts": "2023-07-14 04:08:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67324HN"}, "ts": "2023-07-14 04:08:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51715FH"}, "ts": "2023-07-14 04:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:09:20 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 04:09:20 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:09:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:09:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:09:21 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(6)HexNAc(4)dHex(2)", "term_category": "any"}, "ts": "2023-07-14 04:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(6)HexNAc(4)dHex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:09:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:09:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:09:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87107PF"}, "ts": "2023-07-14 04:09:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77627UV"}, "ts": "2023-07-14 04:09:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26394UA"}, "ts": "2023-07-14 04:09:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05227QG"}, "ts": "2023-07-14 04:09:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89333YV"}, "ts": "2023-07-14 04:09:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80030LD"}, "ts": "2023-07-14 04:09:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09344ZL"}, "ts": "2023-07-14 04:09:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21078FZ"}, "ts": "2023-07-14 04:09:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-14 04:09:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47748JZ"}, "ts": "2023-07-14 04:09:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52131KU"}, "ts": "2023-07-14 04:09:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49284IH"}, "ts": "2023-07-14 04:09:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16175ZV"}, "ts": "2023-07-14 04:09:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91847ME"}, "ts": "2023-07-14 04:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:09:36 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["Glycosphingolipid"]}]}, "ts": "2023-07-14 04:09:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36058QA"}, "ts": "2023-07-14 04:09:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99884YO"}, "ts": "2023-07-14 04:09:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02374CE"}, "ts": "2023-07-14 04:09:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18945FQ"}, "ts": "2023-07-14 04:09:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10788ZQ"}, "ts": "2023-07-14 04:09:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32685NO"}, "ts": "2023-07-14 04:09:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83607KI"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04010WJ"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33012CU"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46691LC"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28247OU"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81578NL"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04742WT"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36431NE"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92463PQ"}, "ts": "2023-07-14 04:09:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19220VM"}, "ts": "2023-07-14 04:09:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25956VZ"}, "ts": "2023-07-14 04:09:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90411BS"}, "ts": "2023-07-14 04:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6T4P5"}, "ts": "2023-07-14 04:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6T4P5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32685NO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:09:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32685NO"}, "ts": "2023-07-14 04:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5R4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5R4"}, "ts": "2023-07-14 04:10:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:10:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:10:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-14 04:10:19 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 04:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:10:40 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHK5"}, "ts": "2023-07-14 04:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:10:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:10:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-14 04:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:10:54 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(6)HexNAc(4)dHex(2)", "term_category": "any"}, "ts": "2023-07-14 04:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(6)HexNAc(4)dHex(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:10:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:11:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-14 04:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:11:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["Other"]}]}, "ts": "2023-07-14 04:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:11:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77050QU"}, "ts": "2023-07-14 04:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53768ZR"}, "ts": "2023-07-14 04:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-14 04:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 04:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 04:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-14 04:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 04:11:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53276NK"}, "ts": "2023-07-14 04:11:17 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:11:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-14 04:11:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73319KU"}, "ts": "2023-07-14 04:11:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-14 04:11:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:11:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b345a79201a694b5addccfbae0a6c6dd", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["Glycosphingolipid"]}]}, "ts": "2023-07-14 04:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32685NO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:11:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32685NO"}, "ts": "2023-07-14 04:11:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01906", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:11:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01906"}, "ts": "2023-07-14 04:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:12:23 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 04:12:23 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N370", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:12:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N370.14.14"}, "ts": "2023-07-14 04:12:32 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(5)dHex(3)", "term_category": "any"}, "ts": "2023-07-14 04:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">93284d47a7a9847a87ebc5ced4f9a657", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(5)dHex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "93284d47a7a9847a87ebc5ced4f9a657", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:12:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "93284d47a7a9847a87ebc5ced4f9a657", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:12:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96489SM"}, "ts": "2023-07-14 04:12:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41742IZ"}, "ts": "2023-07-14 04:12:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52692IB"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20767LB"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94163JU"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51806IG"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98590PE"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40268BC"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38835AV"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68817WF"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99647DZ"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19778AE"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61956VN"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80099PR"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73515IW"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26557AV"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57429KQ"}, "ts": "2023-07-14 04:12:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "93284d47a7a9847a87ebc5ced4f9a657", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:12:37 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "93284d47a7a9847a87ebc5ced4f9a657", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:12:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99281CN"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47345EV"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79421NO"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83152ZM"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20012OO"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00652BK"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14972EH"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90829NZ"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35946GZ"}, "ts": "2023-07-14 04:12:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37282LW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:12:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37282LW"}, "ts": "2023-07-14 04:12:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91Y86.183.183"}, "ts": "2023-07-14 04:12:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Y86", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:12:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86VZ1.255.255"}, "ts": "2023-07-14 04:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VZ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:13:13 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 04:13:13 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:13:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:13:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:13:14 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(6)HexNAc(5)dHex(3)", "term_category": "any"}, "ts": "2023-07-14 04:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">0b4270dc14ae5ef0b68bcf982d41e4bf", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(6)HexNAc(5)dHex(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b4270dc14ae5ef0b68bcf982d41e4bf", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:13:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0b4270dc14ae5ef0b68bcf982d41e4bf", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:13:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24132CP"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11696PX"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90974PL"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42504VW"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65760UO"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72906WU"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80285YU"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92145EO"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43660IT"}, "ts": "2023-07-14 04:13:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28060PF"}, "ts": "2023-07-14 04:13:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59303WP"}, "ts": "2023-07-14 04:13:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09325HD"}, "ts": "2023-07-14 04:13:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22658BN"}, "ts": "2023-07-14 04:13:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-14 04:13:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-14 04:13:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-14 04:13:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89865VY"}, "ts": "2023-07-14 04:13:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04784US"}, "ts": "2023-07-14 04:13:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64813JD"}, "ts": "2023-07-14 04:13:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73211XU"}, "ts": "2023-07-14 04:13:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:13:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGC6-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGC6-1"}, "ts": "2023-07-14 04:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:13:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95352"}, "ts": "2023-07-14 04:13:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2E6"}, "ts": "2023-07-14 04:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:13:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 04:13:54 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 04:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05086", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 04:14:08 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(3)HexNAc(2)dHex(4)", "term_category": "any"}, "ts": "2023-07-14 04:14:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q05086", "cluster_type": "unselected"}, "ts": "2023-07-14 04:14:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:14:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05086", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 04:14:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">5756389d4b703c0906f22b48b1558c22", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(3)HexNAc(2)dHex(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:14:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5756389d4b703c0906f22b48b1558c22", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:14:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5756389d4b703c0906f22b48b1558c22", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:14:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23154TX"}, "ts": "2023-07-14 04:14:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94235HZ"}, "ts": "2023-07-14 04:14:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39952AI"}, "ts": "2023-07-14 04:14:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94458CS"}, "ts": "2023-07-14 04:14:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50290HR"}, "ts": "2023-07-14 04:14:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65142PC"}, "ts": "2023-07-14 04:14:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70379IZ"}, "ts": "2023-07-14 04:14:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23154TX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:14:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23154TX"}, "ts": "2023-07-14 04:14:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-14 04:14:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-14 04:14:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-14 04:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:14:48 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:15:06 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(3)HexNAc(2)dHex(2)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-14 04:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">236330df040cec9dd95d36ea0453b002", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(3)HexNAc(2)dHex(2)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "236330df040cec9dd95d36ea0453b002", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:15:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "236330df040cec9dd95d36ea0453b002", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:15:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45685DY"}, "ts": "2023-07-14 04:15:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61785RY"}, "ts": "2023-07-14 04:15:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78034AU"}, "ts": "2023-07-14 04:15:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30580XW"}, "ts": "2023-07-14 04:15:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24774ZZ"}, "ts": "2023-07-14 04:15:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61360OW"}, "ts": "2023-07-14 04:15:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61401ZY"}, "ts": "2023-07-14 04:15:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96504WL"}, "ts": "2023-07-14 04:15:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23505FB"}, "ts": "2023-07-14 04:15:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23666EW"}, "ts": "2023-07-14 04:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10361"}, "ts": "2023-07-14 04:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08473", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:15:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08473.541.541"}, "ts": "2023-07-14 04:15:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 04:15:42 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 04:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:15:44 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:15:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04791QM"}, "ts": "2023-07-14 04:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 04:15:46 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(4)HexNAc(6)", "term_category": "any"}, "ts": "2023-07-14 04:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">25e3c504e00be49f151b42c426d8e7af", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(4)HexNAc(6)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:15:56 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:15:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:16:14 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86V35", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:16:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:16:26 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "25e3c504e00be49f151b42c426d8e7af", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:16:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86V35.114.114"}, "ts": "2023-07-14 04:16:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23684622", "type": "PubMed"}, "ts": "2023-07-14 04:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23684622", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27642048", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:17:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27642048", "type": "PubMed"}, "ts": "2023-07-14 04:17:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32319846", "type": "PubMed"}, "ts": "2023-07-14 04:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32319846", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:17:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX21"}, "ts": "2023-07-14 04:18:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13094", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:18:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13094"}, "ts": "2023-07-14 04:18:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86144YL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:18:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86144YL"}, "ts": "2023-07-14 04:18:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-14 04:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41230", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:19:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41230"}, "ts": "2023-07-14 04:19:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UW1"}, "ts": "2023-07-14 04:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06518", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:19:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06518"}, "ts": "2023-07-14 04:19:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13611.300.300"}, "ts": "2023-07-14 04:20:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13611", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:20:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04230-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04230-1"}, "ts": "2023-07-14 04:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15904"}, "ts": "2023-07-14 04:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15904", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:21:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13231"}, "ts": "2023-07-14 04:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZSW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:21:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZSW3"}, "ts": "2023-07-14 04:21:15 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 04:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 04:21:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-14 04:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 04:21:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14258-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14258-1"}, "ts": "2023-07-14 04:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:22:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:22:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-14 04:22:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/534  (KHTML, like Gecko) BingPreview/1.0b"}, "ts": "2023-07-14 04:22:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12553878", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:22:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12553878", "type": "PubMed"}, "ts": "2023-07-14 04:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68D06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:22:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68D06.658.658"}, "ts": "2023-07-14 04:22:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32809973", "type": "PubMed"}, "ts": "2023-07-14 04:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32809973", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30416-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:23:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30416-1"}, "ts": "2023-07-14 04:23:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17105775", "type": "PubMed"}, "ts": "2023-07-14 04:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17105775", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:24:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860-1"}, "ts": "2023-07-14 04:24:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:24:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P67936", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 04:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67936", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 04:24:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N122"}, "ts": "2023-07-14 04:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-14 04:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-14 04:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:25:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-14 04:25:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-14 04:25:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-14 04:25:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CCH2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:26:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CCH2"}, "ts": "2023-07-14 04:26:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z739"}, "ts": "2023-07-14 04:26:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:26:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7521540", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:26:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7521540", "type": "PubMed"}, "ts": "2023-07-14 04:26:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-14 04:26:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q2N0"}, "ts": "2023-07-14 04:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q2N0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:27:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19564354", "type": "PubMed"}, "ts": "2023-07-14 04:27:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19564354", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:27:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ANY6"}, "ts": "2023-07-14 04:27:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ANY6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:27:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11549286", "type": "PubMed"}, "ts": "2023-07-14 04:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11549286", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35580", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:27:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35580.1592.1592"}, "ts": "2023-07-14 04:27:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-14 04:28:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60242.611.611"}, "ts": "2023-07-14 04:28:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60242", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:28:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PEZ8"}, "ts": "2023-07-14 04:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PEZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0A6YYK7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:28:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0A6YYK7-1"}, "ts": "2023-07-14 04:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDM7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:28:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDM7"}, "ts": "2023-07-14 04:28:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AAF4"}, "ts": "2023-07-14 04:29:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AAF4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:29:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AAF4", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 04:29:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1M3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:29:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1M3"}, "ts": "2023-07-14 04:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CFZ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:29:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CFZ4.494.494"}, "ts": "2023-07-14 04:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:29:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01591"}, "ts": "2023-07-14 04:30:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULC5"}, "ts": "2023-07-14 04:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULC5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31159924", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:31:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31159924", "type": "PubMed"}, "ts": "2023-07-14 04:31:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14574"}, "ts": "2023-07-14 04:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:31:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:31:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:31:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQ03.21.21"}, "ts": "2023-07-14 04:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ03", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04791QM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50609"}, "ts": "2023-07-14 04:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50609", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:32:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37275"}, "ts": "2023-07-14 04:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21765415", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:32:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21765415", "type": "PubMed"}, "ts": "2023-07-14 04:32:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L1Q6"}, "ts": "2023-07-14 04:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L1Q6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY85", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:32:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IY85.931.931"}, "ts": "2023-07-14 04:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:33:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY74.501.501"}, "ts": "2023-07-14 04:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UFC0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:34:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UFC0"}, "ts": "2023-07-14 04:34:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPN7.196.196"}, "ts": "2023-07-14 04:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPN7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:34:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22888"}, "ts": "2023-07-14 04:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24821", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:34:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24821"}, "ts": "2023-07-14 04:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:35:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86VP6.335.335"}, "ts": "2023-07-14 04:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VP6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:35:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40319SF"}, "ts": "2023-07-14 04:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40319SF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:35:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z860"}, "ts": "2023-07-14 04:35:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8BWC0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 04:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BWC0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 04:35:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-14 04:35:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17655.50.50"}, "ts": "2023-07-14 04:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17655", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:35:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75460"}, "ts": "2023-07-14 04:36:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20823"}, "ts": "2023-07-14 04:36:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-14 04:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RUV9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RUV9-1"}, "ts": "2023-07-14 04:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0D2K2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:37:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q0D2K2.213.213"}, "ts": "2023-07-14 04:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TFD2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:37:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TFD2-1"}, "ts": "2023-07-14 04:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42227JK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 04:37:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42227JK"}, "ts": "2023-07-14 04:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95158"}, "ts": "2023-07-14 04:38:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:38:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.445.445"}, "ts": "2023-07-14 04:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:39:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:39:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6K9"}, "ts": "2023-07-14 04:39:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1483390", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:39:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1483390", "type": "PubMed"}, "ts": "2023-07-14 04:39:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T4S7.7.7"}, "ts": "2023-07-14 04:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4S7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:39:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-14 04:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20800521", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:39:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20800521", "type": "PubMed"}, "ts": "2023-07-14 04:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80108"}, "ts": "2023-07-14 04:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:41:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-14 04:41:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:41:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60673.1832.1832"}, "ts": "2023-07-14 04:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U367", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U367"}, "ts": "2023-07-14 04:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11279-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:41:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NVI7.588.588"}, "ts": "2023-07-14 04:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:41:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-14 04:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2H5-1"}, "ts": "2023-07-14 04:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2H5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:42:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23421541", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:42:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23421541", "type": "PubMed"}, "ts": "2023-07-14 04:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23421541", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 04:42:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03319HQ"}, "ts": "2023-07-14 04:43:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22083"}, "ts": "2023-07-14 04:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99944", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:43:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99944.204.204"}, "ts": "2023-07-14 04:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29958295", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:44:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29958295", "type": "PubMed"}, "ts": "2023-07-14 04:44:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2844223", "type": "PubMed"}, "ts": "2023-07-14 04:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2844223", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:44:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24107381", "type": "PubMed"}, "ts": "2023-07-14 04:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24107381", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:44:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48047"}, "ts": "2023-07-14 04:44:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z127"}, "ts": "2023-07-14 04:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:45:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q76LX8.1060.1060"}, "ts": "2023-07-14 04:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40189", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:45:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40189.762.762"}, "ts": "2023-07-14 04:45:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20807"}, "ts": "2023-07-14 04:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20807", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBJ7"}, "ts": "2023-07-14 04:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-14 04:46:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43426"}, "ts": "2023-07-14 04:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-14 04:46:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-14 04:46:34 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-14 04:46:35 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-14 04:46:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N1Z4-1"}, "ts": "2023-07-14 04:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N1Z4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88704-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:47:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88704-1"}, "ts": "2023-07-14 04:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43916"}, "ts": "2023-07-14 04:47:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q33DR3-1"}, "ts": "2023-07-14 04:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q33DR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41236", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:48:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41236.77.77"}, "ts": "2023-07-14 04:48:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:49:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UP6"}, "ts": "2023-07-14 04:49:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02751-15.866.866"}, "ts": "2023-07-14 04:49:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:49:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:49:13 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 04:49:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 04:49:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-14 04:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99470", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:49:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99470.100.100"}, "ts": "2023-07-14 04:49:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPN6.89.89"}, "ts": "2023-07-14 04:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 04:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPN6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:49:31 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)", "term_category": "any"}, "ts": "2023-07-14 04:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30044"}, "ts": "2023-07-14 04:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30044", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 04:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:49:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-14 04:49:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-14 04:49:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53962WT"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06209KS"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08520NM"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11637WL"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51367TM"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37166HP"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82942ZJ"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33734YD"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84852GW"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04576KS"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44617UT"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97720QM"}, "ts": "2023-07-14 04:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-14 04:49:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:49:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34100DU"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33508VK"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04765GH"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86537AD"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01457KB"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07677VL"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05848DX"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13260JU"}, "ts": "2023-07-14 04:49:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23438NR"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41424HD"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86186US"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70125XL"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69500TM"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52144RR"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66419SM"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29231AT"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37653KL"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07932PU"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03670RH"}, "ts": "2023-07-14 04:49:43 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:49:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24794ZA"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09912GB"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49844LC"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96079CK"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69631DE"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09343VX"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180UW"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81303NJ"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59529EG"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80105XT"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77557JA"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765JV"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01455VM"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13496UJ"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30089VH"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84074", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:49:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95151JF"}, "ts": "2023-07-14 04:49:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84074"}, "ts": "2023-07-14 04:49:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03146JP"}, "ts": "2023-07-14 04:49:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59588WY"}, "ts": "2023-07-14 04:49:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44407SY"}, "ts": "2023-07-14 04:49:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21472XU"}, "ts": "2023-07-14 04:49:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "269b8e3e0e2d48002b2d4a6505934c8a", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-14 04:49:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60735SE"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47947JW"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65137ZN"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22745SA"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77152WY"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21100PW"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88162NH"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28134WJ"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29432PD"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20174EZ"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84641CT"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66244VX"}, "ts": "2023-07-14 04:49:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51984GX"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18892PE"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35689CT"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58314JG"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00038MO"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40740AD"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60275BG"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92378XH"}, "ts": "2023-07-14 04:49:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8194769", "type": "PubMed"}, "ts": "2023-07-14 04:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8194769", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31930", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:50:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31930.148.148"}, "ts": "2023-07-14 04:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:50:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52209"}, "ts": "2023-07-14 04:51:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 04:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:51:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-14 04:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969U6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:51:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969U6"}, "ts": "2023-07-14 04:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:52:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBY0"}, "ts": "2023-07-14 04:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15392"}, "ts": "2023-07-14 04:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15392", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L985"}, "ts": "2023-07-14 04:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L985", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:52:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPY3.15.15"}, "ts": "2023-07-14 04:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NF91"}, "ts": "2023-07-14 04:52:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NF91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:52:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-14 04:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KQU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KQU3"}, "ts": "2023-07-14 04:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D1K2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D1K2"}, "ts": "2023-07-14 04:53:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:54:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16104-1"}, "ts": "2023-07-14 04:54:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96N66"}, "ts": "2023-07-14 04:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0I1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0I1"}, "ts": "2023-07-14 04:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBU9"}, "ts": "2023-07-14 04:54:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:54:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92560-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:54:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92560-1.493.493"}, "ts": "2023-07-14 04:54:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32920546", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:54:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32920546", "type": "PubMed"}, "ts": "2023-07-14 04:54:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80W65", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:54:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80W65.50.50"}, "ts": "2023-07-14 04:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32920546", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 04:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26378", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:55:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26378"}, "ts": "2023-07-14 04:55:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IUX8"}, "ts": "2023-07-14 04:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:55:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22509"}, "ts": "2023-07-14 04:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22509", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNC4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 04:56:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNC4"}, "ts": "2023-07-14 04:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:56:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXW9-1"}, "ts": "2023-07-14 04:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXW9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:56:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16511563", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:56:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16511563", "type": "PubMed"}, "ts": "2023-07-14 04:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12955717", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:56:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12955717", "type": "PubMed"}, "ts": "2023-07-14 04:56:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CXN7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:56:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CXN7"}, "ts": "2023-07-14 04:56:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0R8"}, "ts": "2023-07-14 04:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:56:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2264928", "type": "PubMed"}, "ts": "2023-07-14 04:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2264928", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01031-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:58:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:58:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UP3.553.553"}, "ts": "2023-07-14 04:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:58:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACI1"}, "ts": "2023-07-14 04:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:58:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14210-1.566.566"}, "ts": "2023-07-14 04:58:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-14 04:58:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09958"}, "ts": "2023-07-14 04:59:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09958", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8836150", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:59:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8836150", "type": "PubMed"}, "ts": "2023-07-14 04:59:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 04:59:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14672"}, "ts": "2023-07-14 04:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:59:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UN15.304.304"}, "ts": "2023-07-14 04:59:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UN15", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 04:59:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2153914", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 04:59:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2153914", "type": "PubMed"}, "ts": "2023-07-14 04:59:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-14 04:59:54 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 05:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 05:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 05:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 05:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 05:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 05:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-14 05:00:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-14 05:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56959"}, "ts": "2023-07-14 05:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q497B7"}, "ts": "2023-07-14 05:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q497B7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13639-1"}, "ts": "2023-07-14 05:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28867141", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:00:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28867141", "type": "PubMed"}, "ts": "2023-07-14 05:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28867141", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 05:00:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:01:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43491.39.39"}, "ts": "2023-07-14 05:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43491", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:01:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920R6"}, "ts": "2023-07-14 05:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920R6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:01:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16822"}, "ts": "2023-07-14 05:01:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16822"}, "ts": "2023-07-14 05:01:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61221"}, "ts": "2023-07-14 05:01:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13427"}, "ts": "2023-07-14 05:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95684", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:02:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95684.3.3"}, "ts": "2023-07-14 05:02:01 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 05:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 05:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 05:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "TT2C18", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-14 05:02:28 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "TT2C18"}, "ts": "2023-07-14 05:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 05:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "TT2C18", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=TT2C18"}, "ts": "2023-07-14 05:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 05:02:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49792.1011.1011"}, "ts": "2023-07-14 05:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49792", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C18", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-14 05:02:38 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "C18"}, "ts": "2023-07-14 05:02:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 05:02:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C18", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=C18"}, "ts": "2023-07-14 05:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 05:02:40 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 05:02:41 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "38e69aea4a7c18bc605213413dad6751", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 05:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "38e69aea4a7c18bc605213413dad6751", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 05:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:02:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62841", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:02:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62841"}, "ts": "2023-07-14 05:02:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92876"}, "ts": "2023-07-14 05:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:03:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56851CO"}, "ts": "2023-07-14 05:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56851CO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:03:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55344.61.61"}, "ts": "2023-07-14 05:03:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55344", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:03:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-14 05:03:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNA4"}, "ts": "2023-07-14 05:03:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:04:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:05:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHP6"}, "ts": "2023-07-14 05:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MN2-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:05:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96MN2-1.606.606"}, "ts": "2023-07-14 05:05:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 05:05:21 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 05:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 05:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9651501", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:05:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9651501", "type": "PubMed"}, "ts": "2023-07-14 05:05:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L33"}, "ts": "2023-07-14 05:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:06:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N446.249.249"}, "ts": "2023-07-14 05:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N446", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:07:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11049-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11049-1"}, "ts": "2023-07-14 05:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:07:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:07:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-14 05:08:05 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 05:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 05:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 05:08:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07996-1.1083.1083"}, "ts": "2023-07-14 05:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07996-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZV5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:08:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZV5.267.267"}, "ts": "2023-07-14 05:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:08:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1875909", "type": "PubMed"}, "ts": "2023-07-14 05:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1875909", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "TT2C18", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-14 05:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 05:08:19 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "TT2C18"}, "ts": "2023-07-14 05:08:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 05:08:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "TT2C18", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=TT2C18"}, "ts": "2023-07-14 05:08:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35274.205.205"}, "ts": "2023-07-14 05:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35274", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:08:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 05:08:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02730"}, "ts": "2023-07-14 05:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z443", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 05:08:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q7Z443", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 05:08:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q61043", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 05:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61043", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 05:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8E9"}, "ts": "2023-07-14 05:09:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:09:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXK5"}, "ts": "2023-07-14 05:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:09:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-14 05:09:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UWB1.8.8"}, "ts": "2023-07-14 05:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWB1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:10:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13611.569.569"}, "ts": "2023-07-14 05:10:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18077"}, "ts": "2023-07-14 05:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60565"}, "ts": "2023-07-14 05:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60565", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:11:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDM6.1021.1021"}, "ts": "2023-07-14 05:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDM6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:11:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21300913", "type": "PubMed"}, "ts": "2023-07-14 05:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21300913", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:12:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00422", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:12:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00422.149.149"}, "ts": "2023-07-14 05:12:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22590573", "type": "PubMed"}, "ts": "2023-07-14 05:13:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22590573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:13:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97449.852.852"}, "ts": "2023-07-14 05:13:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97449", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12786757", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:13:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12786757", "type": "PubMed"}, "ts": "2023-07-14 05:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:14:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00629"}, "ts": "2023-07-14 05:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14672", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:15:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-14 05:16:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70309-1"}, "ts": "2023-07-14 05:16:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQ94.436.436"}, "ts": "2023-07-14 05:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ94", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70309-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:16:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:16:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X51"}, "ts": "2023-07-14 05:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:16:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:16:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13639-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:16:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26888187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:16:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26888187", "type": "PubMed"}, "ts": "2023-07-14 05:16:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14921"}, "ts": "2023-07-14 05:16:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26358"}, "ts": "2023-07-14 05:17:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26358"}, "ts": "2023-07-14 05:17:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16822", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:17:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4J6-1"}, "ts": "2023-07-14 05:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4J6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61221", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ASU6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:17:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ASU6-1"}, "ts": "2023-07-14 05:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M842-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M842-1"}, "ts": "2023-07-14 05:18:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-14 05:18:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g00052mo"}, "ts": "2023-07-14 05:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01584", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:19:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01584.214.214"}, "ts": "2023-07-14 05:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15488", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:19:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15488.277.277"}, "ts": "2023-07-14 05:19:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21478870", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:19:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21478870", "type": "PubMed"}, "ts": "2023-07-14 05:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 05:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75694", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:20:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75694"}, "ts": "2023-07-14 05:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q148R9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:20:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q148R9-1"}, "ts": "2023-07-14 05:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:20:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZQ1"}, "ts": "2023-07-14 05:20:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:20:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCF1-1"}, "ts": "2023-07-14 05:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14618", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:21:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14618.264.264"}, "ts": "2023-07-14 05:21:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50851", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:21:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50851.979.979"}, "ts": "2023-07-14 05:21:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2Y2"}, "ts": "2023-07-14 05:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2Y2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:21:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33991.712.712"}, "ts": "2023-07-14 05:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33991", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34107992", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:22:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34107992", "type": "PubMed"}, "ts": "2023-07-14 05:22:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34107992", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 05:22:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-14 05:22:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:22:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5F1.596.596"}, "ts": "2023-07-14 05:22:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55097ES"}, "ts": "2023-07-14 05:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55097ES", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:23:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2D0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:23:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2D0.291.291"}, "ts": "2023-07-14 05:23:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18869TR"}, "ts": "2023-07-14 05:23:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28325905", "type": "PubMed"}, "ts": "2023-07-14 05:23:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18869TR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28325905", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:23:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-14 05:23:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0E3.465.465"}, "ts": "2023-07-14 05:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:23:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92673"}, "ts": "2023-07-14 05:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92673", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:24:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-14 05:24:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22079.315.315"}, "ts": "2023-07-14 05:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22079", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:24:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11465", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11465"}, "ts": "2023-07-14 05:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHV9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:24:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHV9-1"}, "ts": "2023-07-14 05:24:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8C437.388.388"}, "ts": "2023-07-14 05:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C437", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:25:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-14 05:25:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-14 05:25:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08485", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:25:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08485"}, "ts": "2023-07-14 05:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32236629", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:25:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32236629", "type": "PubMed"}, "ts": "2023-07-14 05:25:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32236629", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 05:25:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M830"}, "ts": "2023-07-14 05:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:25:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NVU6"}, "ts": "2023-07-14 05:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NVU6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31802126", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:25:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31802126", "type": "PubMed"}, "ts": "2023-07-14 05:25:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92543"}, "ts": "2023-07-14 05:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29383885", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:26:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29383885", "type": "PubMed"}, "ts": "2023-07-14 05:26:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15389.205.205"}, "ts": "2023-07-14 05:26:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15389", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:26:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23936226", "type": "PubMed"}, "ts": "2023-07-14 05:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23936226", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23936226", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 05:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18219CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:27:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18219CJ"}, "ts": "2023-07-14 05:27:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08575.167.167"}, "ts": "2023-07-14 05:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97846", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:28:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97846.277.277"}, "ts": "2023-07-14 05:28:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVM6-1"}, "ts": "2023-07-14 05:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:28:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWW6.230.230"}, "ts": "2023-07-14 05:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVM6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:28:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15788"}, "ts": "2023-07-14 05:28:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:28:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:28:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08538"}, "ts": "2023-07-14 05:28:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08538", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:28:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-14 05:28:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43736"}, "ts": "2023-07-14 05:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43736", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:28:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14CX5"}, "ts": "2023-07-14 05:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14CX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:29:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9065401", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:29:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9065401", "type": "PubMed"}, "ts": "2023-07-14 05:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:29:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99871"}, "ts": "2023-07-14 05:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27615-1"}, "ts": "2023-07-14 05:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27615-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:29:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P35439-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 05:30:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5H2.257.257"}, "ts": "2023-07-14 05:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:30:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13994", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:31:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13994.28.28"}, "ts": "2023-07-14 05:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00469", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:31:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00469.63.63"}, "ts": "2023-07-14 05:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10275-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:31:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10275-1"}, "ts": "2023-07-14 05:31:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6C9.212.212"}, "ts": "2023-07-14 05:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6C9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:31:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96FZ2.295.295"}, "ts": "2023-07-14 05:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1X1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:32:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1X1-1"}, "ts": "2023-07-14 05:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37868ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MV58-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:32:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2MV58-1.297.297"}, "ts": "2023-07-14 05:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:32:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43358"}, "ts": "2023-07-14 05:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43358", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:32:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 05:32:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHK9"}, "ts": "2023-07-14 05:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20239", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:32:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20239"}, "ts": "2023-07-14 05:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHK9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:32:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52954.85.85"}, "ts": "2023-07-14 05:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26358", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:33:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6VH22", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6VH22"}, "ts": "2023-07-14 05:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18079109", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:33:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18079109", "type": "PubMed"}, "ts": "2023-07-14 05:33:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92985"}, "ts": "2023-07-14 05:33:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92985", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:34:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5"}, "ts": "2023-07-14 05:34:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:34:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXI2-1"}, "ts": "2023-07-14 05:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXI2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g00052mo", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:34:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15439"}, "ts": "2023-07-14 05:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15439", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 05:35:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCC8"}, "ts": "2023-07-14 05:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCC8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:35:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38398.63.63"}, "ts": "2023-07-14 05:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38398", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NEV9.87.87"}, "ts": "2023-07-14 05:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71RJ2"}, "ts": "2023-07-14 05:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBR4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBR4"}, "ts": "2023-07-14 05:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:37:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210"}, "ts": "2023-07-14 05:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:37:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-14 05:37:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10369680", "type": "PubMed"}, "ts": "2023-07-14 05:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10369680", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:37:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-14 05:37:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NVV9"}, "ts": "2023-07-14 05:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NVV9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31275300", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:37:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31275300", "type": "PubMed"}, "ts": "2023-07-14 05:37:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUV9.128.128"}, "ts": "2023-07-14 05:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ZAU7"}, "ts": "2023-07-14 05:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ZAU7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6Z1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6Z1"}, "ts": "2023-07-14 05:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2026597", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:38:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2026597", "type": "PubMed"}, "ts": "2023-07-14 05:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:38:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5I1"}, "ts": "2023-07-14 05:38:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75449", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:38:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75449.362.362"}, "ts": "2023-07-14 05:38:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23510", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:39:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23510"}, "ts": "2023-07-14 05:39:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96Q42"}, "ts": "2023-07-14 05:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:39:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:39:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-14 05:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99L90", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:39:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99L90.282.282"}, "ts": "2023-07-14 05:39:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09651-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:40:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09651-1"}, "ts": "2023-07-14 05:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "I3L1E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:40:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "I3L1E1"}, "ts": "2023-07-14 05:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71013KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49773-1"}, "ts": "2023-07-14 05:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49773-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:40:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M4Q5-1"}, "ts": "2023-07-14 05:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M4Q5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:40:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 05:40:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Z2A9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 05:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2A9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 05:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:41:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51681"}, "ts": "2023-07-14 05:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51681", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:41:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HAP2.485.485"}, "ts": "2023-07-14 05:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAP2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14520415", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10070"}, "ts": "2023-07-14 05:41:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14520415", "type": "PubMed"}, "ts": "2023-07-14 05:41:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54764.231.231"}, "ts": "2023-07-14 05:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54764", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10144", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:41:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10144"}, "ts": "2023-07-14 05:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3SXY7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:42:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3SXY7.111.111"}, "ts": "2023-07-14 05:42:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13224.832.832"}, "ts": "2023-07-14 05:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13224", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:42:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63ZY3.92.92"}, "ts": "2023-07-14 05:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63ZY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92503"}, "ts": "2023-07-14 05:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92503", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:42:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01876.105.105"}, "ts": "2023-07-14 05:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:43:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6DKK2.310.310"}, "ts": "2023-07-14 05:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DKK2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:43:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30931947", "type": "PubMed"}, "ts": "2023-07-14 05:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30931947", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:43:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TL0"}, "ts": "2023-07-14 05:43:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15116"}, "ts": "2023-07-14 05:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:43:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31126802", "type": "PubMed"}, "ts": "2023-07-14 05:44:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31126802", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:44:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42658", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:44:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42658.124.124"}, "ts": "2023-07-14 05:44:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52292"}, "ts": "2023-07-14 05:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50045TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:44:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12084985", "type": "PubMed"}, "ts": "2023-07-14 05:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12084985", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26038"}, "ts": "2023-07-14 05:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:45:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49070-1"}, "ts": "2023-07-14 05:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TE4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:45:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86TE4.277.277"}, "ts": "2023-07-14 05:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-14 05:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:46:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14997", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:46:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14997.191.191"}, "ts": "2023-07-14 05:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08289"}, "ts": "2023-07-14 05:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:46:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2M0"}, "ts": "2023-07-14 05:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2M0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q641Z5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:47:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q641Z5"}, "ts": "2023-07-14 05:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43776", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:47:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43776.393.393"}, "ts": "2023-07-14 05:47:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86Z14.410.410"}, "ts": "2023-07-14 05:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Z14", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21504830", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:47:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21504830", "type": "PubMed"}, "ts": "2023-07-14 05:47:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66K66", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:47:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q66K66.319.319"}, "ts": "2023-07-14 05:47:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76HP3"}, "ts": "2023-07-14 05:48:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76HP3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:48:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32302.28.28"}, "ts": "2023-07-14 05:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32302", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:49:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZF0.297.297"}, "ts": "2023-07-14 05:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:49:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-14 05:50:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-14 05:50:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-14 05:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09028-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09028-1"}, "ts": "2023-07-14 05:50:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80Y24", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:51:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80Y24.608.608"}, "ts": "2023-07-14 05:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16282325", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:51:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16282325", "type": "PubMed"}, "ts": "2023-07-14 05:51:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTD8"}, "ts": "2023-07-14 05:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17275", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:51:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17275.100.100"}, "ts": "2023-07-14 05:51:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NI73"}, "ts": "2023-07-14 05:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NI73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:52:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5L7.194.194"}, "ts": "2023-07-14 05:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5L7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:52:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92819.221.221"}, "ts": "2023-07-14 05:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:52:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLN4"}, "ts": "2023-07-14 05:52:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923Y9"}, "ts": "2023-07-14 05:52:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923Y9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK65"}, "ts": "2023-07-14 05:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12606758", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:52:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12606758", "type": "PubMed"}, "ts": "2023-07-14 05:52:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43852", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:53:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43852.300.300"}, "ts": "2023-07-14 05:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:53:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29320.337.337"}, "ts": "2023-07-14 05:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29320", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08493", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 05:53:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q08493", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 05:53:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22735"}, "ts": "2023-07-14 05:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:55:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03252", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:55:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03252"}, "ts": "2023-07-14 05:55:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23333241", "type": "PubMed"}, "ts": "2023-07-14 05:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23333241", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:55:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49225WK"}, "ts": "2023-07-14 05:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49225WK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 05:55:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253-1"}, "ts": "2023-07-14 05:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35233", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:56:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35233"}, "ts": "2023-07-14 05:56:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:57:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8265339", "type": "PubMed"}, "ts": "2023-07-14 05:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8265339", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 05:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYX4-1"}, "ts": "2023-07-14 05:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYX4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:57:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-14 05:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2W8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:57:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2W8"}, "ts": "2023-07-14 05:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H665"}, "ts": "2023-07-14 05:59:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H665", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 05:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-14 05:59:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4C2"}, "ts": "2023-07-14 05:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-14 05:59:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55036.266.266"}, "ts": "2023-07-14 05:59:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55036", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:59:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0I4.843.843"}, "ts": "2023-07-14 05:59:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0I4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 05:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY84", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 05:59:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY84"}, "ts": "2023-07-14 06:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 06:00:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 06:00:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 06:00:04 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 06:00:04 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 06:00:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 06:00:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52292", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:00:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-14 06:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21932"}, "ts": "2023-07-14 06:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21932", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP80-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:01:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP80-1"}, "ts": "2023-07-14 06:01:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18065"}, "ts": "2023-07-14 06:01:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-14 06:01:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N446.238.238"}, "ts": "2023-07-14 06:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:01:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11526106", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:02:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11526106", "type": "PubMed"}, "ts": "2023-07-14 06:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19041750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:02:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19041750", "type": "PubMed"}, "ts": "2023-07-14 06:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:03:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60602"}, "ts": "2023-07-14 06:03:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-14 06:03:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07359"}, "ts": "2023-07-14 06:03:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ3"}, "ts": "2023-07-14 06:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19109256", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:03:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19109256", "type": "PubMed"}, "ts": "2023-07-14 06:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1856230", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:04:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1856230", "type": "PubMed"}, "ts": "2023-07-14 06:04:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-14 06:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:04:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQC7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:05:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQC7"}, "ts": "2023-07-14 06:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54290-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:05:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54290-1.323.323"}, "ts": "2023-07-14 06:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:06:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z139"}, "ts": "2023-07-14 06:06:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31150649", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:06:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31150649", "type": "PubMed"}, "ts": "2023-07-14 06:06:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31150649", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 06:06:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96577RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 06:06:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NLJ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:06:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NLJ0"}, "ts": "2023-07-14 06:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 06:06:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06210"}, "ts": "2023-07-14 06:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35579", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:07:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35579.389.389"}, "ts": "2023-07-14 06:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:07:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21730"}, "ts": "2023-07-14 06:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62230", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:07:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62230"}, "ts": "2023-07-14 06:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15761-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:07:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15761-1"}, "ts": "2023-07-14 06:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WGJ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:08:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2WGJ6"}, "ts": "2023-07-14 06:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIS9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:08:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIS9.391.391"}, "ts": "2023-07-14 06:08:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V188-1"}, "ts": "2023-07-14 06:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V188-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2T1"}, "ts": "2023-07-14 06:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDR2-1"}, "ts": "2023-07-14 06:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDR2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25024", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 06:09:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P25024", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 06:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25024", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 06:09:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20142513", "type": "PubMed"}, "ts": "2023-07-14 06:09:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01726.157.157"}, "ts": "2023-07-14 06:09:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20142513", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:09:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01726", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-14 06:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:10:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55011"}, "ts": "2023-07-14 06:10:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12872260", "type": "PubMed"}, "ts": "2023-07-14 06:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12872260", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35331", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:10:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35331"}, "ts": "2023-07-14 06:10:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQC9"}, "ts": "2023-07-14 06:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10253-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923K1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:11:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q923K1.482.482"}, "ts": "2023-07-14 06:11:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28965849", "type": "PubMed"}, "ts": "2023-07-14 06:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28965849", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JM99", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:12:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JM99.354.354"}, "ts": "2023-07-14 06:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:12:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBW0.75.75"}, "ts": "2023-07-14 06:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:12:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60664.50.50"}, "ts": "2023-07-14 06:12:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20823"}, "ts": "2023-07-14 06:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:12:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQF2.351.351"}, "ts": "2023-07-14 06:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQF2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:12:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60894"}, "ts": "2023-07-14 06:12:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69849"}, "ts": "2023-07-14 06:12:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P37198.127.127"}, "ts": "2023-07-14 06:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37198", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:12:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMS5"}, "ts": "2023-07-14 06:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LH1"}, "ts": "2023-07-14 06:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:13:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6R7.868.868"}, "ts": "2023-07-14 06:13:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "A4D126", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 06:13:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D126", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 06:13:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33121"}, "ts": "2023-07-14 06:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:13:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15021"}, "ts": "2023-07-14 06:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0J7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0J7"}, "ts": "2023-07-14 06:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61265-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61265-1"}, "ts": "2023-07-14 06:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PB8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:15:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PB8.94.94"}, "ts": "2023-07-14 06:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95573"}, "ts": "2023-07-14 06:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2VLH6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:15:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2VLH6"}, "ts": "2023-07-14 06:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:15:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEL6.40.40"}, "ts": "2023-07-14 06:15:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:15:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1P5-1"}, "ts": "2023-07-14 06:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1P5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99700", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:15:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99700.776.776"}, "ts": "2023-07-14 06:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSN7-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00472", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:16:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00472.506.506"}, "ts": "2023-07-14 06:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19958IL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 06:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:16:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60347"}, "ts": "2023-07-14 06:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YZP9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:16:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "D3YZP9.45.45"}, "ts": "2023-07-14 06:16:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-14 06:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:17:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48029", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:17:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48029.604.604"}, "ts": "2023-07-14 06:17:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PU5.453.453"}, "ts": "2023-07-14 06:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:18:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00441"}, "ts": "2023-07-14 06:18:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51955-1"}, "ts": "2023-07-14 06:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51955-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:18:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZZ09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:19:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZZ09"}, "ts": "2023-07-14 06:19:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYD9.16.16"}, "ts": "2023-07-14 06:19:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYD9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11127-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11127-1"}, "ts": "2023-07-14 06:19:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-14 06:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WBS4-1"}, "ts": "2023-07-14 06:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WBS4-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:20:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXL0.307.307"}, "ts": "2023-07-14 06:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXL0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EQ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EQ8"}, "ts": "2023-07-14 06:20:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1F8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:20:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1F8-1"}, "ts": "2023-07-14 06:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:21:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAA1"}, "ts": "2023-07-14 06:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21575-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21575-1"}, "ts": "2023-07-14 06:21:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQF2.103.103"}, "ts": "2023-07-14 06:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11027579", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:22:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11027579", "type": "PubMed"}, "ts": "2023-07-14 06:22:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01844", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:22:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01844.254.254"}, "ts": "2023-07-14 06:22:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6D5-1"}, "ts": "2023-07-14 06:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6D5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:22:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS40"}, "ts": "2023-07-14 06:22:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-14 06:22:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-14 06:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:22:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13693.64.64"}, "ts": "2023-07-14 06:22:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13693", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:22:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15713785", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:23:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15713785", "type": "PubMed"}, "ts": "2023-07-14 06:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A7A5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:23:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A7A5-1"}, "ts": "2023-07-14 06:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:23:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22721921", "type": "PubMed"}, "ts": "2023-07-14 06:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22721921", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15149", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:23:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15149.305.305"}, "ts": "2023-07-14 06:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1I8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:24:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1I8"}, "ts": "2023-07-14 06:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3Q0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:24:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3Q0"}, "ts": "2023-07-14 06:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSJ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:24:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BSJ6.201.201"}, "ts": "2023-07-14 06:24:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15464227", "type": "PubMed"}, "ts": "2023-07-14 06:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15464227", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:25:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPR2"}, "ts": "2023-07-14 06:25:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:25:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6X8Z9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:25:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6X8Z9"}, "ts": "2023-07-14 06:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:25:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08047"}, "ts": "2023-07-14 06:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWA0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:26:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-14 06:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5KU26-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 06:26:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5KU26-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 06:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5KU26-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 06:26:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55011", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:26:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBJ4"}, "ts": "2023-07-14 06:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZR10", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:27:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "D3ZR10.270.270"}, "ts": "2023-07-14 06:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08999", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:28:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08999"}, "ts": "2023-07-14 06:28:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D110-1"}, "ts": "2023-07-14 06:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D110-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:28:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ20-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:28:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ20-1"}, "ts": "2023-07-14 06:28:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:28:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75351"}, "ts": "2023-07-14 06:29:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15391.348.348"}, "ts": "2023-07-14 06:29:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15391", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:29:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MX3-1"}, "ts": "2023-07-14 06:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MX3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:29:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-14 06:29:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55144.859.859"}, "ts": "2023-07-14 06:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55144", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16066"}, "ts": "2023-07-14 06:29:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16066", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:29:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21856776", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:30:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21856776", "type": "PubMed"}, "ts": "2023-07-14 06:30:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-14 06:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IPM2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:30:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IPM2"}, "ts": "2023-07-14 06:30:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00911-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:31:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00911-1"}, "ts": "2023-07-14 06:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:31:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHV9"}, "ts": "2023-07-14 06:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:32:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31809", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:32:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31809"}, "ts": "2023-07-14 06:32:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:32:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32942"}, "ts": "2023-07-14 06:32:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VV43.154.154"}, "ts": "2023-07-14 06:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV43", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25445"}, "ts": "2023-07-14 06:32:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE23"}, "ts": "2023-07-14 06:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:32:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-14 06:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25674224", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:32:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25674224", "type": "PubMed"}, "ts": "2023-07-14 06:32:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9659228", "type": "PubMed"}, "ts": "2023-07-14 06:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9659228", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:33:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BVQ5"}, "ts": "2023-07-14 06:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:33:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0X0-1"}, "ts": "2023-07-14 06:33:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0X0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:33:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14517953", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:33:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14517953", "type": "PubMed"}, "ts": "2023-07-14 06:33:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1ARI9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:34:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1ARI9-1"}, "ts": "2023-07-14 06:34:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96R27.272.272"}, "ts": "2023-07-14 06:34:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R27", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35295-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:34:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35295-1"}, "ts": "2023-07-14 06:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:35:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68CZ2.113.113"}, "ts": "2023-07-14 06:35:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11940607", "type": "PubMed"}, "ts": "2023-07-14 06:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11940607", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35408", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35408"}, "ts": "2023-07-14 06:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61266"}, "ts": "2023-07-14 06:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61266", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:36:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZS6.134.134"}, "ts": "2023-07-14 06:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:36:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13347-1"}, "ts": "2023-07-14 06:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13347-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26161668", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:36:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26161668", "type": "PubMed"}, "ts": "2023-07-14 06:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43301", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:37:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43301.376.376"}, "ts": "2023-07-14 06:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15047"}, "ts": "2023-07-14 06:37:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R688"}, "ts": "2023-07-14 06:37:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:37:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UGC7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:37:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UGC7-1"}, "ts": "2023-07-14 06:37:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQ30", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQ30"}, "ts": "2023-07-14 06:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG53"}, "ts": "2023-07-14 06:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10373325", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:37:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10373325", "type": "PubMed"}, "ts": "2023-07-14 06:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11511", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:38:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11511.392.392"}, "ts": "2023-07-14 06:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15511219", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:38:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15511219", "type": "PubMed"}, "ts": "2023-07-14 06:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16959576", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:38:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16959576", "type": "PubMed"}, "ts": "2023-07-14 06:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:38:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83876"}, "ts": "2023-07-14 06:38:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYV4.612.612"}, "ts": "2023-07-14 06:39:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:39:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98172.287.287"}, "ts": "2023-07-14 06:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98172", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:39:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29457838", "type": "PubMed"}, "ts": "2023-07-14 06:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29457838", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:40:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08670.33.33"}, "ts": "2023-07-14 06:40:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08670", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:40:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29457838", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 06:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30530", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:41:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30530.40.40"}, "ts": "2023-07-14 06:41:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14791.59.59"}, "ts": "2023-07-14 06:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14791", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15006"}, "ts": "2023-07-14 06:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15006", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRS8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:41:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BRS8.19.19"}, "ts": "2023-07-14 06:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21333", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:41:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21333.720.720"}, "ts": "2023-07-14 06:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 06:42:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6UVM3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 06:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVM3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 06:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:42:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWZ8"}, "ts": "2023-07-14 06:42:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11123271", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:42:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11123271", "type": "PubMed"}, "ts": "2023-07-14 06:42:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:42:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19827"}, "ts": "2023-07-14 06:42:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGG4-1"}, "ts": "2023-07-14 06:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGG4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:43:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34935059", "type": "PubMed"}, "ts": "2023-07-14 06:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34935059", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34935059", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 06:43:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A571BES4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:43:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A571BES4"}, "ts": "2023-07-14 06:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48735", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:43:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48735.176.176"}, "ts": "2023-07-14 06:43:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00342"}, "ts": "2023-07-14 06:43:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK08-1"}, "ts": "2023-07-14 06:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK08-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:43:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N2E2.340.340"}, "ts": "2023-07-14 06:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2E2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:44:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VVX9-1"}, "ts": "2023-07-14 06:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VVX9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:44:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81827"}, "ts": "2023-07-14 06:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 06:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:45:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFY4"}, "ts": "2023-07-14 06:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:45:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:45:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96EG3.129.129"}, "ts": "2023-07-14 06:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EG3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:45:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y657-1"}, "ts": "2023-07-14 06:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y657-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:45:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-14 06:45:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34572530", "type": "PubMed"}, "ts": "2023-07-14 06:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34572530", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:45:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55022"}, "ts": "2023-07-14 06:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55022", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:45:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 06:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD9"}, "ts": "2023-07-14 06:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16109"}, "ts": "2023-07-14 06:46:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21102457", "type": "PubMed"}, "ts": "2023-07-14 06:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21102457", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:46:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22645316", "type": "PubMed"}, "ts": "2023-07-14 06:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22645316", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 06:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZ63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:47:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZ63.399.399"}, "ts": "2023-07-14 06:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16835242", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:47:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16835242", "type": "PubMed"}, "ts": "2023-07-14 06:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41224-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:47:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22608503", "type": "PubMed"}, "ts": "2023-07-14 06:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22608503", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:47:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11095434", "type": "PubMed"}, "ts": "2023-07-14 06:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11095434", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36269", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:48:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PL2.224.224"}, "ts": "2023-07-14 06:48:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36269.550.550"}, "ts": "2023-07-14 06:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:48:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M6V8-1"}, "ts": "2023-07-14 06:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M6V8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:48:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9208860", "type": "PubMed"}, "ts": "2023-07-14 06:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9208860", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:48:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96K76.933.933"}, "ts": "2023-07-14 06:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2CG71-1"}, "ts": "2023-07-14 06:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2CG71-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:48:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVV4.232.232"}, "ts": "2023-07-14 06:49:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:49:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20933"}, "ts": "2023-07-14 06:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:49:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:49:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-14 06:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBT3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:49:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NBT3.430.430"}, "ts": "2023-07-14 06:49:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-14 06:50:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95295"}, "ts": "2023-07-14 06:50:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32865561", "type": "PubMed"}, "ts": "2023-07-14 06:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32865561", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZL8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:50:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NZL8-1"}, "ts": "2023-07-14 06:50:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H9I0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:50:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H9I0"}, "ts": "2023-07-14 06:50:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZV2-1"}, "ts": "2023-07-14 06:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZV2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRE1"}, "ts": "2023-07-14 06:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:51:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXJ7.406.406"}, "ts": "2023-07-14 06:51:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-14 06:51:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LS21"}, "ts": "2023-07-14 06:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LS21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:51:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94875", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGP4"}, "ts": "2023-07-14 06:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22304", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:52:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22304.277.277"}, "ts": "2023-07-14 06:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31949"}, "ts": "2023-07-14 06:52:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FZ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FZ2"}, "ts": "2023-07-14 06:52:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V26"}, "ts": "2023-07-14 06:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V26", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53FV1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:54:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53FV1"}, "ts": "2023-07-14 06:54:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22382862", "type": "PubMed"}, "ts": "2023-07-14 06:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22382862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:54:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62919"}, "ts": "2023-07-14 06:54:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-14 06:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:54:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68668TB"}, "ts": "2023-07-14 06:54:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23396"}, "ts": "2023-07-14 06:54:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHC6.389.389"}, "ts": "2023-07-14 06:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHC6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:54:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X29.185.185"}, "ts": "2023-07-14 06:55:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:55:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34040256", "type": "PubMed"}, "ts": "2023-07-14 06:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34040256", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:55:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9931343", "type": "PubMed"}, "ts": "2023-07-14 06:55:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9931343", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:55:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15599"}, "ts": "2023-07-14 06:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:55:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-14 06:55:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EU6-1"}, "ts": "2023-07-14 06:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EU6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:56:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-14 06:56:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-14 06:56:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-14 06:56:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 06:56:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-14 06:56:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-14 06:56:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 06:56:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-14 06:56:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80746IL"}, "ts": "2023-07-14 06:56:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U1W2"}, "ts": "2023-07-14 06:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1W2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:56:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15580289", "type": "PubMed"}, "ts": "2023-07-14 06:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15580289", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 06:56:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H492"}, "ts": "2023-07-14 06:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H492", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:56:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05026"}, "ts": "2023-07-14 06:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31431", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:57:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31431.97.97"}, "ts": "2023-07-14 06:57:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12235"}, "ts": "2023-07-14 06:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSG1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 06:58:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSG1"}, "ts": "2023-07-14 06:58:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NC74"}, "ts": "2023-07-14 06:58:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NC74", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:58:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-14 06:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62182OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 06:59:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Q6R3"}, "ts": "2023-07-14 06:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q6R3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BS35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:59:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BS35"}, "ts": "2023-07-14 06:59:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:59:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8Y8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 06:59:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H8Y8.47.47"}, "ts": "2023-07-14 06:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ARY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 06:59:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ARY0"}, "ts": "2023-07-14 06:59:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139-1"}, "ts": "2023-07-14 07:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 07:00:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 07:00:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 07:00:06 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 07:00:06 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 07:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 07:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139-1"}, "ts": "2023-07-14 07:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19456272", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:00:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19456272", "type": "PubMed"}, "ts": "2023-07-14 07:00:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6Q4G3.309.309"}, "ts": "2023-07-14 07:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q4G3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:01:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75914.133.133"}, "ts": "2023-07-14 07:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75914", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62182OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:01:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-14 07:01:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27626380", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:01:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27626380", "type": "PubMed"}, "ts": "2023-07-14 07:01:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27626380", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:01:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQ76"}, "ts": "2023-07-14 07:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:02:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31412620", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:02:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31412620", "type": "PubMed"}, "ts": "2023-07-14 07:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYG4"}, "ts": "2023-07-14 07:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9780177", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:03:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9780177", "type": "PubMed"}, "ts": "2023-07-14 07:03:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35550"}, "ts": "2023-07-14 07:03:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9391075", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:04:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9391075", "type": "PubMed"}, "ts": "2023-07-14 07:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1L3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 07:04:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Z1L3", "cluster_type": "unselected"}, "ts": "2023-07-14 07:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1L3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:04:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56856"}, "ts": "2023-07-14 07:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56856", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4FU01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:05:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4FU01"}, "ts": "2023-07-14 07:05:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33011563", "type": "PubMed"}, "ts": "2023-07-14 07:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33011563", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:05:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A4D2H0.585.585"}, "ts": "2023-07-14 07:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D2H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:05:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-14 07:05:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15688006", "type": "PubMed"}, "ts": "2023-07-14 07:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15688006", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 07:06:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:06:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15541", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 07:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 07:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95295", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:06:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-14 07:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17237713", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:06:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17237713", "type": "PubMed"}, "ts": "2023-07-14 07:06:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21397", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:07:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21397"}, "ts": "2023-07-14 07:07:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15409"}, "ts": "2023-07-14 07:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15409", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:07:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20425TQ"}, "ts": "2023-07-14 07:07:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12898236", "type": "PubMed"}, "ts": "2023-07-14 07:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12898236", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:07:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16717126", "type": "PubMed"}, "ts": "2023-07-14 07:07:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16717126", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:07:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21704"}, "ts": "2023-07-14 07:07:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21704", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:07:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91WJ7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:08:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91WJ7"}, "ts": "2023-07-14 07:08:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-14 07:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:08:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921V7"}, "ts": "2023-07-14 07:08:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:08:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IWH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:08:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IWH7"}, "ts": "2023-07-14 07:08:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY97", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:08:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY97.365.365"}, "ts": "2023-07-14 07:08:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-14 07:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:09:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0R8"}, "ts": "2023-07-14 07:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15063-1"}, "ts": "2023-07-14 07:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15063-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:09:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UK0"}, "ts": "2023-07-14 07:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:10:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD8"}, "ts": "2023-07-14 07:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23396", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68668TB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:10:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VEX6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:10:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VEX6"}, "ts": "2023-07-14 07:10:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33782119", "type": "PubMed"}, "ts": "2023-07-14 07:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33782119", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33782119", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:10:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DTC2.1074.1074"}, "ts": "2023-07-14 07:10:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-14 07:10:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12601080", "type": "PubMed"}, "ts": "2023-07-14 07:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12601080", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:11:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64803HZ"}, "ts": "2023-07-14 07:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64803HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:11:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9P6"}, "ts": "2023-07-14 07:11:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58858DY"}, "ts": "2023-07-14 07:11:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64803HZ"}, "ts": "2023-07-14 07:11:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02655"}, "ts": "2023-07-14 07:11:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-14 07:11:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:11:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2V0"}, "ts": "2023-07-14 07:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 07:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 07:12:12 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 07:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:12:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERK4"}, "ts": "2023-07-14 07:12:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLK8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:12:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLK8-1"}, "ts": "2023-07-14 07:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05026", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:12:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15061"}, "ts": "2023-07-14 07:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQB3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:13:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQB3"}, "ts": "2023-07-14 07:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:13:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28033-1"}, "ts": "2023-07-14 07:13:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DFE2-1"}, "ts": "2023-07-14 07:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DFE2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:14:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-14 07:14:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:14:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-14 07:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12946358", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:14:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12946358", "type": "PubMed"}, "ts": "2023-07-14 07:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0S5V8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:14:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0S5V8-1"}, "ts": "2023-07-14 07:14:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7670478", "type": "PubMed"}, "ts": "2023-07-14 07:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23868259", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7670478", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:15:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23868259", "type": "PubMed"}, "ts": "2023-07-14 07:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61759-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61759-1"}, "ts": "2023-07-14 07:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12402346", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:15:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12402346", "type": "PubMed"}, "ts": "2023-07-14 07:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:16:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPG1-1"}, "ts": "2023-07-14 07:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42025", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:17:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42025"}, "ts": "2023-07-14 07:17:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:18:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62888"}, "ts": "2023-07-14 07:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:18:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63633-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:18:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63633-1"}, "ts": "2023-07-14 07:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13123", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13123"}, "ts": "2023-07-14 07:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16623", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:19:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16623"}, "ts": "2023-07-14 07:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4S7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:19:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T4S7.181.181"}, "ts": "2023-07-14 07:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19628817", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:20:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19628817", "type": "PubMed"}, "ts": "2023-07-14 07:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-14 07:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:20:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09061"}, "ts": "2023-07-14 07:20:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ3-1"}, "ts": "2023-07-14 07:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:21:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92729.598.598"}, "ts": "2023-07-14 07:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92729", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41731", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:21:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41731"}, "ts": "2023-07-14 07:21:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20983SP"}, "ts": "2023-07-14 07:22:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R2P8-1"}, "ts": "2023-07-14 07:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2P8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00053MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:22:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05019-1"}, "ts": "2023-07-14 07:22:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05019-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:22:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63246"}, "ts": "2023-07-14 07:23:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63246", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 07:23:29 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 07:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 07:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:23:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969X2"}, "ts": "2023-07-14 07:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969X2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:24:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NX49-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NX49-1"}, "ts": "2023-07-14 07:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:25:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60220.14.14"}, "ts": "2023-07-14 07:25:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z175.626.626"}, "ts": "2023-07-14 07:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60220", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z175", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4B5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:25:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4B5.1256.1256"}, "ts": "2023-07-14 07:25:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15528"}, "ts": "2023-07-14 07:26:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15528", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30835", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16054028", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:27:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16054028", "type": "PubMed"}, "ts": "2023-07-14 07:27:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LX8"}, "ts": "2023-07-14 07:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:27:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08319.51.51"}, "ts": "2023-07-14 07:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08319", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33521930", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:28:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33521930", "type": "PubMed"}, "ts": "2023-07-14 07:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33521930", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:28:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54687", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:28:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54687.233.233"}, "ts": "2023-07-14 07:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12077346", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:29:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12077346", "type": "PubMed"}, "ts": "2023-07-14 07:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20725044", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:29:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20725044", "type": "PubMed"}, "ts": "2023-07-14 07:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18641401", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:29:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18641401", "type": "PubMed"}, "ts": "2023-07-14 07:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35136-1"}, "ts": "2023-07-14 07:29:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9P2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:30:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H9P2"}, "ts": "2023-07-14 07:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35136-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:30:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BX51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:30:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BX51"}, "ts": "2023-07-14 07:30:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:30:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTL9"}, "ts": "2023-07-14 07:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21262353", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:30:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21262353", "type": "PubMed"}, "ts": "2023-07-14 07:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20193842", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:31:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20193842", "type": "PubMed"}, "ts": "2023-07-14 07:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:31:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2V0"}, "ts": "2023-07-14 07:31:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61548.296.296"}, "ts": "2023-07-14 07:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61548", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97888-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:31:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97888-1"}, "ts": "2023-07-14 07:31:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07988"}, "ts": "2023-07-14 07:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:31:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30728747", "type": "PubMed"}, "ts": "2023-07-14 07:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30728747", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30728747", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:32:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32170560", "type": "PubMed"}, "ts": "2023-07-14 07:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32170560", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EBA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:33:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EBA0"}, "ts": "2023-07-14 07:33:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15153"}, "ts": "2023-07-14 07:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13234", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:33:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13234.337.337"}, "ts": "2023-07-14 07:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1P4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:33:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z1P4.792.792"}, "ts": "2023-07-14 07:33:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:34:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPQ7"}, "ts": "2023-07-14 07:34:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPQ7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:34:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4JEI8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:34:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4JEI8"}, "ts": "2023-07-14 07:34:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TC12"}, "ts": "2023-07-14 07:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:34:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TC12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:34:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61916"}, "ts": "2023-07-14 07:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:34:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13541"}, "ts": "2023-07-14 07:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZQJ5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:35:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZQJ5"}, "ts": "2023-07-14 07:35:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23229"}, "ts": "2023-07-14 07:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:36:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923Y9"}, "ts": "2023-07-14 07:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923Y9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30917308", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:37:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30917308", "type": "PubMed"}, "ts": "2023-07-14 07:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30917308", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20983SP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:37:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46718-1"}, "ts": "2023-07-14 07:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46718-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y287-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:39:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y287-1"}, "ts": "2023-07-14 07:39:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y487"}, "ts": "2023-07-14 07:39:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15041-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:39:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15041-1"}, "ts": "2023-07-14 07:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERK4"}, "ts": "2023-07-14 07:39:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13237-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 07:39:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13237-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 07:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:40:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09467", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:40:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09467"}, "ts": "2023-07-14 07:40:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08852.2122.2122"}, "ts": "2023-07-14 07:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08852", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:40:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXC0.256.256"}, "ts": "2023-07-14 07:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:40:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXD2"}, "ts": "2023-07-14 07:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:41:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00451.585.585"}, "ts": "2023-07-14 07:41:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CDE2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:42:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CDE2"}, "ts": "2023-07-14 07:42:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-14 07:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T9"}, "ts": "2023-07-14 07:42:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17167418", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:42:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17167418", "type": "PubMed"}, "ts": "2023-07-14 07:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-14 07:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-14 07:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21964", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:43:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21964"}, "ts": "2023-07-14 07:43:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2TL32.181.181"}, "ts": "2023-07-14 07:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2TL32", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:43:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92769.394.394"}, "ts": "2023-07-14 07:43:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92769", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:43:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKL3"}, "ts": "2023-07-14 07:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:44:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TBB1.490.490"}, "ts": "2023-07-14 07:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBB1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:44:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-14 07:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-14 07:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49913"}, "ts": "2023-07-14 07:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09681", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:46:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09681"}, "ts": "2023-07-14 07:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29274", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:46:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29274"}, "ts": "2023-07-14 07:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13807", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:46:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13807.641.641"}, "ts": "2023-07-14 07:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47782UT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:47:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47782UT"}, "ts": "2023-07-14 07:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21459ST", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 07:47:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21459ST"}, "ts": "2023-07-14 07:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYL7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:47:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYL7"}, "ts": "2023-07-14 07:47:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NCN5.206.206"}, "ts": "2023-07-14 07:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCN5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1S7"}, "ts": "2023-07-14 07:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1S7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P6S4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:47:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P6S4-1"}, "ts": "2023-07-14 07:47:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61548", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:48:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61548"}, "ts": "2023-07-14 07:48:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-14 07:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A1W8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:48:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A1W8"}, "ts": "2023-07-14 07:48:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24512202", "type": "PubMed"}, "ts": "2023-07-14 07:48:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24512202", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:48:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HT8"}, "ts": "2023-07-14 07:48:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HT8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:48:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30542.105.105"}, "ts": "2023-07-14 07:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30542", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14246", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:50:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14246.838.838"}, "ts": "2023-07-14 07:50:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5W0Q7"}, "ts": "2023-07-14 07:50:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5W0Q7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:50:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-14 07:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43403", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:50:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43403.319.319"}, "ts": "2023-07-14 07:50:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22004887", "type": "PubMed"}, "ts": "2023-07-14 07:51:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22004887", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91WA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:51:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91WA4"}, "ts": "2023-07-14 07:51:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09874"}, "ts": "2023-07-14 07:51:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50228", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:51:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50228"}, "ts": "2023-07-14 07:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13541", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBS5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:51:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBS5"}, "ts": "2023-07-14 07:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 07:51:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK65"}, "ts": "2023-07-14 07:51:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:52:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0X8"}, "ts": "2023-07-14 07:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0X8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:52:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33331818", "type": "PubMed"}, "ts": "2023-07-14 07:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33331818", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33331818", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12417528", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:52:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12417528", "type": "PubMed"}, "ts": "2023-07-14 07:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:52:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15151"}, "ts": "2023-07-14 07:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "H7BZ55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:52:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "H7BZ55"}, "ts": "2023-07-14 07:52:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25778398", "type": "PubMed"}, "ts": "2023-07-14 07:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25778398", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22005"}, "ts": "2023-07-14 07:53:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22005", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15853", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15853"}, "ts": "2023-07-14 07:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 07:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ4"}, "ts": "2023-07-14 07:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16194093", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:54:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16194093", "type": "PubMed"}, "ts": "2023-07-14 07:54:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-14 07:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZF5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:54:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZF5.660.660"}, "ts": "2023-07-14 07:54:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15569-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15569-1"}, "ts": "2023-07-14 07:55:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1324930", "type": "PubMed"}, "ts": "2023-07-14 07:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1324930", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9180264", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:55:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9180264", "type": "PubMed"}, "ts": "2023-07-14 07:55:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMP0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:56:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMP0.410.410"}, "ts": "2023-07-14 07:56:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17931"}, "ts": "2023-07-14 07:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:56:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32167655", "type": "PubMed"}, "ts": "2023-07-14 07:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32167655", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32167655", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8356058", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:56:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8356058", "type": "PubMed"}, "ts": "2023-07-14 07:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPQ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:56:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPQ3-1"}, "ts": "2023-07-14 07:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11463338", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:57:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11463338", "type": "PubMed"}, "ts": "2023-07-14 07:57:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2V7"}, "ts": "2023-07-14 07:57:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:57:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1408763", "type": "PubMed"}, "ts": "2023-07-14 07:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1408763", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:57:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21653862", "type": "PubMed"}, "ts": "2023-07-14 07:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21653862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12915443", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:57:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12915443", "type": "PubMed"}, "ts": "2023-07-14 07:57:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q58FF7"}, "ts": "2023-07-14 07:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q58FF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:57:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:57:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.392.392"}, "ts": "2023-07-14 07:57:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43307"}, "ts": "2023-07-14 07:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43307"}, "ts": "2023-07-14 07:57:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:58:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2526077"}, "ts": "2023-07-14 07:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 07:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14617756", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:58:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14617756", "type": "PubMed"}, "ts": "2023-07-14 07:58:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02786.407.407"}, "ts": "2023-07-14 07:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80SS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:58:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80SS6"}, "ts": "2023-07-14 07:58:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66K66"}, "ts": "2023-07-14 07:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66K66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 07:59:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12814.339.339"}, "ts": "2023-07-14 07:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12814", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUN1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:59:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BUN1.51.51"}, "ts": "2023-07-14 07:59:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33310872", "type": "PubMed"}, "ts": "2023-07-14 07:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33310872", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 07:59:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5IJ48.7.7"}, "ts": "2023-07-14 07:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5IJ48", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 07:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-14 07:59:52 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 08:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 08:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 08:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 08:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 08:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 08:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91023GB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 08:01:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-14 08:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:01:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42865BX"}, "ts": "2023-07-14 08:01:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-14 08:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGE9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:01:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CGE9.661.661"}, "ts": "2023-07-14 08:01:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZUN1-1"}, "ts": "2023-07-14 08:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZUN1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:02:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42865BX"}, "ts": "2023-07-14 08:02:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:02:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:02:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FS3"}, "ts": "2023-07-14 08:02:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01374"}, "ts": "2023-07-14 08:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01374", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:02:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99972.172.172"}, "ts": "2023-07-14 08:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99972", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11960", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:02:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11960.343.343"}, "ts": "2023-07-14 08:02:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07205.394.394"}, "ts": "2023-07-14 08:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07205", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12927808", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:03:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12927808", "type": "PubMed"}, "ts": "2023-07-14 08:03:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQG6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:03:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "D3ZQG6.371.371"}, "ts": "2023-07-14 08:03:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13207-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:03:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13207-1"}, "ts": "2023-07-14 08:03:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UN15"}, "ts": "2023-07-14 08:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UN15", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:04:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N6T7.303.303"}, "ts": "2023-07-14 08:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6T7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:04:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15118"}, "ts": "2023-07-14 08:04:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:05:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45452"}, "ts": "2023-07-14 08:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13634", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:05:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13634"}, "ts": "2023-07-14 08:05:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-14 08:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33953268", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:06:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33953268", "type": "PubMed"}, "ts": "2023-07-14 08:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:06:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-14 08:06:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3Z0.339.339"}, "ts": "2023-07-14 08:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3Z0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1315496", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:07:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1315496", "type": "PubMed"}, "ts": "2023-07-14 08:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:07:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17600", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:07:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17600.39.39"}, "ts": "2023-07-14 08:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26368", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:08:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26368.2.2"}, "ts": "2023-07-14 08:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 08:08:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20404107", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:08:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20404107", "type": "PubMed"}, "ts": "2023-07-14 08:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47862", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 08:08:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P47862", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 08:08:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M6Z4-1"}, "ts": "2023-07-14 08:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M6Z4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:08:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VGW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VGW3"}, "ts": "2023-07-14 08:10:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2937845", "type": "PubMed"}, "ts": "2023-07-14 08:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2937845", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L266"}, "ts": "2023-07-14 08:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPR5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:11:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPR5.457.457"}, "ts": "2023-07-14 08:11:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1904059", "type": "PubMed"}, "ts": "2023-07-14 08:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1904059", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:11:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32303335", "type": "PubMed"}, "ts": "2023-07-14 08:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32303335", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:12:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:12:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L266"}, "ts": "2023-07-14 08:12:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQV6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:12:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQV6.428.428"}, "ts": "2023-07-14 08:12:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQV6.428.428"}, "ts": "2023-07-14 08:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DB20", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:12:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DB20"}, "ts": "2023-07-14 08:12:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17948.1309.1309"}, "ts": "2023-07-14 08:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17948", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:13:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L523-1"}, "ts": "2023-07-14 08:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L523-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 08:13:27 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 08:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 08:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29533", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:13:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29533"}, "ts": "2023-07-14 08:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:13:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35520"}, "ts": "2023-07-14 08:13:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-14 08:13:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02315DX"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23432EQ"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24954UD"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25079LO"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46902YN"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47448YK"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-14 08:14:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-14 08:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24485456", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:14:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24485456", "type": "PubMed"}, "ts": "2023-07-14 08:14:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99PV8.376.376"}, "ts": "2023-07-14 08:14:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PV8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46459"}, "ts": "2023-07-14 08:15:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43451"}, "ts": "2023-07-14 08:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1847560", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:16:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1847560", "type": "PubMed"}, "ts": "2023-07-14 08:16:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8224916", "type": "PubMed"}, "ts": "2023-07-14 08:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8224916", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16055520", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:16:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16055520", "type": "PubMed"}, "ts": "2023-07-14 08:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17433EW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 08:17:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3I0"}, "ts": "2023-07-14 08:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3I0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:17:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:17:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UHV4"}, "ts": "2023-07-14 08:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42865BX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 08:17:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42865BX"}, "ts": "2023-07-14 08:17:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25325JY"}, "ts": "2023-07-14 08:17:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15411WZ"}, "ts": "2023-07-14 08:17:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49157MU"}, "ts": "2023-07-14 08:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYI8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:17:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYI8-1"}, "ts": "2023-07-14 08:17:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:18:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-14 08:18:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-14 08:18:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:18:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23274913", "type": "PubMed"}, "ts": "2023-07-14 08:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23274913", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:18:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613"}, "ts": "2023-07-14 08:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:19:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47875-1"}, "ts": "2023-07-14 08:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47875-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:19:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:19:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00451.1074.1074"}, "ts": "2023-07-14 08:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4Z2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:19:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4Z2"}, "ts": "2023-07-14 08:19:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUK9-1"}, "ts": "2023-07-14 08:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUK9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-14 08:19:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08379.902.902"}, "ts": "2023-07-14 08:20:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:20:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08379", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:20:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21105914", "type": "PubMed"}, "ts": "2023-07-14 08:21:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21105914", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:21:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122"}, "ts": "2023-07-14 08:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y512", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:21:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y512.389.389"}, "ts": "2023-07-14 08:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95918", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:22:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95918.141.141"}, "ts": "2023-07-14 08:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26599", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:22:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26599"}, "ts": "2023-07-14 08:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY17", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:22:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IY17.546.546"}, "ts": "2023-07-14 08:22:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23284", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:22:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23284.33.33"}, "ts": "2023-07-14 08:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:22:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-14 08:22:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:22:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53728DU"}, "ts": "2023-07-14 08:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T6X5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:23:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T6X5.123.123"}, "ts": "2023-07-14 08:23:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15277698", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:23:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15277698", "type": "PubMed"}, "ts": "2023-07-14 08:23:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29460"}, "ts": "2023-07-14 08:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12610629", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:23:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12610629", "type": "PubMed"}, "ts": "2023-07-14 08:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZT1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:23:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZT1.61.61"}, "ts": "2023-07-14 08:23:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95497"}, "ts": "2023-07-14 08:23:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:23:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6R3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6R3"}, "ts": "2023-07-14 08:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60282", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:24:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60282.364.364"}, "ts": "2023-07-14 08:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUM3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:24:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUM3"}, "ts": "2023-07-14 08:24:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41438"}, "ts": "2023-07-14 08:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13586"}, "ts": "2023-07-14 08:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13586", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:25:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPJ3"}, "ts": "2023-07-14 08:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPJ3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:26:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04727", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:26:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04727.683.683"}, "ts": "2023-07-14 08:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:26:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-14 08:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11215", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11215"}, "ts": "2023-07-14 08:26:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-14 08:27:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 08:27:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 08:27:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35392"}, "ts": "2023-07-14 08:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35392", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:28:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:28:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q969H0.224.224"}, "ts": "2023-07-14 08:28:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:28:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15893726", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:28:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15893726", "type": "PubMed"}, "ts": "2023-07-14 08:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:29:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01543"}, "ts": "2023-07-14 08:29:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16402.163.163"}, "ts": "2023-07-14 08:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16402", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:29:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19096"}, "ts": "2023-07-14 08:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:29:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZC9.85.85"}, "ts": "2023-07-14 08:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZC9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13489", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:30:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13489.74.74"}, "ts": "2023-07-14 08:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:31:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75129.276.276"}, "ts": "2023-07-14 08:31:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75129", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:31:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:32:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPD8"}, "ts": "2023-07-14 08:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:32:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.162.162"}, "ts": "2023-07-14 08:32:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2K6.580.580"}, "ts": "2023-07-14 08:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49407-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:33:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49407-1"}, "ts": "2023-07-14 08:33:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-14 08:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 08:34:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18464913", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:34:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18464913", "type": "PubMed"}, "ts": "2023-07-14 08:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18464913", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 08:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47741", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:34:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47741"}, "ts": "2023-07-14 08:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DN2"}, "ts": "2023-07-14 08:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-14 08:35:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11203"}, "ts": "2023-07-14 08:35:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11203"}, "ts": "2023-07-14 08:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCS0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:35:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCS0"}, "ts": "2023-07-14 08:35:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-14 08:35:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24726386", "type": "PubMed"}, "ts": "2023-07-14 08:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24726386", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:35:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:35:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25205"}, "ts": "2023-07-14 08:35:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:35:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-14 08:35:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03897"}, "ts": "2023-07-14 08:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03897", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12259", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XS5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:36:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XS5"}, "ts": "2023-07-14 08:36:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:36:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6V0"}, "ts": "2023-07-14 08:36:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RI0"}, "ts": "2023-07-14 08:36:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21581"}, "ts": "2023-07-14 08:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:37:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80098"}, "ts": "2023-07-14 08:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:37:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZU1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:37:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZU1.557.557"}, "ts": "2023-07-14 08:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-14 08:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58283", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:37:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P58283.407.407"}, "ts": "2023-07-14 08:37:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07196.431.431"}, "ts": "2023-07-14 08:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07196", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95149", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:38:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95149.123.123"}, "ts": "2023-07-14 08:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VGL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:38:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4VGL6.531.531"}, "ts": "2023-07-14 08:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01196", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:39:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01196.193.193"}, "ts": "2023-07-14 08:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53728DU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 08:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:39:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-14 08:39:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00420UH"}, "ts": "2023-07-14 08:40:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3X0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:40:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3X0"}, "ts": "2023-07-14 08:40:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P45985.306.306"}, "ts": "2023-07-14 08:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45985", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22234-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:41:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22234-1"}, "ts": "2023-07-14 08:41:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41438", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:41:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33536578", "type": "PubMed"}, "ts": "2023-07-14 08:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33536578", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47987-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:41:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47987-1"}, "ts": "2023-07-14 08:41:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y692"}, "ts": "2023-07-14 08:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y692", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:42:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4H2.6.6"}, "ts": "2023-07-14 08:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4H2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:42:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42765"}, "ts": "2023-07-14 08:42:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98161.1352.1352"}, "ts": "2023-07-14 08:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:42:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27824"}, "ts": "2023-07-14 08:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27824", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:42:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15121"}, "ts": "2023-07-14 08:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10888", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:43:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10888"}, "ts": "2023-07-14 08:43:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54803.285.285"}, "ts": "2023-07-14 08:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54803", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHA7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHA7"}, "ts": "2023-07-14 08:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9I7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:44:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9I7"}, "ts": "2023-07-14 08:44:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7690959", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:44:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7690959", "type": "PubMed"}, "ts": "2023-07-14 08:44:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:44:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96007"}, "ts": "2023-07-14 08:44:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:45:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-14 08:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33408414", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:46:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33408414", "type": "PubMed"}, "ts": "2023-07-14 08:46:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11583586", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:47:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11583586", "type": "PubMed"}, "ts": "2023-07-14 08:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24586521", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:47:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24586521", "type": "PubMed"}, "ts": "2023-07-14 08:47:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2X7"}, "ts": "2023-07-14 08:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2X7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:47:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPR4"}, "ts": "2023-07-14 08:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ZCQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:47:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ZCQ2"}, "ts": "2023-07-14 08:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969N2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:47:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969N2"}, "ts": "2023-07-14 08:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07563", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:47:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07563"}, "ts": "2023-07-14 08:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46721", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:47:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46721"}, "ts": "2023-07-14 08:47:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71DI3"}, "ts": "2023-07-14 08:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71DI3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:48:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUY8"}, "ts": "2023-07-14 08:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34199392", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:48:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34199392", "type": "PubMed"}, "ts": "2023-07-14 08:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PIV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:48:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PIV2"}, "ts": "2023-07-14 08:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZP80", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:49:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZP80"}, "ts": "2023-07-14 08:49:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14780.120.120"}, "ts": "2023-07-14 08:49:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14780", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:49:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16284.581.581"}, "ts": "2023-07-14 08:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16284", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:50:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92954.407.407"}, "ts": "2023-07-14 08:50:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:50:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "8626379"}, "ts": "2023-07-14 08:50:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-14 08:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11203", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVU7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 08:51:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NVU7", "cluster_type": "unselected"}, "ts": "2023-07-14 08:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVU7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 08:51:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34238204", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:51:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34238204", "type": "PubMed"}, "ts": "2023-07-14 08:51:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34238204", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 08:51:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11203", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:51:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29467321", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:51:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29467321", "type": "PubMed"}, "ts": "2023-07-14 08:51:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954ZJ"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99943EE"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954GW"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99956MJ"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99729IU"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99896CG"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99866WK"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99584SF"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99714FV"}, "ts": "2023-07-14 08:51:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99571EV"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99511SH"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99568AR"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99452IK"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99448WD"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99403QU"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99356PZ"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99306JE"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99242KO"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99258WN"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:51:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99891PR"}, "ts": "2023-07-14 08:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:52:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86Y26.1031.1031"}, "ts": "2023-07-14 08:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13291", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:52:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13291"}, "ts": "2023-07-14 08:52:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-14 08:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00193", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:52:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00193.136.136"}, "ts": "2023-07-14 08:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20874444", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:52:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20874444", "type": "PubMed"}, "ts": "2023-07-14 08:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75417", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:52:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75417.2236.2236"}, "ts": "2023-07-14 08:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40855", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:53:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40855.76.76"}, "ts": "2023-07-14 08:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:53:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14155.330.330"}, "ts": "2023-07-14 08:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 08:54:05 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P29474", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 08:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29474", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 08:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R020", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:54:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9R020.153.153"}, "ts": "2023-07-14 08:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TST3"}, "ts": "2023-07-14 08:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TST3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:54:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-14 08:54:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:54:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-14 08:54:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWQ8.269.269"}, "ts": "2023-07-14 08:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:55:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6A1.316.316"}, "ts": "2023-07-14 08:55:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6A1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75140"}, "ts": "2023-07-14 08:55:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQS8"}, "ts": "2023-07-14 08:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQS8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22983157", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:56:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22983157", "type": "PubMed"}, "ts": "2023-07-14 08:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:56:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PU5.256.256"}, "ts": "2023-07-14 08:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:56:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0U6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:56:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80Z71"}, "ts": "2023-07-14 08:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80Z71", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 08:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M1V0-1"}, "ts": "2023-07-14 08:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M1V0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:57:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZ41-1"}, "ts": "2023-07-14 08:57:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZ41-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Z7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:57:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Z7.227.227"}, "ts": "2023-07-14 08:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:59:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15043"}, "ts": "2023-07-14 08:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15043", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:59:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-14 08:59:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 08:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22992961", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 08:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "how-to-cite", "message": "page access"}, "ts": "2023-07-14 08:59:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22992961", "type": "PubMed"}, "ts": "2023-07-14 08:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 08:59:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UP2.156.156"}, "ts": "2023-07-14 08:59:59 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 09:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 09:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 09:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 09:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 09:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 09:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-14 09:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22525750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:00:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22525750", "type": "PubMed"}, "ts": "2023-07-14 09:00:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P032-1"}, "ts": "2023-07-14 09:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P032-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:00:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924T3-1"}, "ts": "2023-07-14 09:00:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924T3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:01:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17969444", "type": "PubMed"}, "ts": "2023-07-14 09:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17969444", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:01:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N8V4.116.116"}, "ts": "2023-07-14 09:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8V4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:01:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q7TSN2", "cluster_type": "unselected"}, "ts": "2023-07-14 09:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSN2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 09:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSN2", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 09:02:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JT2.528.528"}, "ts": "2023-07-14 09:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JT2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:02:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17595167", "type": "PubMed"}, "ts": "2023-07-14 09:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17595167", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:03:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31690811", "type": "PubMed"}, "ts": "2023-07-14 09:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31690811", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:03:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RK0"}, "ts": "2023-07-14 09:03:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:03:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SM5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:03:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86SM5.132.132"}, "ts": "2023-07-14 09:03:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:04:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00441"}, "ts": "2023-07-14 09:04:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10488153", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:04:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10488153", "type": "PubMed"}, "ts": "2023-07-14 09:04:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q554-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:04:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q554-1"}, "ts": "2023-07-14 09:04:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QX27"}, "ts": "2023-07-14 09:04:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QX27", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:04:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1A9"}, "ts": "2023-07-14 09:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:05:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2THW7"}, "ts": "2023-07-14 09:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2THW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:05:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275"}, "ts": "2023-07-14 09:05:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT11", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-14 09:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT11", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-14 09:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:05:17 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GALNT11"}, "ts": "2023-07-14 09:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT11", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GALNT11"}, "ts": "2023-07-14 09:05:17 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "caf3ede4024aef8d35402b41b08a9230", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 09:05:20 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "caf3ede4024aef8d35402b41b08a9230", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 09:05:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCW6-1"}, "ts": "2023-07-14 09:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCW6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:05:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 09:05:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92609"}, "ts": "2023-07-14 09:05:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92609", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:05:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY42"}, "ts": "2023-07-14 09:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:05:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49854OS"}, "ts": "2023-07-14 09:06:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49854OS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYS0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:07:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYS0-1"}, "ts": "2023-07-14 09:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6C5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:07:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6C5-1"}, "ts": "2023-07-14 09:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L92", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:07:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96L92.142.142"}, "ts": "2023-07-14 09:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15019995", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:07:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15019995", "type": "PubMed"}, "ts": "2023-07-14 09:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:08:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86Y30"}, "ts": "2023-07-14 09:08:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70207"}, "ts": "2023-07-14 09:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10856257", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:08:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10856257", "type": "PubMed"}, "ts": "2023-07-14 09:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT12", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-14 09:08:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:08:48 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GALNT12"}, "ts": "2023-07-14 09:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT12", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GALNT12"}, "ts": "2023-07-14 09:08:48 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a0f95b838502c1a5c6c4aa0e7c7c4ce9", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 09:08:50 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "a0f95b838502c1a5c6c4aa0e7c7c4ce9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 09:08:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-14 09:08:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXK2-1"}, "ts": "2023-07-14 09:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXK2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:08:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-14 09:09:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-14 09:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48167", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:09:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48167.155.155"}, "ts": "2023-07-14 09:09:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 09:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SJ6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 09:09:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q86SJ6", "cluster_type": "unselected"}, "ts": "2023-07-14 09:09:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SJ6", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 09:09:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08J23"}, "ts": "2023-07-14 09:10:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08J23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:10:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70375MX"}, "ts": "2023-07-14 09:10:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 09:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RTN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:10:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RTN2"}, "ts": "2023-07-14 09:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-14 09:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22455"}, "ts": "2023-07-14 09:10:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08J23", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:10:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08J23.139.139"}, "ts": "2023-07-14 09:10:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36544.37.37"}, "ts": "2023-07-14 09:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36544", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT13", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-14 09:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:11:01 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GALNT13"}, "ts": "2023-07-14 09:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:11:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT13", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GALNT13"}, "ts": "2023-07-14 09:11:01 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3c861091cac00ef59de7f96485d47e2b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 09:11:03 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3c861091cac00ef59de7f96485d47e2b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 09:11:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CF93-1"}, "ts": "2023-07-14 09:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CF93-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:11:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 09:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08J23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:11:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08J23"}, "ts": "2023-07-14 09:11:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10222061", "type": "PubMed"}, "ts": "2023-07-14 09:11:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10222061", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75140", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:11:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06349-1"}, "ts": "2023-07-14 09:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06349-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:11:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57787"}, "ts": "2023-07-14 09:12:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57787", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:12:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT16", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-14 09:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:12:08 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GALNT16"}, "ts": "2023-07-14 09:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 09:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT16", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GALNT16"}, "ts": "2023-07-14 09:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11311237", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:12:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11311237", "type": "PubMed"}, "ts": "2023-07-14 09:12:10 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "624b40fccd7ec81779b89447d1c8b337", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 09:12:11 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "624b40fccd7ec81779b89447d1c8b337", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 09:12:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N428-1"}, "ts": "2023-07-14 09:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N428-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:12:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14567693", "type": "PubMed"}, "ts": "2023-07-14 09:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14567693", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:12:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCM1"}, "ts": "2023-07-14 09:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NNE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:12:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NNE9"}, "ts": "2023-07-14 09:12:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31197516", "type": "PubMed"}, "ts": "2023-07-14 09:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31197516", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30038", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 09:13:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P30038", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 09:13:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19715408", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:13:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19715408", "type": "PubMed"}, "ts": "2023-07-14 09:13:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33110456", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:13:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33110456", "type": "PubMed"}, "ts": "2023-07-14 09:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:13:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YHK3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 09:13:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6YHK3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 09:13:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6T1-1"}, "ts": "2023-07-14 09:13:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6T1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:13:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18782776", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:13:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18782776", "type": "PubMed"}, "ts": "2023-07-14 09:13:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N2K0.267.267"}, "ts": "2023-07-14 09:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2K0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G5E8G2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:14:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G5E8G2-1"}, "ts": "2023-07-14 09:14:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:14:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NHY2.387.387"}, "ts": "2023-07-14 09:14:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-14 09:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U44"}, "ts": "2023-07-14 09:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:14:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99988"}, "ts": "2023-07-14 09:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:14:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NG06.293.293"}, "ts": "2023-07-14 09:14:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:14:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07595HH"}, "ts": "2023-07-14 09:15:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H9Z2.25.25"}, "ts": "2023-07-14 09:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9Z2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:15:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-14 09:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:15:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCD6.1637.1637"}, "ts": "2023-07-14 09:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20847312", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:15:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20847312", "type": "PubMed"}, "ts": "2023-07-14 09:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08559", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:15:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08559.8.8"}, "ts": "2023-07-14 09:15:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20432435", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:16:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20432435", "type": "PubMed"}, "ts": "2023-07-14 09:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:16:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02767-1"}, "ts": "2023-07-14 09:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02767-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13976", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:17:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13976"}, "ts": "2023-07-14 09:17:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95684", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:17:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95684"}, "ts": "2023-07-14 09:17:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00534", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:18:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00534"}, "ts": "2023-07-14 09:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:18:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6M7.796.796"}, "ts": "2023-07-14 09:18:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75064", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:18:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75064"}, "ts": "2023-07-14 09:18:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYH1.396.396"}, "ts": "2023-07-14 09:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22465717", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:18:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22465717", "type": "PubMed"}, "ts": "2023-07-14 09:18:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923K9-1"}, "ts": "2023-07-14 09:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923K9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:19:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:19:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-14 09:19:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBE4.94.94"}, "ts": "2023-07-14 09:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBE4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15738392", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:19:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15738392", "type": "PubMed"}, "ts": "2023-07-14 09:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7D3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03979", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:20:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7D3"}, "ts": "2023-07-14 09:20:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P03979.42.42"}, "ts": "2023-07-14 09:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61179", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0F1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0F1-1"}, "ts": "2023-07-14 09:20:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61179"}, "ts": "2023-07-14 09:20:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:20:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25586176", "type": "PubMed"}, "ts": "2023-07-14 09:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25586176", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:21:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N428-1"}, "ts": "2023-07-14 09:21:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N428-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16495380", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:21:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16495380", "type": "PubMed"}, "ts": "2023-07-14 09:21:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10721.50.50"}, "ts": "2023-07-14 09:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10721", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32854GF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:21:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32854GF"}, "ts": "2023-07-14 09:21:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16878137", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:21:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16878137", "type": "PubMed"}, "ts": "2023-07-14 09:21:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28660"}, "ts": "2023-07-14 09:22:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:22:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PV3"}, "ts": "2023-07-14 09:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:22:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFZ3"}, "ts": "2023-07-14 09:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI72", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:22:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LI72"}, "ts": "2023-07-14 09:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55091", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:23:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55091"}, "ts": "2023-07-14 09:23:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "27916748"}, "ts": "2023-07-14 09:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 09:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:23:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42866", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:23:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42866.370.370"}, "ts": "2023-07-14 09:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15244466", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:23:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15244466", "type": "PubMed"}, "ts": "2023-07-14 09:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56A07", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:24:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q56A07.42.42"}, "ts": "2023-07-14 09:24:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35916.833.833"}, "ts": "2023-07-14 09:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35916", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:25:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00403.70.70"}, "ts": "2023-07-14 09:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00403", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:25:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69AB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:25:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69AB1"}, "ts": "2023-07-14 09:25:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28908.171.171"}, "ts": "2023-07-14 09:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28908", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS82", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:26:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NS82.103.103"}, "ts": "2023-07-14 09:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:26:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AG4"}, "ts": "2023-07-14 09:26:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-14 09:27:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2W1"}, "ts": "2023-07-14 09:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2W1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C6L5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:27:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C6L5"}, "ts": "2023-07-14 09:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I7T1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:28:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5I7T1.132.132"}, "ts": "2023-07-14 09:28:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28241900", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:28:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28241900", "type": "PubMed"}, "ts": "2023-07-14 09:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:28:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613"}, "ts": "2023-07-14 09:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19996105", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:28:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19996105", "type": "PubMed"}, "ts": "2023-07-14 09:28:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:28:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UM73.401.401"}, "ts": "2023-07-14 09:29:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM73", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:29:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX03", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:29:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IX03.912.912"}, "ts": "2023-07-14 09:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8G5"}, "ts": "2023-07-14 09:29:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:29:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07766"}, "ts": "2023-07-14 09:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27391WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:29:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96361GW"}, "ts": "2023-07-14 09:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96361GW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:29:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28973871", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:30:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28973871", "type": "PubMed"}, "ts": "2023-07-14 09:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:30:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A84"}, "ts": "2023-07-14 09:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14651", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:30:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14651.119.119"}, "ts": "2023-07-14 09:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515"}, "ts": "2023-07-14 09:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0FGR8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:31:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0FGR8.582.582"}, "ts": "2023-07-14 09:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:31:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0E7"}, "ts": "2023-07-14 09:31:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-14 09:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWF4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:31:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWF4"}, "ts": "2023-07-14 09:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N350", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 09:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9233787", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:32:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9233787", "type": "PubMed"}, "ts": "2023-07-14 09:32:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22897", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:32:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22897"}, "ts": "2023-07-14 09:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHY8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:32:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHY8"}, "ts": "2023-07-14 09:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WX94", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:32:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WX94.14.14"}, "ts": "2023-07-14 09:32:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-14 09:32:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10469298", "type": "PubMed"}, "ts": "2023-07-14 09:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10469298", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:32:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14112.453.453"}, "ts": "2023-07-14 09:32:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937-1"}, "ts": "2023-07-14 09:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61014", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:33:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61014.17.17"}, "ts": "2023-07-14 09:33:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43324-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:33:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43324-1"}, "ts": "2023-07-14 09:33:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04233"}, "ts": "2023-07-14 09:34:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04233"}, "ts": "2023-07-14 09:34:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01871-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:34:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01871-1"}, "ts": "2023-07-14 09:34:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48356"}, "ts": "2023-07-14 09:34:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRH6-1"}, "ts": "2023-07-14 09:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRH6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:35:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R716-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R716-1"}, "ts": "2023-07-14 09:35:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZ52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:36:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZ52"}, "ts": "2023-07-14 09:36:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:36:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46937.128.128"}, "ts": "2023-07-14 09:36:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60673.1584.1584"}, "ts": "2023-07-14 09:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:36:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12727204", "type": "PubMed"}, "ts": "2023-07-14 09:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12727204", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:37:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12213192", "type": "PubMed"}, "ts": "2023-07-14 09:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12213192", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ42", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:37:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WZ42.12022.12022"}, "ts": "2023-07-14 09:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZMH5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:37:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZMH5-1"}, "ts": "2023-07-14 09:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-14 09:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22061"}, "ts": "2023-07-14 09:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-14 09:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09198-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:38:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000095"}, "ts": "2023-07-14 09:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75899", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:39:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75899.236.236"}, "ts": "2023-07-14 09:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29177481", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:39:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29177481", "type": "PubMed"}, "ts": "2023-07-14 09:39:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-14 09:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:40:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-14 09:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:40:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKT3"}, "ts": "2023-07-14 09:40:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BL97.212.212"}, "ts": "2023-07-14 09:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BL97", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15572", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:40:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15572"}, "ts": "2023-07-14 09:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15800", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:40:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15800"}, "ts": "2023-07-14 09:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99985-1"}, "ts": "2023-07-14 09:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99985-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54821"}, "ts": "2023-07-14 09:42:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PAL1"}, "ts": "2023-07-14 09:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19971", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PAL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:42:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19971.275.275"}, "ts": "2023-07-14 09:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:43:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17656621", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:43:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17656621", "type": "PubMed"}, "ts": "2023-07-14 09:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61072-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:43:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61072-1"}, "ts": "2023-07-14 09:43:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7518249", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:43:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7518249", "type": "PubMed"}, "ts": "2023-07-14 09:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 09:43:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NS65"}, "ts": "2023-07-14 09:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NS65", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZZ3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZZ3-1"}, "ts": "2023-07-14 09:43:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2TJV2"}, "ts": "2023-07-14 09:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2TJV2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:44:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2059658", "type": "PubMed"}, "ts": "2023-07-14 09:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2059658", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20059-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20059-1"}, "ts": "2023-07-14 09:44:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-14 09:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 09:44:31 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 09:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 09:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 09:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 09:45:01 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 09:45:09 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "Brugia malayi", "term_category": "any"}, "ts": "2023-07-14 09:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">fab973ec7a7e7ee1a7005fe066f119b1", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"Brugia malayi\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 09:45:09 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fab973ec7a7e7ee1a7005fe066f119b1", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 09:45:09 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fab973ec7a7e7ee1a7005fe066f119b1", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 09:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 09:45:21 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 09:45:28 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "Brugia", "term_category": "organism"}, "ts": "2023-07-14 09:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"Brugia\",\"term_category\":\"organism\"}"}, "ts": "2023-07-14 09:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23725801", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:45:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23725801", "type": "PubMed"}, "ts": "2023-07-14 09:45:43 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "Brugia malayi", "term_category": "organism"}, "ts": "2023-07-14 09:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 09:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"\\tBrugia malayi\",\"term_category\":\"organism\"}"}, "ts": "2023-07-14 09:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 09:45:50 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "Brugia malayi", "term_category": "any"}, "ts": "2023-07-14 09:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">fab973ec7a7e7ee1a7005fe066f119b1", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"\\tBrugia malayi\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 09:45:51 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 09:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fab973ec7a7e7ee1a7005fe066f119b1", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 09:45:51 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fab973ec7a7e7ee1a7005fe066f119b1", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 09:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:46:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY07"}, "ts": "2023-07-14 09:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CC62", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CC62"}, "ts": "2023-07-14 09:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19338054", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:46:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19338054", "type": "PubMed"}, "ts": "2023-07-14 09:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP85", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:46:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP85.224.224"}, "ts": "2023-07-14 09:46:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZX3"}, "ts": "2023-07-14 09:46:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TUF7"}, "ts": "2023-07-14 09:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TUF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:47:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14610093", "type": "PubMed"}, "ts": "2023-07-14 09:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10425SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 09:47:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-14 09:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34969", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:48:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34969"}, "ts": "2023-07-14 09:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25391-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:48:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25391-1"}, "ts": "2023-07-14 09:48:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU68"}, "ts": "2023-07-14 09:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:48:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0E3"}, "ts": "2023-07-14 09:48:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06733"}, "ts": "2023-07-14 09:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:48:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11792844", "type": "PubMed"}, "ts": "2023-07-14 09:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11792844", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:48:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63096"}, "ts": "2023-07-14 09:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20783-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:49:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20783-1"}, "ts": "2023-07-14 09:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M329", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:49:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M329"}, "ts": "2023-07-14 09:49:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18326623", "type": "PubMed"}, "ts": "2023-07-14 09:49:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18326623", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:49:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ13", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:49:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQ13.297.297"}, "ts": "2023-07-14 09:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04233", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:50:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67870"}, "ts": "2023-07-14 09:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67870", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUM3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:50:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUM3-1"}, "ts": "2023-07-14 09:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48356", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:50:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 09:50:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-14 09:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55066", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55066"}, "ts": "2023-07-14 09:50:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14730019", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:50:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14730019", "type": "PubMed"}, "ts": "2023-07-14 09:50:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:50:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BJI4"}, "ts": "2023-07-14 09:50:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VWI1.376.376"}, "ts": "2023-07-14 09:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWI1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49748"}, "ts": "2023-07-14 09:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8808275", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:51:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8808275", "type": "PubMed"}, "ts": "2023-07-14 09:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13554", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13554"}, "ts": "2023-07-14 09:51:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUQ8"}, "ts": "2023-07-14 09:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUQ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92574", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92574"}, "ts": "2023-07-14 09:53:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05155"}, "ts": "2023-07-14 09:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:53:14 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-14 09:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-14 09:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97430-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97430-1"}, "ts": "2023-07-14 09:53:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2MJT0-1.441.441"}, "ts": "2023-07-14 09:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MJT0-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:53:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21964.67.67"}, "ts": "2023-07-14 09:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21964", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49863"}, "ts": "2023-07-14 09:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49863", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 09:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:55:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P7Q4-1"}, "ts": "2023-07-14 09:55:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P7Q4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:55:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12000365", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 09:55:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12000365", "type": "PubMed"}, "ts": "2023-07-14 09:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18075", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:55:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18075.372.372"}, "ts": "2023-07-14 09:55:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-14 09:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:55:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86SQ0.701.701"}, "ts": "2023-07-14 09:55:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06865", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:56:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06865"}, "ts": "2023-07-14 09:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:57:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52306"}, "ts": "2023-07-14 09:57:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40222.72.72"}, "ts": "2023-07-14 09:57:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BGU5.21.21"}, "ts": "2023-07-14 09:58:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 09:58:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54821", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:58:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-14 09:59:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 09:59:26 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 10:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 10:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 10:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 10:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 10:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 10:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-14 10:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PA06", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:01:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PA06"}, "ts": "2023-07-14 10:02:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42785", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:02:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42785.112.112"}, "ts": "2023-07-14 10:02:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75643.295.295"}, "ts": "2023-07-14 10:03:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75643", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:03:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95910WJ"}, "ts": "2023-07-14 10:03:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZY8"}, "ts": "2023-07-14 10:03:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-14 10:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGW1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:08:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGW1.48.48"}, "ts": "2023-07-14 10:08:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01887"}, "ts": "2023-07-14 10:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01887", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:08:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75027"}, "ts": "2023-07-14 10:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:08:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4W1-1"}, "ts": "2023-07-14 10:08:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4W1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:08:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30712867", "type": "PubMed"}, "ts": "2023-07-14 10:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30712867", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGM2-1"}, "ts": "2023-07-14 10:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGM2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:09:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJF2"}, "ts": "2023-07-14 10:11:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29400", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:11:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29400.665.665"}, "ts": "2023-07-14 10:11:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:11:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYA4.297.297"}, "ts": "2023-07-14 10:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYA4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:12:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68CZ2.660.660"}, "ts": "2023-07-14 10:12:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z5L9"}, "ts": "2023-07-14 10:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z5L9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:12:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7-1"}, "ts": "2023-07-14 10:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q674X7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:13:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54132"}, "ts": "2023-07-14 10:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:13:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34691235", "type": "PubMed"}, "ts": "2023-07-14 10:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34691235", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:14:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34691235", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 10:14:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43157.1183.1183"}, "ts": "2023-07-14 10:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43157", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYV9"}, "ts": "2023-07-14 10:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:15:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43520"}, "ts": "2023-07-14 10:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31337858", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:16:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31337858", "type": "PubMed"}, "ts": "2023-07-14 10:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07350-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:16:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07350-1"}, "ts": "2023-07-14 10:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V6R9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:16:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V6R9-1"}, "ts": "2023-07-14 10:16:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43524", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:16:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43524.32.32"}, "ts": "2023-07-14 10:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92777-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:16:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92777-1"}, "ts": "2023-07-14 10:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48546"}, "ts": "2023-07-14 10:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03135-1"}, "ts": "2023-07-14 10:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23470", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:18:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23470.184.184"}, "ts": "2023-07-14 10:18:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16055366", "type": "PubMed"}, "ts": "2023-07-14 10:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16055366", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:18:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFN9"}, "ts": "2023-07-14 10:18:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8V3"}, "ts": "2023-07-14 10:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8V3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:19:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-14 10:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2K0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 10:19:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H2K0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 10:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2K0", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-14 10:19:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14174"}, "ts": "2023-07-14 10:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 10:19:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15010462", "type": "PubMed"}, "ts": "2023-07-14 10:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15010462", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRV2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:19:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZRV2.465.465"}, "ts": "2023-07-14 10:19:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NMZ7.684.684"}, "ts": "2023-07-14 10:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NMZ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:20:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0AVK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:20:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0AVK6"}, "ts": "2023-07-14 10:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-14 10:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01282-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 10:20:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01282-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 10:20:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000010"}, "ts": "2023-07-14 10:22:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERB5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:22:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERB5"}, "ts": "2023-07-14 10:22:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53680"}, "ts": "2023-07-14 10:22:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21795679", "type": "PubMed"}, "ts": "2023-07-14 10:22:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21795679", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:22:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTP6"}, "ts": "2023-07-14 10:23:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:23:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q642B5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:23:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q642B5-1"}, "ts": "2023-07-14 10:23:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56300FZ"}, "ts": "2023-07-14 10:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56300FZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 10:24:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-14 10:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34325031", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:24:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34325031", "type": "PubMed"}, "ts": "2023-07-14 10:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21981"}, "ts": "2023-07-14 10:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DP24"}, "ts": "2023-07-14 10:24:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-14 10:24:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29317"}, "ts": "2023-07-14 10:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:25:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-14 10:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14115", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:26:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14115"}, "ts": "2023-07-14 10:26:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4G5"}, "ts": "2023-07-14 10:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02458", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:26:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02458.1292.1292"}, "ts": "2023-07-14 10:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:26:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPC2"}, "ts": "2023-07-14 10:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:26:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16105885", "type": "PubMed"}, "ts": "2023-07-14 10:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16105885", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:26:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76M96"}, "ts": "2023-07-14 10:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76M96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:27:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 10:27:06 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 10:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 10:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "egfr", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-14 10:27:12 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "egfr"}, "ts": "2023-07-14 10:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 10:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "egfr", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "Global search term=egfr"}, "ts": "2023-07-14 10:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 10:27:13 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 10:27:19 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7840e63e198bf97abf1eef1fa8c40752", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 10:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7840e63e198bf97abf1eef1fa8c40752", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 10:27:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-14 10:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22441692", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:27:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22441692", "type": "PubMed"}, "ts": "2023-07-14 10:27:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-14 10:27:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83461WR"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59536GA"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66760KM"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 10:27:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBL9.148.148"}, "ts": "2023-07-14 10:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBL9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQT4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:27:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQT4"}, "ts": "2023-07-14 10:27:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PWS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:27:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PWS4"}, "ts": "2023-07-14 10:27:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-14 10:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:28:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20864032", "type": "PubMed"}, "ts": "2023-07-14 10:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20864032", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9450183", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:28:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9450183", "type": "PubMed"}, "ts": "2023-07-14 10:28:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP78.704.704"}, "ts": "2023-07-14 10:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP78", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:28:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95757", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:28:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95757.692.692"}, "ts": "2023-07-14 10:28:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:29:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-14 10:29:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10332027", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:29:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10332027", "type": "PubMed"}, "ts": "2023-07-14 10:29:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21049984", "type": "PubMed"}, "ts": "2023-07-14 10:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21049984", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:29:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12710"}, "ts": "2023-07-14 10:29:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12710", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:29:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBW7"}, "ts": "2023-07-14 10:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:30:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRM1.689.689"}, "ts": "2023-07-14 10:30:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20093627", "type": "PubMed"}, "ts": "2023-07-14 10:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20093627", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:30:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1860873", "type": "PubMed"}, "ts": "2023-07-14 10:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1860873", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:30:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSI4"}, "ts": "2023-07-14 10:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02743", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02743"}, "ts": "2023-07-14 10:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:31:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:31:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6K8"}, "ts": "2023-07-14 10:31:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 10:31:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91V26.225.225"}, "ts": "2023-07-14 10:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83878UZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 10:31:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83878UZ"}, "ts": "2023-07-14 10:31:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68363"}, "ts": "2023-07-14 10:31:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:31:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWQ2.573.573"}, "ts": "2023-07-14 10:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920Q0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:31:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q920Q0.145.145"}, "ts": "2023-07-14 10:31:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y3D8.121.121"}, "ts": "2023-07-14 10:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3D8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-14 10:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:32:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00898"}, "ts": "2023-07-14 10:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35546", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:33:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35546.98.98"}, "ts": "2023-07-14 10:33:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-14 10:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27666745", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:33:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27666745", "type": "PubMed"}, "ts": "2023-07-14 10:33:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019797", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:33:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019797", "type": "PubMed"}, "ts": "2023-07-14 10:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:33:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5Z5"}, "ts": "2023-07-14 10:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5Z5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5P0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:34:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5P0"}, "ts": "2023-07-14 10:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03971", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:34:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P03971.37.37"}, "ts": "2023-07-14 10:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2X0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:35:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2X0"}, "ts": "2023-07-14 10:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJK2"}, "ts": "2023-07-14 10:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7671815", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:35:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7671815", "type": "PubMed"}, "ts": "2023-07-14 10:35:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05067"}, "ts": "2023-07-14 10:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q641W9"}, "ts": "2023-07-14 10:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q641W9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:36:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1899243", "type": "PubMed"}, "ts": "2023-07-14 10:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1899243", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14662-1"}, "ts": "2023-07-14 10:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14662-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:36:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AZP2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:36:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B1AZP2.405.405"}, "ts": "2023-07-14 10:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9233640", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:37:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9233640", "type": "PubMed"}, "ts": "2023-07-14 10:37:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T124.509.509"}, "ts": "2023-07-14 10:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T124", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:38:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQ76.381.381"}, "ts": "2023-07-14 10:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:38:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40424"}, "ts": "2023-07-14 10:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56199", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:38:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56199"}, "ts": "2023-07-14 10:38:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H2K0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 10:38:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2K0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 10:38:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2K0", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 10:38:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2MJT0-1.441.441"}, "ts": "2023-07-14 10:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MJT0-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15506-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:38:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15506-1"}, "ts": "2023-07-14 10:38:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P34080-1.269.269"}, "ts": "2023-07-14 10:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34080-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H334", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:39:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H334.190.190"}, "ts": "2023-07-14 10:39:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18550549", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:39:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18550549", "type": "PubMed"}, "ts": "2023-07-14 10:39:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60174"}, "ts": "2023-07-14 10:39:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22068912", "type": "PubMed"}, "ts": "2023-07-14 10:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22068912", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:39:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070"}, "ts": "2023-07-14 10:40:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:40:11 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000047", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-14 10:40:24 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000047", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-14 10:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 10:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000047", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 10:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:40:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35926TG"}, "ts": "2023-07-14 10:40:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5H9R7.315.315"}, "ts": "2023-07-14 10:41:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H9R7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D4G1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:41:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D4G1-1"}, "ts": "2023-07-14 10:41:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-14 10:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYM9", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:41:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYM9"}, "ts": "2023-07-14 10:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:41:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5L3"}, "ts": "2023-07-14 10:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-14 10:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:41:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-14 10:41:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-14 10:41:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-14 10:41:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-14 10:41:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-14 10:41:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-14 10:41:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-14 10:41:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-14 10:41:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41250-1"}, "ts": "2023-07-14 10:42:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D8X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D8X1"}, "ts": "2023-07-14 10:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:43:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06828"}, "ts": "2023-07-14 10:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06828", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:43:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H201-1"}, "ts": "2023-07-14 10:43:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P6Q2.5.5"}, "ts": "2023-07-14 10:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H201-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P6Q2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:43:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30203"}, "ts": "2023-07-14 10:44:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30203", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:44:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23490"}, "ts": "2023-07-14 10:44:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61818", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:44:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61818"}, "ts": "2023-07-14 10:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:44:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08236"}, "ts": "2023-07-14 10:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08236", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:45:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:45:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06231AO"}, "ts": "2023-07-14 10:45:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-14 10:45:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-14 10:45:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47448YK"}, "ts": "2023-07-14 10:45:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92062TF"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41247ZX"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92050GC"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 10:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W4"}, "ts": "2023-07-14 10:45:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-14 10:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-14 10:46:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-14 10:46:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BJ25"}, "ts": "2023-07-14 10:46:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJ25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14687", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:47:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14687.1153.1153"}, "ts": "2023-07-14 10:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:47:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43307"}, "ts": "2023-07-14 10:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:47:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23432EQ"}, "ts": "2023-07-14 10:47:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-14 10:47:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24954UD"}, "ts": "2023-07-14 10:47:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-14 10:47:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-14 10:47:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-14 10:47:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-14 10:47:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-14 10:47:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-14 10:47:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25079LO"}, "ts": "2023-07-14 10:47:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02315DX"}, "ts": "2023-07-14 10:47:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47448YK"}, "ts": "2023-07-14 10:47:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-14 10:47:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-14 10:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:47:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13401"}, "ts": "2023-07-14 10:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13401", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:48:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LRZ0-1"}, "ts": "2023-07-14 10:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LRZ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 10:48:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 10:48:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cd38", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-14 10:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 10:48:28 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "cd38"}, "ts": "2023-07-14 10:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cd38", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=cd38"}, "ts": "2023-07-14 10:48:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30044"}, "ts": "2023-07-14 10:48:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 10:48:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "e6f1b432eca89e42dc1bd79d82b7c068", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 10:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e6f1b432eca89e42dc1bd79d82b7c068", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 10:48:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28907-1"}, "ts": "2023-07-14 10:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28907-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:48:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-14 10:48:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00898"}, "ts": "2023-07-14 10:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00898", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23615608", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:49:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23615608", "type": "PubMed"}, "ts": "2023-07-14 10:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:49:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 10:49:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11499", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 10:49:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15129", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:49:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P11499", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 10:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15129"}, "ts": "2023-07-14 10:49:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UW49.82.82"}, "ts": "2023-07-14 10:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UW49", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:49:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGF4.11.11"}, "ts": "2023-07-14 10:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGF4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:50:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEG0"}, "ts": "2023-07-14 10:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920S3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:50:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920S3"}, "ts": "2023-07-14 10:50:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14317"}, "ts": "2023-07-14 10:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24190977", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:51:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24190977", "type": "PubMed"}, "ts": "2023-07-14 10:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122-1"}, "ts": "2023-07-14 10:51:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-14 10:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05067", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:51:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18809712", "type": "PubMed"}, "ts": "2023-07-14 10:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18809712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:52:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80YX1.1394.1394"}, "ts": "2023-07-14 10:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YX1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20871633", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:53:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20871633", "type": "PubMed"}, "ts": "2023-07-14 10:53:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-14 10:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:53:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-14 10:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:54:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q969H0.162.162"}, "ts": "2023-07-14 10:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08733", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 10:55:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08733"}, "ts": "2023-07-14 10:55:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15371"}, "ts": "2023-07-14 10:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60981-1"}, "ts": "2023-07-14 10:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19131329", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:56:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19131329", "type": "PubMed"}, "ts": "2023-07-14 10:56:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BW41-1"}, "ts": "2023-07-14 10:56:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BW41-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0S2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:56:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N0S2.256.256"}, "ts": "2023-07-14 10:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35926TG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 10:56:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15569"}, "ts": "2023-07-14 10:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15569", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:57:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32878882", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:57:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32878882", "type": "PubMed"}, "ts": "2023-07-14 10:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32878882", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 10:57:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "678554", "type": "PubMed"}, "ts": "2023-07-14 10:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "678554", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 10:57:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "C9J069.387.387"}, "ts": "2023-07-14 10:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9J069", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 10:57:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07998"}, "ts": "2023-07-14 10:58:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75369"}, "ts": "2023-07-14 10:58:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-14 10:58:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-14 10:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL33"}, "ts": "2023-07-14 10:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05121"}, "ts": "2023-07-14 10:58:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-14 10:58:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43007"}, "ts": "2023-07-14 10:58:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q09328-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 10:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09328-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 10:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09328-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-14 10:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-14 10:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-14 10:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGF8"}, "ts": "2023-07-14 10:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGF8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 10:59:50 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 11:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 11:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 11:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 11:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 11:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 11:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:00:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q64455.317.317"}, "ts": "2023-07-14 11:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25003238", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:00:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25003238", "type": "PubMed"}, "ts": "2023-07-14 11:00:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-14 11:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB80", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:01:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TB80.474.474"}, "ts": "2023-07-14 11:01:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WBZ7-1"}, "ts": "2023-07-14 11:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WBZ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:01:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00144"}, "ts": "2023-07-14 11:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-14 11:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-14 11:02:02 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-14 11:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:02:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75376"}, "ts": "2023-07-14 11:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75376", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:02:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9537414", "type": "PubMed"}, "ts": "2023-07-14 11:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9537414", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:02:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15788"}, "ts": "2023-07-14 11:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00740", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:03:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00740.99.99"}, "ts": "2023-07-14 11:03:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:03:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXU2"}, "ts": "2023-07-14 11:03:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-14 11:04:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06702"}, "ts": "2023-07-14 11:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30044", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:04:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98063-1"}, "ts": "2023-07-14 11:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98063-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:04:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96I36-1"}, "ts": "2023-07-14 11:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96I36-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:05:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05193-1"}, "ts": "2023-07-14 11:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05193-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:05:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5BKX8.7.7"}, "ts": "2023-07-14 11:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKX8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-14 11:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:05:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 11:05:57 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 11:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 11:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C1D8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:06:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8C1D8.209.209"}, "ts": "2023-07-14 11:06:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02649"}, "ts": "2023-07-14 11:06:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13611"}, "ts": "2023-07-14 11:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11831", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:06:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11831.324.324"}, "ts": "2023-07-14 11:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ER58-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:07:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ER58-1"}, "ts": "2023-07-14 11:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q9M8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:07:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q9M8"}, "ts": "2023-07-14 11:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:07:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35858.174.174"}, "ts": "2023-07-14 11:07:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0A3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 11:07:38 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9D0A3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 11:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0A3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 11:07:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24755855", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:07:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24755855", "type": "PubMed"}, "ts": "2023-07-14 11:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:07:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86SM5.160.160"}, "ts": "2023-07-14 11:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SM5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:08:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19945"}, "ts": "2023-07-14 11:08:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q497L8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:08:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q497L8"}, "ts": "2023-07-14 11:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16617", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:08:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16617"}, "ts": "2023-07-14 11:08:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06865"}, "ts": "2023-07-14 11:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06865", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:09:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:09:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25082813", "type": "PubMed"}, "ts": "2023-07-14 11:09:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56UD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25082813", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17980", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:09:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17980.284.284"}, "ts": "2023-07-14 11:09:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56UD9"}, "ts": "2023-07-14 11:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1W4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:10:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U1W4-1"}, "ts": "2023-07-14 11:10:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C3Y4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:10:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C3Y4-1"}, "ts": "2023-07-14 11:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "H7BZ55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:10:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "H7BZ55"}, "ts": "2023-07-14 11:10:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HC56.25.25"}, "ts": "2023-07-14 11:10:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC56", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:10:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-14 11:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20570965", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:11:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20570965", "type": "PubMed"}, "ts": "2023-07-14 11:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45209NR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-14 11:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:12:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63173"}, "ts": "2023-07-14 11:12:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "4373463", "type": "PubMed"}, "ts": "2023-07-14 11:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4373463", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:12:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3MIR4.129.129"}, "ts": "2023-07-14 11:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MIR4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:12:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13772"}, "ts": "2023-07-14 11:13:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13772", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14142", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:13:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14142.52.52"}, "ts": "2023-07-14 11:13:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36414FS"}, "ts": "2023-07-14 11:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-14 11:13:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34067418", "type": "PubMed"}, "ts": "2023-07-14 11:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34067418", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:14:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:14:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:14:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62311", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:14:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62311"}, "ts": "2023-07-14 11:14:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2R2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2R2"}, "ts": "2023-07-14 11:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A188", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:15:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A188"}, "ts": "2023-07-14 11:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58283", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58283"}, "ts": "2023-07-14 11:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33316-3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:15:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33316-3"}, "ts": "2023-07-14 11:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61025-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:15:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61025-1"}, "ts": "2023-07-14 11:15:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54762-1"}, "ts": "2023-07-14 11:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54762-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16728594", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:15:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16728594", "type": "PubMed"}, "ts": "2023-07-14 11:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:15:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-14 11:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3T4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:15:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3T4-1"}, "ts": "2023-07-14 11:15:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RRH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:16:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RRH5"}, "ts": "2023-07-14 11:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64455", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:16:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTU4.89.89"}, "ts": "2023-07-14 11:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTU4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07477"}, "ts": "2023-07-14 11:17:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-14 11:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-14 11:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:17:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-14 11:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8816444", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:18:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8816444", "type": "PubMed"}, "ts": "2023-07-14 11:18:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-14 11:18:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ER63.156.156"}, "ts": "2023-07-14 11:19:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ER63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:19:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48067"}, "ts": "2023-07-14 11:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48067", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z173", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:19:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z173.532.532"}, "ts": "2023-07-14 11:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L7X3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L7X3-1"}, "ts": "2023-07-14 11:19:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYT8"}, "ts": "2023-07-14 11:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYT8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NAM6"}, "ts": "2023-07-14 11:19:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02487.279.279"}, "ts": "2023-07-14 11:19:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02487", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:20:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2VEC9"}, "ts": "2023-07-14 11:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2VEC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16473", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:20:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16473.350.350"}, "ts": "2023-07-14 11:20:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27040"}, "ts": "2023-07-14 11:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27040", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06702", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:20:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13233", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:20:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13233.21.21"}, "ts": "2023-07-14 11:20:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75695-1"}, "ts": "2023-07-14 11:20:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75695-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25274305", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:21:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25274305", "type": "PubMed"}, "ts": "2023-07-14 11:21:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48039", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-14 11:21:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48039.4.4"}, "ts": "2023-07-14 11:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24256811", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:21:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24256811", "type": "PubMed"}, "ts": "2023-07-14 11:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MK8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:21:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99MK8-1"}, "ts": "2023-07-14 11:21:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-14 11:21:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:22:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13611", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:23:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10758"}, "ts": "2023-07-14 11:23:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10758", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20208537", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:23:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20208537", "type": "PubMed"}, "ts": "2023-07-14 11:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01871-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:23:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01871-1"}, "ts": "2023-07-14 11:23:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:23:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCC3"}, "ts": "2023-07-14 11:23:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCC3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:23:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14508"}, "ts": "2023-07-14 11:23:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:23:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N4H0.263.263"}, "ts": "2023-07-14 11:23:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:23:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJA5.82.82"}, "ts": "2023-07-14 11:23:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01833-1"}, "ts": "2023-07-14 11:24:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-14 11:24:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-14 11:24:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHY0-1"}, "ts": "2023-07-14 11:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:24:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60477", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:25:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60477.23.23"}, "ts": "2023-07-14 11:25:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P58335.436.436"}, "ts": "2023-07-14 11:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58335", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:26:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6VMQ6.473.473"}, "ts": "2023-07-14 11:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6VMQ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80T79-3"}, "ts": "2023-07-14 11:27:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80T79-3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:27:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22174917", "type": "PubMed"}, "ts": "2023-07-14 11:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22174917", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64581-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64581-1"}, "ts": "2023-07-14 11:27:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9JI74", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 11:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI74", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 11:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI74", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 11:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27374177", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:27:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27374177", "type": "PubMed"}, "ts": "2023-07-14 11:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:27:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14525"}, "ts": "2023-07-14 11:27:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5E8.449.449"}, "ts": "2023-07-14 11:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5E8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18367677", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:28:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18367677", "type": "PubMed"}, "ts": "2023-07-14 11:28:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWB1"}, "ts": "2023-07-14 11:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31026469", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:28:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31026469", "type": "PubMed"}, "ts": "2023-07-14 11:28:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:28:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBY0"}, "ts": "2023-07-14 11:28:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-14 11:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15197", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:29:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15197.651.651"}, "ts": "2023-07-14 11:29:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18855522", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:29:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18855522", "type": "PubMed"}, "ts": "2023-07-14 11:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36375", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:29:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36375"}, "ts": "2023-07-14 11:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36414FS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07563"}, "ts": "2023-07-14 11:29:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07563", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06520", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:29:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06520.239.239"}, "ts": "2023-07-14 11:29:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54707"}, "ts": "2023-07-14 11:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88623", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:29:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88623"}, "ts": "2023-07-14 11:29:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12815-1"}, "ts": "2023-07-14 11:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12815-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:30:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02817.425.425"}, "ts": "2023-07-14 11:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02817", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:30:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06830-1"}, "ts": "2023-07-14 11:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06830-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:30:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01042", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:30:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01042.48.48"}, "ts": "2023-07-14 11:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:30:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH55"}, "ts": "2023-07-14 11:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:30:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17950006", "type": "PubMed"}, "ts": "2023-07-14 11:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17950006", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20489-1"}, "ts": "2023-07-14 11:31:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:31:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14242", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:31:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14242.129.129"}, "ts": "2023-07-14 11:31:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1311608", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:31:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1311608", "type": "PubMed"}, "ts": "2023-07-14 11:31:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02671"}, "ts": "2023-07-14 11:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZND0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:31:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZND0"}, "ts": "2023-07-14 11:31:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BQ52.449.449"}, "ts": "2023-07-14 11:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ52", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:31:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y312"}, "ts": "2023-07-14 11:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y312", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:32:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 11:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:32:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5WN11", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:32:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5WN11"}, "ts": "2023-07-14 11:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32850288", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:32:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32850288", "type": "PubMed"}, "ts": "2023-07-14 11:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32850288", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 11:32:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23301498", "type": "PubMed"}, "ts": "2023-07-14 11:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23301498", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5F1R6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:33:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5F1R6.229.229"}, "ts": "2023-07-14 11:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43529", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:33:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43529.122.122"}, "ts": "2023-07-14 11:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19588076", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:33:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19588076", "type": "PubMed"}, "ts": "2023-07-14 11:33:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15822"}, "ts": "2023-07-14 11:33:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15822", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:33:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64581RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:33:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:34:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4QR86-1"}, "ts": "2023-07-14 11:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4QR86-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:34:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00401.484.484"}, "ts": "2023-07-14 11:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00401", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X19"}, "ts": "2023-07-14 11:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFT4-1"}, "ts": "2023-07-14 11:35:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFT4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:35:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q64ET8.100.100"}, "ts": "2023-07-14 11:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64ET8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12740439", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:35:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12740439", "type": "PubMed"}, "ts": "2023-07-14 11:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04792"}, "ts": "2023-07-14 11:36:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:36:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "23219802"}, "ts": "2023-07-14 11:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 11:36:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04040"}, "ts": "2023-07-14 11:36:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-14 11:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23471", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:36:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23471.220.220"}, "ts": "2023-07-14 11:36:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55735"}, "ts": "2023-07-14 11:36:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00848"}, "ts": "2023-07-14 11:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00848", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14047PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:37:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-14 11:37:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33587032", "type": "PubMed"}, "ts": "2023-07-14 11:37:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33587032", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11717"}, "ts": "2023-07-14 11:38:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11717", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25220262", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:38:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25220262", "type": "PubMed"}, "ts": "2023-07-14 11:38:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:38:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD2"}, "ts": "2023-07-14 11:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:39:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK82"}, "ts": "2023-07-14 11:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTZ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:40:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01833-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:40:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JTZ9.152.152"}, "ts": "2023-07-14 11:40:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H7N4.245.245"}, "ts": "2023-07-14 11:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7N4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U962", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 11:40:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3U962", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 11:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U962", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 11:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE71", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:40:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NE71.596.596"}, "ts": "2023-07-14 11:40:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P63151.389.389"}, "ts": "2023-07-14 11:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63151", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZ23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:41:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZ23"}, "ts": "2023-07-14 11:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13310", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:41:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13310.644.644"}, "ts": "2023-07-14 11:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19801", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:41:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19801.276.276"}, "ts": "2023-07-14 11:41:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95477", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:41:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95477.746.746"}, "ts": "2023-07-14 11:41:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P6S0"}, "ts": "2023-07-14 11:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P6S0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:42:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15427"}, "ts": "2023-07-14 11:42:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80303"}, "ts": "2023-07-14 11:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61208", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:42:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61208"}, "ts": "2023-07-14 11:42:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-14 11:43:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5SW96.260.260"}, "ts": "2023-07-14 11:43:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SW96", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21734707", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:43:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21734707", "type": "PubMed"}, "ts": "2023-07-14 11:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91413ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:45:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:45:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JE67"}, "ts": "2023-07-14 11:45:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JE67", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:45:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56856"}, "ts": "2023-07-14 11:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAV4"}, "ts": "2023-07-14 11:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:45:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14246", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:45:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14246.522.522"}, "ts": "2023-07-14 11:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R6I7"}, "ts": "2023-07-14 11:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R6I7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-14 11:45:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32418.850.850"}, "ts": "2023-07-14 11:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 11:45:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 11:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 11:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:45:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99JF8.122.122"}, "ts": "2023-07-14 11:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JF8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:46:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22573RC"}, "ts": "2023-07-14 11:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22573RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-14 11:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27106", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:46:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27106"}, "ts": "2023-07-14 11:46:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:46:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TM6"}, "ts": "2023-07-14 11:46:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24449917", "type": "PubMed"}, "ts": "2023-07-14 11:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24449917", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:46:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z739.46.46"}, "ts": "2023-07-14 11:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CA95-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:46:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CA95-1"}, "ts": "2023-07-14 11:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20489-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:47:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22607.760.760"}, "ts": "2023-07-14 11:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51787", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:47:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51787"}, "ts": "2023-07-14 11:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:47:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00480"}, "ts": "2023-07-14 11:47:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99805"}, "ts": "2023-07-14 11:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8Y8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:48:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:48:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H8Y8.262.262"}, "ts": "2023-07-14 11:48:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:49:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14923.387.387"}, "ts": "2023-07-14 11:49:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-14 11:49:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPV8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:49:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:49:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BPV8.31.31"}, "ts": "2023-07-14 11:49:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8B7"}, "ts": "2023-07-14 11:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8B7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:50:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10816555", "type": "PubMed"}, "ts": "2023-07-14 11:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10816555", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09486", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:50:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09486"}, "ts": "2023-07-14 11:50:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493-1"}, "ts": "2023-07-14 11:51:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92832", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:51:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92832.340.340"}, "ts": "2023-07-14 11:51:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047-1.1205.1205"}, "ts": "2023-07-14 11:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11047-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:51:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWJ2"}, "ts": "2023-07-14 11:51:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08999.194.194"}, "ts": "2023-07-14 11:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08999", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:52:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A096MJY1-1"}, "ts": "2023-07-14 11:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A096MJY1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW85", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:53:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW85"}, "ts": "2023-07-14 11:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17850793", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:53:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17850793", "type": "PubMed"}, "ts": "2023-07-14 11:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13798-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:53:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13798-1"}, "ts": "2023-07-14 11:53:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29011JC"}, "ts": "2023-07-14 11:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMW2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:53:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMW2.475.475"}, "ts": "2023-07-14 11:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:53:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12565886", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:53:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12565886", "type": "PubMed"}, "ts": "2023-07-14 11:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 11:53:39 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 11:53:40 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 11:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 11:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 11:54:13 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "CD14", "term_category": "any"}, "ts": "2023-07-14 11:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">9ccf94f467e2cbebff23bfd81900e9b1", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"CD14\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 11:54:13 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 11:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9ccf94f467e2cbebff23bfd81900e9b1", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 11:54:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "9ccf94f467e2cbebff23bfd81900e9b1", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 11:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08571-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:54:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08571-1"}, "ts": "2023-07-14 11:54:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02402FF"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33609NS"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42962KI"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59626AS"}, "ts": "2023-07-14 11:54:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13258"}, "ts": "2023-07-14 11:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:54:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37231"}, "ts": "2023-07-14 11:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12507995", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:54:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12507995", "type": "PubMed"}, "ts": "2023-07-14 11:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01614ZM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 11:54:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y587"}, "ts": "2023-07-14 11:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y587", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYM0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QYM0-1"}, "ts": "2023-07-14 11:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11229"}, "ts": "2023-07-14 11:55:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:55:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWA0-1"}, "ts": "2023-07-14 11:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWA0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:55:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04440", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:55:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04440.48.48"}, "ts": "2023-07-14 11:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66538GV"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82020ZR"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84820NF"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66676MI"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 11:55:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2A9"}, "ts": "2023-07-14 11:56:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7629110", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:56:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7629110", "type": "PubMed"}, "ts": "2023-07-14 11:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:56:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-14 11:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14522961", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:56:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14522961", "type": "PubMed"}, "ts": "2023-07-14 11:56:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06828-1.166.166"}, "ts": "2023-07-14 11:56:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06828-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:56:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N461.295.295"}, "ts": "2023-07-14 11:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N461", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:56:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NEW0.243.243"}, "ts": "2023-07-14 11:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54748", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:57:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54748.672.672"}, "ts": "2023-07-14 11:57:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26392224", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:57:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26392224", "type": "PubMed"}, "ts": "2023-07-14 11:57:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106-1"}, "ts": "2023-07-14 11:57:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88488.904.904"}, "ts": "2023-07-14 11:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88488", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:57:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U204"}, "ts": "2023-07-14 11:58:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U204", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:58:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26041762", "type": "PubMed"}, "ts": "2023-07-14 11:58:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26041762", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 11:58:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9E0-1"}, "ts": "2023-07-14 11:58:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06330"}, "ts": "2023-07-14 11:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9E0-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:58:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:59:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15304", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 11:59:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15304.70.70"}, "ts": "2023-07-14 11:59:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZV76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 11:59:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZXB8-1"}, "ts": "2023-07-14 11:59:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZXB8-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 11:59:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZV76"}, "ts": "2023-07-14 11:59:56 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 12:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 12:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 12:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 12:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 12:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 12:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4L180.1091.1091"}, "ts": "2023-07-14 12:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4L180", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21135090", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:00:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21135090", "type": "PubMed"}, "ts": "2023-07-14 12:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:01:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A732"}, "ts": "2023-07-14 12:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969D9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56856", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:01:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17927"}, "ts": "2023-07-14 12:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:01:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969D9-1"}, "ts": "2023-07-14 12:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6C5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:01:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6C5"}, "ts": "2023-07-14 12:01:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75976", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:02:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75976.1070.1070"}, "ts": "2023-07-14 12:02:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PGP7.1486.1486"}, "ts": "2023-07-14 12:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGP7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:02:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNA1"}, "ts": "2023-07-14 12:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GX86-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:02:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6GX86-1"}, "ts": "2023-07-14 12:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-14 12:03:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYC2.106.106"}, "ts": "2023-07-14 12:03:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYC2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:03:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00480", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:03:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FF6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:03:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68FF6.224.224"}, "ts": "2023-07-14 12:03:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-14 12:03:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14247"}, "ts": "2023-07-14 12:04:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-14 12:04:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:04:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10369865", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:04:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10369865", "type": "PubMed"}, "ts": "2023-07-14 12:04:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07949", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:04:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07949.396.396"}, "ts": "2023-07-14 12:04:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15299664", "type": "PubMed"}, "ts": "2023-07-14 12:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15299664", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:04:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DFV6"}, "ts": "2023-07-14 12:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DFV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:05:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YBV0"}, "ts": "2023-07-14 12:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YBV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:05:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PK18"}, "ts": "2023-07-14 12:05:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:05:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14796", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:05:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14796"}, "ts": "2023-07-14 12:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17405"}, "ts": "2023-07-14 12:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17405", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P202", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P202"}, "ts": "2023-07-14 12:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:06:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPH0"}, "ts": "2023-07-14 12:06:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33139577", "type": "PubMed"}, "ts": "2023-07-14 12:06:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33139577", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33139577", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 12:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 12:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:06:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07350"}, "ts": "2023-07-14 12:07:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UK55.295.295"}, "ts": "2023-07-14 12:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK55", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08857-1"}, "ts": "2023-07-14 12:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:07:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41279.400.400"}, "ts": "2023-07-14 12:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:07:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPG3.660.660"}, "ts": "2023-07-14 12:07:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35615.925.925"}, "ts": "2023-07-14 12:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35615", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:08:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P80188-1.85.85"}, "ts": "2023-07-14 12:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80188-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:08:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06496.623.623"}, "ts": "2023-07-14 12:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06496", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:08:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TM6"}, "ts": "2023-07-14 12:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29011JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2D9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:09:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2D9-1"}, "ts": "2023-07-14 12:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22933", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:09:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22933.103.103"}, "ts": "2023-07-14 12:09:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27826023", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:09:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27826023", "type": "PubMed"}, "ts": "2023-07-14 12:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR51"}, "ts": "2023-07-14 12:10:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR51", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28270450", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:10:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28270450", "type": "PubMed"}, "ts": "2023-07-14 12:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:10:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBN1"}, "ts": "2023-07-14 12:10:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01889.344.344"}, "ts": "2023-07-14 12:10:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01889", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56705", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:10:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56705.228.228"}, "ts": "2023-07-14 12:10:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGR6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:10:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGR6.25.25"}, "ts": "2023-07-14 12:10:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JWP9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:10:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JWP9-1"}, "ts": "2023-07-14 12:10:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26012", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:10:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26012.270.270"}, "ts": "2023-07-14 12:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:10:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0M0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:10:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5I0M0"}, "ts": "2023-07-14 12:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCJ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:10:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCJ2-1"}, "ts": "2023-07-14 12:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:11:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06210"}, "ts": "2023-07-14 12:11:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969F9-1"}, "ts": "2023-07-14 12:11:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969F9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00033MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:12:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-14 12:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15544348", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:13:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15544348", "type": "PubMed"}, "ts": "2023-07-14 12:13:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24290375", "type": "PubMed"}, "ts": "2023-07-14 12:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24290375", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:13:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33785307", "type": "PubMed"}, "ts": "2023-07-14 12:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33785307", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33785307", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 12:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ANA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ANA3"}, "ts": "2023-07-14 12:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:13:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43883"}, "ts": "2023-07-14 12:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:14:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-14 12:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PT87", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:14:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "E9PT87.422.422"}, "ts": "2023-07-14 12:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29262349", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:15:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29262349", "type": "PubMed"}, "ts": "2023-07-14 12:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:15:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16658"}, "ts": "2023-07-14 12:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16658", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9QAE3"}, "ts": "2023-07-14 12:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9QAE3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:15:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26232"}, "ts": "2023-07-14 12:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26232", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:16:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZL6"}, "ts": "2023-07-14 12:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL18", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:18:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL18"}, "ts": "2023-07-14 12:18:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-14 12:18:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15699", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:18:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15699.306.306"}, "ts": "2023-07-14 12:18:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02461.863.863"}, "ts": "2023-07-14 12:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02461", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:18:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731-1"}, "ts": "2023-07-14 12:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:18:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56589"}, "ts": "2023-07-14 12:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:18:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17017", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:18:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17017"}, "ts": "2023-07-14 12:18:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 12:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25490"}, "ts": "2023-07-14 12:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-14 12:19:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00602-1"}, "ts": "2023-07-14 12:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00602-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97686", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:20:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97686.1181.1181"}, "ts": "2023-07-14 12:20:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070-1"}, "ts": "2023-07-14 12:20:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33275228", "type": "PubMed"}, "ts": "2023-07-14 12:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33275228", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:20:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16555.514.514"}, "ts": "2023-07-14 12:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:21:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08761"}, "ts": "2023-07-14 12:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08761", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWB7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:21:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWB7.262.262"}, "ts": "2023-07-14 12:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M7T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:21:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M7T9"}, "ts": "2023-07-14 12:21:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:21:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X27"}, "ts": "2023-07-14 12:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IF42", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:22:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IF42.233.233"}, "ts": "2023-07-14 12:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08857-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:23:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-14 12:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30224647", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:25:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30224647", "type": "PubMed"}, "ts": "2023-07-14 12:25:07 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000080", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-14 12:25:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 12:25:15 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000080", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-14 12:25:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000080", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 12:25:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UR1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:26:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UR1-1"}, "ts": "2023-07-14 12:26:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01279.1018.1018"}, "ts": "2023-07-14 12:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13352", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:26:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13352"}, "ts": "2023-07-14 12:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ET54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:26:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ET54"}, "ts": "2023-07-14 12:26:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04075"}, "ts": "2023-07-14 12:26:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2T4"}, "ts": "2023-07-14 12:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2T4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4K0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:26:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:26:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16150-1"}, "ts": "2023-07-14 12:26:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4K0"}, "ts": "2023-07-14 12:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:27:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4C5.207.207"}, "ts": "2023-07-14 12:27:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-14 12:27:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23945"}, "ts": "2023-07-14 12:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9635433", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:27:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9635433", "type": "PubMed"}, "ts": "2023-07-14 12:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UPF5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:27:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UPF5.553.553"}, "ts": "2023-07-14 12:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06609-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:27:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06609-1"}, "ts": "2023-07-14 12:27:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7647793", "type": "PubMed"}, "ts": "2023-07-14 12:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7647793", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51692", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:28:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51692"}, "ts": "2023-07-14 12:28:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZV5"}, "ts": "2023-07-14 12:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZV5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:28:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15083", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:28:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15083.34.34"}, "ts": "2023-07-14 12:28:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63208"}, "ts": "2023-07-14 12:28:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22926438", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:30:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22926438", "type": "PubMed"}, "ts": "2023-07-14 12:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15319", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:30:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15319.260.260"}, "ts": "2023-07-14 12:30:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07666"}, "ts": "2023-07-14 12:30:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08133"}, "ts": "2023-07-14 12:30:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60149QJ"}, "ts": "2023-07-14 12:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60149QJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWN6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:30:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VWN6.1916.1916"}, "ts": "2023-07-14 12:30:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-14 12:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12160727", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:31:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12160727", "type": "PubMed"}, "ts": "2023-07-14 12:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:31:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33897", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:31:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33897"}, "ts": "2023-07-14 12:31:05 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q62443", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 12:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62443", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 12:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:31:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-14 12:31:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:32:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5L3-1"}, "ts": "2023-07-14 12:32:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04899-1"}, "ts": "2023-07-14 12:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04899-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56677", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:32:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56677"}, "ts": "2023-07-14 12:32:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618"}, "ts": "2023-07-14 12:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1ARD8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:32:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1ARD8-1"}, "ts": "2023-07-14 12:32:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28906"}, "ts": "2023-07-14 12:33:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62888"}, "ts": "2023-07-14 12:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:33:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZTN6.465.465"}, "ts": "2023-07-14 12:33:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZTN6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:33:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07283.45.45"}, "ts": "2023-07-14 12:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07283", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:33:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12778-1"}, "ts": "2023-07-14 12:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92729", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:34:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92729.1285.1285"}, "ts": "2023-07-14 12:34:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29301961", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:34:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29301961", "type": "PubMed"}, "ts": "2023-07-14 12:34:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:34:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TN88", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:34:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7TN88.494.494"}, "ts": "2023-07-14 12:34:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CWK8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:34:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CWK8.97.97"}, "ts": "2023-07-14 12:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:34:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14008"}, "ts": "2023-07-14 12:34:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70557"}, "ts": "2023-07-14 12:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70557", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49257", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:34:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49257"}, "ts": "2023-07-14 12:34:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:35:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:35:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39052.231.231"}, "ts": "2023-07-14 12:35:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZW1"}, "ts": "2023-07-14 12:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:36:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19881492", "type": "PubMed"}, "ts": "2023-07-14 12:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19881492", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:36:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55207-1"}, "ts": "2023-07-14 12:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55207-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:36:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-14 12:37:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UID3.604.604"}, "ts": "2023-07-14 12:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UID3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35658", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35658"}, "ts": "2023-07-14 12:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43567"}, "ts": "2023-07-14 12:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43567", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:37:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8588814", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:37:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8588814", "type": "PubMed"}, "ts": "2023-07-14 12:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07998"}, "ts": "2023-07-14 12:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:37:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04004-1.242.242"}, "ts": "2023-07-14 12:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04004-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:37:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-14 12:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22815884", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:38:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22815884", "type": "PubMed"}, "ts": "2023-07-14 12:38:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9052839", "type": "PubMed"}, "ts": "2023-07-14 12:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9052839", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:38:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHQ8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:38:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHQ8"}, "ts": "2023-07-14 12:38:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:38:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM46"}, "ts": "2023-07-14 12:38:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:39:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43306"}, "ts": "2023-07-14 12:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGX5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:40:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGX5.193.193"}, "ts": "2023-07-14 12:40:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32788217", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:40:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32788217", "type": "PubMed"}, "ts": "2023-07-14 12:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94829", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:40:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94829.339.339"}, "ts": "2023-07-14 12:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60383", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:40:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60383.269.269"}, "ts": "2023-07-14 12:40:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51575"}, "ts": "2023-07-14 12:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:41:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48961"}, "ts": "2023-07-14 12:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1B0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:41:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99N18-1"}, "ts": "2023-07-14 12:41:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T1B0.598.598"}, "ts": "2023-07-14 12:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99N18-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CFC4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:41:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CFC4-1"}, "ts": "2023-07-14 12:41:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLC6"}, "ts": "2023-07-14 12:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLC6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD16", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:41:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TD16.181.181"}, "ts": "2023-07-14 12:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CCJ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:42:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CCJ4.154.154"}, "ts": "2023-07-14 12:42:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:42:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-14 12:42:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:42:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ5"}, "ts": "2023-07-14 12:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29526543", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:42:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29526543", "type": "PubMed"}, "ts": "2023-07-14 12:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12707239", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:42:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12707239", "type": "PubMed"}, "ts": "2023-07-14 12:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50704", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:42:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50704"}, "ts": "2023-07-14 12:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63155", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:43:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63155"}, "ts": "2023-07-14 12:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:43:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWS6"}, "ts": "2023-07-14 12:43:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRF8.567.567"}, "ts": "2023-07-14 12:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRF8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:44:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19639"}, "ts": "2023-07-14 12:44:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92954.460.460"}, "ts": "2023-07-14 12:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:44:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14625"}, "ts": "2023-07-14 12:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:44:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15258"}, "ts": "2023-07-14 12:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63208", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:44:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BWH6.1101.1101"}, "ts": "2023-07-14 12:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWH6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17356132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:45:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17356132", "type": "PubMed"}, "ts": "2023-07-14 12:45:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16157"}, "ts": "2023-07-14 12:45:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30028079", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:46:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30028079", "type": "PubMed"}, "ts": "2023-07-14 12:46:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07666", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:46:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K6W8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:46:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K6W8"}, "ts": "2023-07-14 12:46:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6NS60.477.477"}, "ts": "2023-07-14 12:46:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NS60", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10788476", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:46:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10788476", "type": "PubMed"}, "ts": "2023-07-14 12:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08133", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:46:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:46:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60566.665.665"}, "ts": "2023-07-14 12:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60566", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:46:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27986.376.376"}, "ts": "2023-07-14 12:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27986", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:46:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8-1"}, "ts": "2023-07-14 12:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:47:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12860.634.634"}, "ts": "2023-07-14 12:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27265029", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:47:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:47:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQ79"}, "ts": "2023-07-14 12:47:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQ79", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 12:47:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:47:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30006231", "type": "PubMed"}, "ts": "2023-07-14 12:47:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30006231", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:47:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27265029", "type": "PubMed"}, "ts": "2023-07-14 12:47:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:48:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15791TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:48:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15791TK"}, "ts": "2023-07-14 12:48:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7530363", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:48:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7530363", "type": "PubMed"}, "ts": "2023-07-14 12:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07936", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:48:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07936.192.192"}, "ts": "2023-07-14 12:48:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JK48.145.145"}, "ts": "2023-07-14 12:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK48", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63545", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:48:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63545"}, "ts": "2023-07-14 12:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28906", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12001-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:49:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12001-1"}, "ts": "2023-07-14 12:49:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "17825416"}, "ts": "2023-07-14 12:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 12:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16807956", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:49:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16807956", "type": "PubMed"}, "ts": "2023-07-14 12:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12778-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10636", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:50:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10636.369.369"}, "ts": "2023-07-14 12:50:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20700-1"}, "ts": "2023-07-14 12:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36543"}, "ts": "2023-07-14 12:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:52:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33678755", "type": "PubMed"}, "ts": "2023-07-14 12:52:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33678755", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33678755", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 12:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGR3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:52:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGR3.7.7"}, "ts": "2023-07-14 12:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07483YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:52:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222-1"}, "ts": "2023-07-14 12:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24821-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:53:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24821-1"}, "ts": "2023-07-14 12:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:53:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22771-1"}, "ts": "2023-07-14 12:53:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838"}, "ts": "2023-07-14 12:54:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17525340", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:54:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17525340", "type": "PubMed"}, "ts": "2023-07-14 12:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9119228", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:55:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9119228", "type": "PubMed"}, "ts": "2023-07-14 12:55:15 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q09328-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 12:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09328-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 12:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09328-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 12:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21588"}, "ts": "2023-07-14 12:55:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27811", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:56:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27811"}, "ts": "2023-07-14 12:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:56:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8JZM4"}, "ts": "2023-07-14 12:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU38", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:56:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WU38.631.631"}, "ts": "2023-07-14 12:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70227"}, "ts": "2023-07-14 12:56:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70227"}, "ts": "2023-07-14 12:56:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2E2"}, "ts": "2023-07-14 12:56:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2E2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZQF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:56:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZQF0.863.863"}, "ts": "2023-07-14 12:56:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWB7-1"}, "ts": "2023-07-14 12:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWB7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ79", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:57:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WZ79.318.318"}, "ts": "2023-07-14 12:57:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05241IE"}, "ts": "2023-07-14 12:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63261", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05241IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:57:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P63261.277.277"}, "ts": "2023-07-14 12:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18847"}, "ts": "2023-07-14 12:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D701", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:57:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D701"}, "ts": "2023-07-14 12:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12775773", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:57:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12775773", "type": "PubMed"}, "ts": "2023-07-14 12:57:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "19340428"}, "ts": "2023-07-14 12:57:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4B5.87.87"}, "ts": "2023-07-14 12:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4B5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:57:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-14 12:57:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19409878", "type": "PubMed"}, "ts": "2023-07-14 12:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19409878", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:57:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXX6-1"}, "ts": "2023-07-14 12:58:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXX6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3108864", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 12:58:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3108864", "type": "PubMed"}, "ts": "2023-07-14 12:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQB3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 12:58:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQB3.456.456"}, "ts": "2023-07-14 12:58:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99347TW"}, "ts": "2023-07-14 12:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99347TW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 12:59:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZP2"}, "ts": "2023-07-14 12:59:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 12:59:49 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 13:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 13:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 13:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 13:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 13:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 13:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GV57", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:00:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GV57"}, "ts": "2023-07-14 13:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9382921", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:00:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9382921", "type": "PubMed"}, "ts": "2023-07-14 13:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY1"}, "ts": "2023-07-14 13:00:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15927"}, "ts": "2023-07-14 13:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGN4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:00:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CGN4.1131.1131"}, "ts": "2023-07-14 13:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6179042", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:00:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6179042", "type": "PubMed"}, "ts": "2023-07-14 13:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DH6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:01:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96DH6.6.6"}, "ts": "2023-07-14 13:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25119-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:01:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25119-1"}, "ts": "2023-07-14 13:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11306681", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:01:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11306681", "type": "PubMed"}, "ts": "2023-07-14 13:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:01:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QNW6"}, "ts": "2023-07-14 13:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:02:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14859.162.162"}, "ts": "2023-07-14 13:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23886940", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:02:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23886940", "type": "PubMed"}, "ts": "2023-07-14 13:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0P8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:02:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P0P8.106.106"}, "ts": "2023-07-14 13:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:02:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHK0"}, "ts": "2023-07-14 13:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3D4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:02:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N3D4.1417.1417"}, "ts": "2023-07-14 13:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2B2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:03:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2B2.89.89"}, "ts": "2023-07-14 13:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:03:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-14 13:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48651", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:03:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48651.442.442"}, "ts": "2023-07-14 13:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05019", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:03:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05019.118.118"}, "ts": "2023-07-14 13:03:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:03:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AY3"}, "ts": "2023-07-14 13:03:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08047"}, "ts": "2023-07-14 13:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZK14", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZK14"}, "ts": "2023-07-14 13:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-14 13:04:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:04:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62073", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:04:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62073.187.187"}, "ts": "2023-07-14 13:04:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHG3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:04:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHG3.288.288"}, "ts": "2023-07-14 13:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRD8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:04:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRD8.641.641"}, "ts": "2023-07-14 13:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AVJ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:04:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AVJ5.28.28"}, "ts": "2023-07-14 13:04:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04609", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04609"}, "ts": "2023-07-14 13:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2X3"}, "ts": "2023-07-14 13:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2X3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:05:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGV8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:05:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-14 13:05:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGV8-1"}, "ts": "2023-07-14 13:05:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:05:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30237316", "type": "PubMed"}, "ts": "2023-07-14 13:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30237316", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNE0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:06:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNE0"}, "ts": "2023-07-14 13:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12657635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:06:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12657635", "type": "PubMed"}, "ts": "2023-07-14 13:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20700-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:06:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TJ5"}, "ts": "2023-07-14 13:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:06:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12459258", "type": "PubMed"}, "ts": "2023-07-14 13:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12459258", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:06:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35637"}, "ts": "2023-07-14 13:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:06:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-14 13:06:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 13:06:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-14 13:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:07:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY11"}, "ts": "2023-07-14 13:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:07:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0D2"}, "ts": "2023-07-14 13:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYA6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:07:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IYA6.217.217"}, "ts": "2023-07-14 13:07:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06826"}, "ts": "2023-07-14 13:07:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06826", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:07:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11060459", "type": "PubMed"}, "ts": "2023-07-14 13:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11060459", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11060459", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 13:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22771-1"}, "ts": "2023-07-14 13:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:08:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O43657", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 13:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43657", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 13:08:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7B8-1"}, "ts": "2023-07-14 13:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7B8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:09:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68CZ2.944.944"}, "ts": "2023-07-14 13:09:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61415TZ"}, "ts": "2023-07-14 13:10:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01222"}, "ts": "2023-07-14 13:10:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61415TZ"}, "ts": "2023-07-14 13:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41180", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:10:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41180"}, "ts": "2023-07-14 13:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15385675", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:10:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15385675", "type": "PubMed"}, "ts": "2023-07-14 13:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28356354", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:10:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28356354", "type": "PubMed"}, "ts": "2023-07-14 13:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80SZ6"}, "ts": "2023-07-14 13:11:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80SZ6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:11:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38935"}, "ts": "2023-07-14 13:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38935", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:11:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PU5.400.400"}, "ts": "2023-07-14 13:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32297", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:11:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32297.501.501"}, "ts": "2023-07-14 13:11:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76093-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76093-1"}, "ts": "2023-07-14 13:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BMD4"}, "ts": "2023-07-14 13:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BMD4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01101"}, "ts": "2023-07-14 13:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01101", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BH10-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:12:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BH10-1"}, "ts": "2023-07-14 13:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:12:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16407075", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:12:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16407075", "type": "PubMed"}, "ts": "2023-07-14 13:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVU1-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:12:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVU1-1.489.489"}, "ts": "2023-07-14 13:12:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TE56.253.253"}, "ts": "2023-07-14 13:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE56", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:13:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570"}, "ts": "2023-07-14 13:13:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:13:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-14 13:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:13:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8247530", "type": "PubMed"}, "ts": "2023-07-14 13:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8247530", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A2I1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:14:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A2I1"}, "ts": "2023-07-14 13:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5B9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:14:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5B9.508.508"}, "ts": "2023-07-14 13:14:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O60938", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 13:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60938", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 13:14:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6N8.204.204"}, "ts": "2023-07-14 13:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3J2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:15:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3J2.265.265"}, "ts": "2023-07-14 13:15:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26232.341.341"}, "ts": "2023-07-14 13:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26232", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:15:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18329369", "type": "PubMed"}, "ts": "2023-07-14 13:15:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18329369", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:16:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9N5"}, "ts": "2023-07-14 13:16:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9N5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43719", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:16:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43719"}, "ts": "2023-07-14 13:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:16:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NG31.586.586"}, "ts": "2023-07-14 13:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG31", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9891984", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:17:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9891984", "type": "PubMed"}, "ts": "2023-07-14 13:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79568CQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 13:17:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79568CQ"}, "ts": "2023-07-14 13:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35386-1"}, "ts": "2023-07-14 13:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35386-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q501W1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:17:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q501W1"}, "ts": "2023-07-14 13:17:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ER42-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ER42-1"}, "ts": "2023-07-14 13:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231"}, "ts": "2023-07-14 13:18:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5L0.325.325"}, "ts": "2023-07-14 13:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:18:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15465"}, "ts": "2023-07-14 13:18:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97465.336.336"}, "ts": "2023-07-14 13:18:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97465", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:18:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12653562", "type": "PubMed"}, "ts": "2023-07-14 13:18:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921Y0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:18:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921Y0-1"}, "ts": "2023-07-14 13:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 13:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14427", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 13:18:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14427", "cluster_type": "unselected"}, "ts": "2023-07-14 13:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14427", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 13:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12653562", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:18:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32M07"}, "ts": "2023-07-14 13:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32M07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:19:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42701", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:19:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42701.37.37"}, "ts": "2023-07-14 13:19:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02091-1"}, "ts": "2023-07-14 13:19:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653-1"}, "ts": "2023-07-14 13:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68431"}, "ts": "2023-07-14 13:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14940"}, "ts": "2023-07-14 13:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:19:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11934865", "type": "PubMed"}, "ts": "2023-07-14 13:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11934865", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6146607", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:20:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6146607", "type": "PubMed"}, "ts": "2023-07-14 13:20:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHY1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:20:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JHY1.185.185"}, "ts": "2023-07-14 13:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7915137", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:20:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7915137", "type": "PubMed"}, "ts": "2023-07-14 13:20:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4B5.501.501"}, "ts": "2023-07-14 13:20:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16611247", "type": "PubMed"}, "ts": "2023-07-14 13:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16611247", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVE8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:21:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BVE8.121.121"}, "ts": "2023-07-14 13:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MQT2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:22:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8MQT2.304.304"}, "ts": "2023-07-14 13:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16797541", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:22:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16797541", "type": "PubMed"}, "ts": "2023-07-14 13:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZZ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:22:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZZ8.75.75"}, "ts": "2023-07-14 13:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11388-1"}, "ts": "2023-07-14 13:22:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15611106", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:23:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15611106", "type": "PubMed"}, "ts": "2023-07-14 13:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:23:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTX8"}, "ts": "2023-07-14 13:23:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPW4"}, "ts": "2023-07-14 13:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPW4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11162494", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:23:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11162494", "type": "PubMed"}, "ts": "2023-07-14 13:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17544", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:23:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17544"}, "ts": "2023-07-14 13:24:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13562", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:24:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13562.259.259"}, "ts": "2023-07-14 13:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13995", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:24:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13995"}, "ts": "2023-07-14 13:24:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M8Z5-1"}, "ts": "2023-07-14 13:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M8Z5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SXM2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:25:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SXM2"}, "ts": "2023-07-14 13:25:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42285"}, "ts": "2023-07-14 13:25:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42285", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:25:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULL0.228.228"}, "ts": "2023-07-14 13:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULL0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:25:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23354439", "type": "PubMed"}, "ts": "2023-07-14 13:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23354439", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 13:25:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26644DW"}, "ts": "2023-07-14 13:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26644DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 13:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2P9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:25:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26435498", "type": "PubMed"}, "ts": "2023-07-14 13:25:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2P9-1"}, "ts": "2023-07-14 13:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26435498", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:25:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NP85.242.242"}, "ts": "2023-07-14 13:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP85", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:26:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17177604", "type": "PubMed"}, "ts": "2023-07-14 13:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17177604", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LG2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:26:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LG2-1"}, "ts": "2023-07-14 13:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA0"}, "ts": "2023-07-14 13:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM3"}, "ts": "2023-07-14 13:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 13:26:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14136.7.7"}, "ts": "2023-07-14 13:26:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14136", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61415TZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 13:26:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06733"}, "ts": "2023-07-14 13:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61415TZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 13:26:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61415TZ"}, "ts": "2023-07-14 13:26:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63612VM"}, "ts": "2023-07-14 13:26:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11432AF"}, "ts": "2023-07-14 13:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKT4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:26:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKT4-1"}, "ts": "2023-07-14 13:26:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JWL4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:27:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JWL4-1"}, "ts": "2023-07-14 13:27:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08476"}, "ts": "2023-07-14 13:27:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18653BM"}, "ts": "2023-07-14 13:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11112348", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:27:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11112348", "type": "PubMed"}, "ts": "2023-07-14 13:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18653BM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 13:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31826563", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:27:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31826563", "type": "PubMed"}, "ts": "2023-07-14 13:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31826563", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 13:27:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08476"}, "ts": "2023-07-14 13:27:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26599-3"}, "ts": "2023-07-14 13:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26599-3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX52", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:27:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NX52.273.273"}, "ts": "2023-07-14 13:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:27:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-14 13:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX47"}, "ts": "2023-07-14 13:28:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJN5-1"}, "ts": "2023-07-14 13:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJN5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:28:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25043025", "type": "PubMed"}, "ts": "2023-07-14 13:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25043025", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31809976", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:28:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31809976", "type": "PubMed"}, "ts": "2023-07-14 13:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28778945", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:28:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28778945", "type": "PubMed"}, "ts": "2023-07-14 13:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21245099", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:29:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21245099", "type": "PubMed"}, "ts": "2023-07-14 13:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8456283", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:29:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8456283", "type": "PubMed"}, "ts": "2023-07-14 13:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0G7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0G7-1"}, "ts": "2023-07-14 13:29:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:29:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53007"}, "ts": "2023-07-14 13:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IW41"}, "ts": "2023-07-14 13:29:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:30:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXF1-1"}, "ts": "2023-07-14 13:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXF1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:30:10 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8N0Z6", "cluster_type": "unselected"}, "ts": "2023-07-14 13:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0Z6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 13:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0Z6", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 13:30:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13450PJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 13:30:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13450PJ"}, "ts": "2023-07-14 13:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12931"}, "ts": "2023-07-14 13:30:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60732.25.25"}, "ts": "2023-07-14 13:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60732", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:31:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82450"}, "ts": "2023-07-14 13:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C6I2-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 13:31:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8C6I2-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 13:31:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6N9.519.519"}, "ts": "2023-07-14 13:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:31:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10807908", "type": "PubMed"}, "ts": "2023-07-14 13:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10807908", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:31:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35599"}, "ts": "2023-07-14 13:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35599", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIS1"}, "ts": "2023-07-14 13:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51943"}, "ts": "2023-07-14 13:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:32:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16511036", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:32:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16511036", "type": "PubMed"}, "ts": "2023-07-14 13:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H477", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:32:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H477.59.59"}, "ts": "2023-07-14 13:32:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14970211", "type": "PubMed"}, "ts": "2023-07-14 13:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14970211", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:32:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L8C5-1"}, "ts": "2023-07-14 13:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L8C5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:32:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12861019", "type": "PubMed"}, "ts": "2023-07-14 13:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12861019", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:32:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQB3.382.382"}, "ts": "2023-07-14 13:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJ57-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:32:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJ57-1"}, "ts": "2023-07-14 13:32:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H900-1"}, "ts": "2023-07-14 13:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H900-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12228244", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:33:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12228244", "type": "PubMed"}, "ts": "2023-07-14 13:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:33:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VT25", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:33:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VT25.222.222"}, "ts": "2023-07-14 13:33:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15465", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:34:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-14 13:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43166", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:34:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43166.5.5"}, "ts": "2023-07-14 13:34:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03526", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:34:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03526.186.186"}, "ts": "2023-07-14 13:34:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TD43.1152.1152"}, "ts": "2023-07-14 13:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD43", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:35:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60306"}, "ts": "2023-07-14 13:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ79", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:35:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQ79.507.507"}, "ts": "2023-07-14 13:35:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:35:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14936", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:35:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14936.399.399"}, "ts": "2023-07-14 13:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14244", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:35:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14244.8.8"}, "ts": "2023-07-14 13:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15653", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:35:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15653.23.23"}, "ts": "2023-07-14 13:35:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00742-1.221.221"}, "ts": "2023-07-14 13:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00742-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHS0"}, "ts": "2023-07-14 13:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHS0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:36:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54868"}, "ts": "2023-07-14 13:36:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "C9JN71.415.415"}, "ts": "2023-07-14 13:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JN71", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:36:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11499"}, "ts": "2023-07-14 13:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11499", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48764", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:36:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48764.526.526"}, "ts": "2023-07-14 13:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:36:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32300"}, "ts": "2023-07-14 13:36:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:36:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26725083", "type": "PubMed"}, "ts": "2023-07-14 13:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26725083", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:36:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63054-1"}, "ts": "2023-07-14 13:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63054-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:37:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13946-1"}, "ts": "2023-07-14 13:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13946-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99N43", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:37:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99N43.255.255"}, "ts": "2023-07-14 13:37:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10214944", "type": "PubMed"}, "ts": "2023-07-14 13:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10214944", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:37:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06731.182.182"}, "ts": "2023-07-14 13:37:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93008"}, "ts": "2023-07-14 13:37:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3DMA5-1"}, "ts": "2023-07-14 13:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3DMA5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98191", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98191"}, "ts": "2023-07-14 13:37:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11388.545.545"}, "ts": "2023-07-14 13:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11388", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:37:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P97430-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 13:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97430-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 13:38:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C3S2"}, "ts": "2023-07-14 13:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C3S2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR96", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:38:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.513.513"}, "ts": "2023-07-14 13:38:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.200.200"}, "ts": "2023-07-14 13:38:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.209.209"}, "ts": "2023-07-14 13:38:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.694.694"}, "ts": "2023-07-14 13:38:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.340.340"}, "ts": "2023-07-14 13:38:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.300.300"}, "ts": "2023-07-14 13:38:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.242.242"}, "ts": "2023-07-14 13:38:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.210.210"}, "ts": "2023-07-14 13:38:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.731.731"}, "ts": "2023-07-14 13:38:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21845-1"}, "ts": "2023-07-14 13:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21845-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:38:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14202"}, "ts": "2023-07-14 13:38:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14202", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:38:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11388-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:38:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15922673", "type": "PubMed"}, "ts": "2023-07-14 13:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15922673", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:38:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X4"}, "ts": "2023-07-14 13:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T6X4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:39:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJ72"}, "ts": "2023-07-14 13:39:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJ72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9252191", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:39:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9252191", "type": "PubMed"}, "ts": "2023-07-14 13:39:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0J9"}, "ts": "2023-07-14 13:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0J9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95670", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:40:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95670.101.101"}, "ts": "2023-07-14 13:40:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR96.64.64"}, "ts": "2023-07-14 13:40:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 13:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000080", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 13:40:14 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000080", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-14 13:40:15 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000080", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-14 13:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12645", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:40:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12645.83.83"}, "ts": "2023-07-14 13:40:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AMT1-1"}, "ts": "2023-07-14 13:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AMT1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93077-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:41:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93077-1"}, "ts": "2023-07-14 13:41:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15431"}, "ts": "2023-07-14 13:41:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:41:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60893"}, "ts": "2023-07-14 13:41:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60893", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3754034", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:41:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3754034", "type": "PubMed"}, "ts": "2023-07-14 13:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUG4"}, "ts": "2023-07-14 13:41:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:41:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21817.313.313"}, "ts": "2023-07-14 13:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21817", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:42:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8J025", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:42:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8J025"}, "ts": "2023-07-14 13:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20646", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:42:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20646.93.93"}, "ts": "2023-07-14 13:42:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1645445", "type": "PubMed"}, "ts": "2023-07-14 13:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1645445", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:42:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35968.961.961"}, "ts": "2023-07-14 13:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35968", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88573-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08476", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:43:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88573-1"}, "ts": "2023-07-14 13:43:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15434"}, "ts": "2023-07-14 13:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKD2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:43:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKD2.100.100"}, "ts": "2023-07-14 13:43:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-14 13:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61070-1"}, "ts": "2023-07-14 13:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBN1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:44:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBN1.37.37"}, "ts": "2023-07-14 13:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBF6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:44:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBF6"}, "ts": "2023-07-14 13:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19381258", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:44:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19381258", "type": "PubMed"}, "ts": "2023-07-14 13:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80098"}, "ts": "2023-07-14 13:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15611369", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:44:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15611369", "type": "PubMed"}, "ts": "2023-07-14 13:44:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15187158", "type": "PubMed"}, "ts": "2023-07-14 13:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15187158", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:45:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02466-1"}, "ts": "2023-07-14 13:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02466-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20080667", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:45:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20080667", "type": "PubMed"}, "ts": "2023-07-14 13:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:45:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDM6"}, "ts": "2023-07-14 13:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:45:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12091380", "type": "PubMed"}, "ts": "2023-07-14 13:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12091380", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AAE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:46:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AAE5"}, "ts": "2023-07-14 13:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97574-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:46:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97574-1"}, "ts": "2023-07-14 13:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43361", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:46:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43361.222.222"}, "ts": "2023-07-14 13:46:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28472300", "type": "PubMed"}, "ts": "2023-07-14 13:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28472300", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:46:56 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 13:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 13:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 13:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22875024", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:47:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22875024", "type": "PubMed"}, "ts": "2023-07-14 13:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22875024", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 13:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "site-search", "message": "page access"}, "ts": "2023-07-14 13:47:08 EDT-0400"}, {"api": "/site/search_init/", "req": {}, "ts": "2023-07-14 13:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "site-search", "message": "page access"}, "ts": "2023-07-14 13:47:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JSJ4.408.408"}, "ts": "2023-07-14 13:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JSJ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82450", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:47:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NX78.375.375"}, "ts": "2023-07-14 13:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX78", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18603590", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:47:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18603590", "type": "PubMed"}, "ts": "2023-07-14 13:47:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64240"}, "ts": "2023-07-14 13:47:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10956661", "type": "PubMed"}, "ts": "2023-07-14 13:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10956661", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:48:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11713248", "type": "PubMed"}, "ts": "2023-07-14 13:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11713248", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:48:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-14 13:48:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07900"}, "ts": "2023-07-14 13:48:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34320214", "type": "PubMed"}, "ts": "2023-07-14 13:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34320214", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10201399", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:48:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10201399", "type": "PubMed"}, "ts": "2023-07-14 13:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VT25"}, "ts": "2023-07-14 13:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VT25", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8626397", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:49:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8626397", "type": "PubMed"}, "ts": "2023-07-14 13:49:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11410590", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:49:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11410590", "type": "PubMed"}, "ts": "2023-07-14 13:49:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32766"}, "ts": "2023-07-14 13:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14786", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:49:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14786.638.638"}, "ts": "2023-07-14 13:49:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NVJ2.7.7"}, "ts": "2023-07-14 13:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVJ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-14 13:49:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12426393", "type": "PubMed"}, "ts": "2023-07-14 13:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12426393", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3342889", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:50:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3342889", "type": "PubMed"}, "ts": "2023-07-14 13:50:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y286"}, "ts": "2023-07-14 13:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y286", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:50:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06656BE"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21196UL"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27102CT"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39943KJ"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67030CA"}, "ts": "2023-07-14 13:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-14 13:50:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-14 13:50:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57141NR"}, "ts": "2023-07-14 13:50:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-14 13:50:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-14 13:50:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 13:50:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17963697", "type": "PubMed"}, "ts": "2023-07-14 13:50:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17963697", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:50:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B1AKI9.101.101"}, "ts": "2023-07-14 13:50:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AKI9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDQ0"}, "ts": "2023-07-14 13:50:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6M1-1"}, "ts": "2023-07-14 13:50:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6M1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7891175", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:51:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7891175", "type": "PubMed"}, "ts": "2023-07-14 13:51:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A4S6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:51:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A1A4S6.681.681"}, "ts": "2023-07-14 13:51:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JTJ3"}, "ts": "2023-07-14 13:51:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:51:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95376.153.153"}, "ts": "2023-07-14 13:51:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95376", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:51:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31242416", "type": "PubMed"}, "ts": "2023-07-14 13:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31242416", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31242416", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 13:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CXE0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:51:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CXE0"}, "ts": "2023-07-14 13:51:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P1A6.675.675"}, "ts": "2023-07-14 13:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P1A6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:51:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K245", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:52:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K245.688.688"}, "ts": "2023-07-14 13:52:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIW2.685.685"}, "ts": "2023-07-14 13:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIW2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3SHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:52:16 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-14 13:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 13:52:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3SHH9"}, "ts": "2023-07-14 13:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 13:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54868", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:52:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-14 13:52:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43699", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43699"}, "ts": "2023-07-14 13:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-14 13:52:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01730"}, "ts": "2023-07-14 13:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:53:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11719186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:53:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11719186", "type": "PubMed"}, "ts": "2023-07-14 13:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01579", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:53:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01579"}, "ts": "2023-07-14 13:53:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0C7.892.892"}, "ts": "2023-07-14 13:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32697617", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:54:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32697617", "type": "PubMed"}, "ts": "2023-07-14 13:54:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:54:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-14 13:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:55:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSJ8"}, "ts": "2023-07-14 13:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15927", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:55:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15927.4.4"}, "ts": "2023-07-14 13:55:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JUM8-1"}, "ts": "2023-07-14 13:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JUM8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:55:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00429", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:55:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00429.177.177"}, "ts": "2023-07-14 13:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KQV3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:56:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3KQV3.552.552"}, "ts": "2023-07-14 13:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:56:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VF5"}, "ts": "2023-07-14 13:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:56:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61158"}, "ts": "2023-07-14 13:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12523936", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:56:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12523936", "type": "PubMed"}, "ts": "2023-07-14 13:56:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07309-1"}, "ts": "2023-07-14 13:56:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07309-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIX1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYG6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:57:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIX1"}, "ts": "2023-07-14 13:57:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IYG6.27.27"}, "ts": "2023-07-14 13:57:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:57:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14231"}, "ts": "2023-07-14 13:57:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:57:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCU1"}, "ts": "2023-07-14 13:57:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05901"}, "ts": "2023-07-14 13:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05901", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRR6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 13:58:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRR6.396.396"}, "ts": "2023-07-14 13:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10109-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:58:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10109-1"}, "ts": "2023-07-14 13:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27129230", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:58:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27129230", "type": "PubMed"}, "ts": "2023-07-14 13:58:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZVN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:58:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZVN8"}, "ts": "2023-07-14 13:58:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15397"}, "ts": "2023-07-14 13:58:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15397", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:58:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26194464", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:59:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26194464", "type": "PubMed"}, "ts": "2023-07-14 13:59:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07759-1"}, "ts": "2023-07-14 13:59:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI20"}, "ts": "2023-07-14 13:59:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI20", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:59:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 13:59:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49419"}, "ts": "2023-07-14 13:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49419", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:59:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14626"}, "ts": "2023-07-14 13:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14626", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 13:59:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34445181", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:59:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34445181", "type": "PubMed"}, "ts": "2023-07-14 13:59:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10697413", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 13:59:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10697413", "type": "PubMed"}, "ts": "2023-07-14 13:59:29 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 14:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 14:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 14:00:01 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 14:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 14:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 14:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "FceRII", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-14 14:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 14:00:09 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "FceRII"}, "ts": "2023-07-14 14:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 14:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "FceRII", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=FceRII"}, "ts": "2023-07-14 14:00:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y6A5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 14:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6A5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:00:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6AYA6.168.168"}, "ts": "2023-07-14 14:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYA6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:00:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-14 14:00:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-14 14:00:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19645719", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:01:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19645719", "type": "PubMed"}, "ts": "2023-07-14 14:01:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06858.19.19"}, "ts": "2023-07-14 14:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WV1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:01:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86WV1.219.219"}, "ts": "2023-07-14 14:01:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:02:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2MJT0-1"}, "ts": "2023-07-14 14:02:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJX0"}, "ts": "2023-07-14 14:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MJT0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:02:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "V9GX81-1", "cluster_type": "unselected"}, "ts": "2023-07-14 14:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "V9GX81-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "V9GX81-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-14 14:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CD23", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-14 14:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 14:02:17 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "CD23"}, "ts": "2023-07-14 14:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 14:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CD23", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=CD23"}, "ts": "2023-07-14 14:02:17 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 14:02:38 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "cc6cebe45a9049a5edd28210f54daa3f", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 14:02:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc6cebe45a9049a5edd28210f54daa3f", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:02:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHI5"}, "ts": "2023-07-14 14:02:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06734-1"}, "ts": "2023-07-14 14:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06734-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:02:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 14:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16204", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:03:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16204.249.249"}, "ts": "2023-07-14 14:03:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35613"}, "ts": "2023-07-14 14:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:03:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07113"}, "ts": "2023-07-14 14:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY90-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:03:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY90-1"}, "ts": "2023-07-14 14:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:03:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:04:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:04:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6192439", "type": "PubMed"}, "ts": "2023-07-14 14:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94929", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6192439", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:04:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94929"}, "ts": "2023-07-14 14:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:04:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXR1"}, "ts": "2023-07-14 14:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26322824", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:04:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26322824", "type": "PubMed"}, "ts": "2023-07-14 14:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75072", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:04:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75072"}, "ts": "2023-07-14 14:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:04:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76355TG"}, "ts": "2023-07-14 14:04:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G76355TG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:04:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10453732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:04:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10453732", "type": "PubMed"}, "ts": "2023-07-14 14:04:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IFW6-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:04:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6IFW6-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 14:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03701", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:04:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03701.15.15"}, "ts": "2023-07-14 14:04:56 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 14:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-14 14:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP28", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:05:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DP28.102.102"}, "ts": "2023-07-14 14:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CXX0"}, "ts": "2023-07-14 14:05:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CXX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:05:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04114-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:05:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04114-1.200.200"}, "ts": "2023-07-14 14:05:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96AG3.301.301"}, "ts": "2023-07-14 14:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AG3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:05:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-14 14:05:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48431.222.222"}, "ts": "2023-07-14 14:06:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48431", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03928-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:06:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03928-1"}, "ts": "2023-07-14 14:06:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14207", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:06:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14207.1233.1233"}, "ts": "2023-07-14 14:06:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17503797", "type": "PubMed"}, "ts": "2023-07-14 14:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17503797", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:06:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0J4.315.315"}, "ts": "2023-07-14 14:06:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0J4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:06:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8541209", "type": "PubMed"}, "ts": "2023-07-14 14:07:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8541209", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:07:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XIQ5.588.588"}, "ts": "2023-07-14 14:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIQ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZZ5-4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:07:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZZ5-4"}, "ts": "2023-07-14 14:07:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KR7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:07:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KR7-1"}, "ts": "2023-07-14 14:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13177", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:07:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13177"}, "ts": "2023-07-14 14:07:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96GE5.589.589"}, "ts": "2023-07-14 14:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GE5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1Q8"}, "ts": "2023-07-14 14:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1Q8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:07:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34610483", "type": "PubMed"}, "ts": "2023-07-14 14:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34610483", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34610483", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 14:08:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGZ3"}, "ts": "2023-07-14 14:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:08:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15596.309.309"}, "ts": "2023-07-14 14:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15596", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:08:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1E1"}, "ts": "2023-07-14 14:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BF6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:08:38 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96BF6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 14:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:08:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45379"}, "ts": "2023-07-14 14:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BF6", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-14 14:08:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30197081", "type": "PubMed"}, "ts": "2023-07-14 14:08:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30197081", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:08:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:08:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33527.21.21"}, "ts": "2023-07-14 14:09:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33527", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:09:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08237"}, "ts": "2023-07-14 14:09:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96QF7.580.580"}, "ts": "2023-07-14 14:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QF7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:09:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDD5.222.222"}, "ts": "2023-07-14 14:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:09:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55287.175.175"}, "ts": "2023-07-14 14:09:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:09:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54317", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:09:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54317.430.430"}, "ts": "2023-07-14 14:09:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-14 14:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15911", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:10:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15911.72.72"}, "ts": "2023-07-14 14:10:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ERE9.257.257"}, "ts": "2023-07-14 14:10:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERE9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:10:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23301498", "type": "PubMed"}, "ts": "2023-07-14 14:10:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23301498", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:10:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 14:10:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8JZN5"}, "ts": "2023-07-14 14:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZN5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XPT3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XPT3-1"}, "ts": "2023-07-14 14:10:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGT4.313.313"}, "ts": "2023-07-14 14:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGT4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07759-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11087666", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:11:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11087666", "type": "PubMed"}, "ts": "2023-07-14 14:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8713135", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:11:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8713135", "type": "PubMed"}, "ts": "2023-07-14 14:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LXA3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:11:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3LXA3.53.53"}, "ts": "2023-07-14 14:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16473", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:11:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16473.232.232"}, "ts": "2023-07-14 14:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L2J0-1"}, "ts": "2023-07-14 14:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L2J0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66964CR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:12:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66964CR"}, "ts": "2023-07-14 14:12:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2R4-1"}, "ts": "2023-07-14 14:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2R4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8521815", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:12:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A1B0GUY1.46.46"}, "ts": "2023-07-14 14:12:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8521815", "type": "PubMed"}, "ts": "2023-07-14 14:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A1B0GUY1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14258", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:12:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14258.100.100"}, "ts": "2023-07-14 14:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55058", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:13:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55058.143.143"}, "ts": "2023-07-14 14:13:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9790770", "type": "PubMed"}, "ts": "2023-07-14 14:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9790770", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55197", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:14:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55197"}, "ts": "2023-07-14 14:14:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05556.20.20"}, "ts": "2023-07-14 14:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18923525", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:14:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18923525", "type": "PubMed"}, "ts": "2023-07-14 14:14:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2893289", "type": "PubMed"}, "ts": "2023-07-14 14:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2893289", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D46", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:15:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96D46.468.468"}, "ts": "2023-07-14 14:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8968735", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:15:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8968735", "type": "PubMed"}, "ts": "2023-07-14 14:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-14 14:15:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15758"}, "ts": "2023-07-14 14:15:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06753"}, "ts": "2023-07-14 14:16:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:16:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE23"}, "ts": "2023-07-14 14:16:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-14 14:16:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11106735", "type": "PubMed"}, "ts": "2023-07-14 14:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11106735", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:16:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18037881", "type": "PubMed"}, "ts": "2023-07-14 14:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18037881", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30153-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21964", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:17:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:17:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-14 14:17:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P21964", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 14:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22870HL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:18:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22870HL"}, "ts": "2023-07-14 14:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY22", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:18:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IY22.762.762"}, "ts": "2023-07-14 14:18:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:18:39 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 14:18:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07113", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:18:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:18:46 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 14:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:19:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-14 14:19:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 14:19:20 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 14:19:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-14 14:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-14 14:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7836469", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:19:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7836469", "type": "PubMed"}, "ts": "2023-07-14 14:19:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 14:20:14 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 14:20:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-14 14:20:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-14 14:20:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 14:20:35 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "Ras", "term_category": "any"}, "ts": "2023-07-14 14:20:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">989d85d8cdd98be5a79a991f6b1147a4", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"Ras\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 14:20:37 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 14:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "989d85d8cdd98be5a79a991f6b1147a4", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:20:38 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "989d85d8cdd98be5a79a991f6b1147a4", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 14:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:20:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61071JD"}, "ts": "2023-07-14 14:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61071JD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:20:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55095"}, "ts": "2023-07-14 14:20:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20084057", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:20:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20084057", "type": "PubMed"}, "ts": "2023-07-14 14:20:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-14 14:20:49 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 14:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 14:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16529MG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:21:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16529MG"}, "ts": "2023-07-14 14:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-14 14:21:09 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "Kras", "term_category": "any"}, "ts": "2023-07-14 14:21:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00846"}, "ts": "2023-07-14 14:21:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"Kras\",\"term_category\":\"any\"}"}, "ts": "2023-07-14 14:21:14 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 14:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:21:15 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 14:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99956-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:21:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99956-1"}, "ts": "2023-07-14 14:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27375022", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:21:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27375022", "type": "PubMed"}, "ts": "2023-07-14 14:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UYV9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:21:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UYV9-1"}, "ts": "2023-07-14 14:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:21:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19535621", "type": "PubMed"}, "ts": "2023-07-14 14:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19535621", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q498M8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q498M8"}, "ts": "2023-07-14 14:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 14:22:04 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-14 14:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 14:22:04 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:22:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:22:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HAP2.669.669"}, "ts": "2023-07-14 14:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAP2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4G6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:22:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4G6.156.156"}, "ts": "2023-07-14 14:22:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15213237", "type": "PubMed"}, "ts": "2023-07-14 14:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15213237", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:22:23 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-14 14:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:22:31 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported"]}]}, "ts": "2023-07-14 14:22:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:22:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported", "O-Glycosylation reported"]}]}, "ts": "2023-07-14 14:22:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49000", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:22:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49000.409.409"}, "ts": "2023-07-14 14:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:22:39 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported", "O-Glycosylation reported"]}, {"id": "by_data", "operator": "OR", "selected": ["Mutagenesis"]}]}, "ts": "2023-07-14 14:22:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02650"}, "ts": "2023-07-14 14:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:23:06 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported", "O-Glycosylation reported"]}]}, "ts": "2023-07-14 14:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 14:23:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "fcfde4865816be33336eab40ff82efbd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported", "O-Glycosylation reported"]}, {"id": "by_data", "operator": "OR", "selected": ["Mutagenesis"]}]}, "ts": "2023-07-14 14:23:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24534.8.8"}, "ts": "2023-07-14 14:23:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24534", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4I9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:23:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4I9-1"}, "ts": "2023-07-14 14:23:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:23:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-14 14:23:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBV2.111.111"}, "ts": "2023-07-14 14:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A742-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:24:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A742-1"}, "ts": "2023-07-14 14:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:24:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-14 14:24:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:24:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02774-1"}, "ts": "2023-07-14 14:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02774-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6R7"}, "ts": "2023-07-14 14:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:24:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 14:24:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05067-1"}, "ts": "2023-07-14 14:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05067-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CJ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:25:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68CJ9.410.410"}, "ts": "2023-07-14 14:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11116142", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:25:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11116142", "type": "PubMed"}, "ts": "2023-07-14 14:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17050-1"}, "ts": "2023-07-14 14:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H68-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:25:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H68-1"}, "ts": "2023-07-14 14:25:34 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5YLM1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:25:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5YLM1-1"}, "ts": "2023-07-14 14:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:25:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7540766", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:25:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7540766", "type": "PubMed"}, "ts": "2023-07-14 14:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:26:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-14 14:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14770-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:26:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14770-1"}, "ts": "2023-07-14 14:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:26:29 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "PubChem Compound", "input_idlist": ["147580"]}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"147580\"}"}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "PubChem Compound", "input_idlist": ["156647"]}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"156647\"}"}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:26:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:26:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:40 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:26:46 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:26:46 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "PubChem Substance", "input_idlist": ["147580"]}, "ts": "2023-07-14 14:26:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:26:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47>aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"147580\"}"}, "ts": "2023-07-14 14:26:50 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:50 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:50 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:26:50 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:26:53 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:26:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:26:54 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "PubChem Substance", "input_idlist": ["156647"]}, "ts": "2023-07-14 14:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2>248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"156647\"}"}, "ts": "2023-07-14 14:26:58 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:58 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:58 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:26:58 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36956", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:27:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36956.7.7"}, "ts": "2023-07-14 14:27:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1J9-1"}, "ts": "2023-07-14 14:27:09 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:27:16 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:27:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR23"}, "ts": "2023-07-14 14:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:27:20 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 14:27:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:27:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:27:20 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "PubChem Compound", "input_idlist": ["156647"]}, "ts": "2023-07-14 14:27:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2>248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"156647\"}"}, "ts": "2023-07-14 14:27:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:27:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:27:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:27:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:27:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-14 14:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47710-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47710-1"}, "ts": "2023-07-14 14:28:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05279MG"}, "ts": "2023-07-14 14:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:28:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:28:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-14 14:28:19 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:28:26 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29699", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:28:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29699.138.138"}, "ts": "2023-07-14 14:28:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A1A5B4.83.83"}, "ts": "2023-07-14 14:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A5B4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:28:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06576.25.25"}, "ts": "2023-07-14 14:28:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:28:42 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "GlyConnect", "input_idlist": ["156647"]}, "ts": "2023-07-14 14:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2>248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"156647\"}"}, "ts": "2023-07-14 14:28:44 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:28:45 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:28:45 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:28:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:28:45 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:28:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:28:49 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:28:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:28:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:28:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JL55-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:28:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JL55-1"}, "ts": "2023-07-14 14:28:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:29:01 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "GlyConnect", "input_idlist": ["156647"]}, "ts": "2023-07-14 14:29:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2>248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"156647\"}"}, "ts": "2023-07-14 14:29:01 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99798.544.544"}, "ts": "2023-07-14 14:29:01 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:29:02 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:02 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99798", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10786638", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:29:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10786638", "type": "PubMed"}, "ts": "2023-07-14 14:29:09 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:29:09 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HZI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:29:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HZI2"}, "ts": "2023-07-14 14:29:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07141"}, "ts": "2023-07-14 14:29:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11829491", "type": "PubMed"}, "ts": "2023-07-14 14:29:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11829491", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:29:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-14 14:29:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2EG98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78536-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:29:28 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:29:28 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:29:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78536-1"}, "ts": "2023-07-14 14:29:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2EG98"}, "ts": "2023-07-14 14:29:33 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G99342HD"]}, "ts": "2023-07-14 14:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "248937ecab62e5445238c62beb5aeee2>0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G99342HD\"}"}, "ts": "2023-07-14 14:29:37 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:29:38 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:29:38 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:29:38 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1B9-1"}, "ts": "2023-07-14 14:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1B9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "GlyConnect", "input_idlist": ["147580"]}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47>aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"147580\"}"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:29:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97686.993.993"}, "ts": "2023-07-14 14:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97686", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53999", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:30:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53999"}, "ts": "2023-07-14 14:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 14:30:14 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 14:30:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 14:30:15 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:30:22 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:30:22 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:30:26 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:30:26 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Compound", "input_idlist": ["G99342HD"]}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419>0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"G99342HD\"}"}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:30:27 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "PubChem Substance", "input_idlist": ["147580"]}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47>aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"147580\"}"}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62979-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:30:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62979-1"}, "ts": "2023-07-14 14:30:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2X3.187.187"}, "ts": "2023-07-14 14:30:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2X3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:30:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9370289", "type": "PubMed"}, "ts": "2023-07-14 14:30:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9370289", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:30:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00495-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:30:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00495-1"}, "ts": "2023-07-14 14:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 14:31:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4E5.522.522"}, "ts": "2023-07-14 14:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4E5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:31:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15066269", "type": "PubMed"}, "ts": "2023-07-14 14:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15066269", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:31:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0E3.508.508"}, "ts": "2023-07-14 14:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15758", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:31:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPZ6"}, "ts": "2023-07-14 14:31:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U1Z7-1"}, "ts": "2023-07-14 14:31:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1Z7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06753", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCL4"}, "ts": "2023-07-14 14:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60793", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:32:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60793"}, "ts": "2023-07-14 14:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:33:13 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 14:33:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:33:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 14:33:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00327.78.78"}, "ts": "2023-07-14 14:33:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00327", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:33:41 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:33:51 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:33:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YA9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:33:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80YA9.683.683"}, "ts": "2023-07-14 14:33:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10909"}, "ts": "2023-07-14 14:34:01 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Compound", "input_idlist": ["G40194MN"]}, "ts": "2023-07-14 14:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:34:05 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-14 14:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 14:34:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10909"}, "ts": "2023-07-14 14:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419>5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"G40194MN\"}"}, "ts": "2023-07-14 14:34:09 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:09 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:34:10 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:34:10 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19648920", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:34:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19648920", "type": "PubMed"}, "ts": "2023-07-14 14:34:19 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:34:23 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5Z0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:34:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C5Z0-1"}, "ts": "2023-07-14 14:34:28 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "ChEBI", "output_namespace": "PubChem Substance", "input_idlist": ["150075"]}, "ts": "2023-07-14 14:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "aeaf81f1bb56f9197fb8cec20d9d3e47>c54fbaa8b6a89801c12821cf99824a59", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"ChEBI\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"150075\"}"}, "ts": "2023-07-14 14:34:42 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:43 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:34:43 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:34:43 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:34:47 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:34:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:34:47 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G40194MN"]}, "ts": "2023-07-14 14:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524>5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G40194MN\"}"}, "ts": "2023-07-14 14:34:51 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:52 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:34:52 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:34:52 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:34:52 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED ", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-14 14:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED \",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-14 14:35:00 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 26}, "ts": "2023-07-14 14:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">26", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=26"}, "ts": "2023-07-14 14:35:02 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 26}, "ts": "2023-07-14 14:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 14:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-14 14:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:35:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57772", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:35:16 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P57772", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 14:35:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15205"}, "ts": "2023-07-14 14:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:35:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34406978", "type": "PubMed"}, "ts": "2023-07-14 14:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34406978", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:35:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27305979", "type": "PubMed"}, "ts": "2023-07-14 14:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27305979", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:35:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGL6"}, "ts": "2023-07-14 14:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9H4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:36:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9H4"}, "ts": "2023-07-14 14:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32PY9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:36:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32PY9"}, "ts": "2023-07-14 14:36:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56730", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:36:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56730.270.270"}, "ts": "2023-07-14 14:36:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXI3.111.111"}, "ts": "2023-07-14 14:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXI3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:36:38 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:36:41 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:36:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08670"}, "ts": "2023-07-14 14:36:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:36:55 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "ChEBI", "input_idlist": ["G13856VP"]}, "ts": "2023-07-14 14:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c54fbaa8b6a89801c12821cf99824a59>049e5a9fcacb9d8c7020cd8c2158faf4", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"ChEBI\",\"input_idlist\":\"G13856VP\"}"}, "ts": "2023-07-14 14:36:55 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:36:55 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:36:56 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:36:56 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00846", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:37:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99640-1"}, "ts": "2023-07-14 14:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99640-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0FGR9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:37:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0FGR9.17.17"}, "ts": "2023-07-14 14:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49238"}, "ts": "2023-07-14 14:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13864", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13864"}, "ts": "2023-07-14 14:37:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9830063", "type": "PubMed"}, "ts": "2023-07-14 14:38:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9830063", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:38:18 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:38:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:38:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50851.1090.1090"}, "ts": "2023-07-14 14:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50851", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:38:28 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G02311IE"]}, "ts": "2023-07-14 14:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "049e5a9fcacb9d8c7020cd8c2158faf4>27eb7bb70db333c8d79d44d08d755190", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G02311IE\"}"}, "ts": "2023-07-14 14:38:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:38:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:38:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:38:29 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCB7"}, "ts": "2023-07-14 14:38:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:38:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55082"}, "ts": "2023-07-14 14:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:38:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW11"}, "ts": "2023-07-14 14:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:38:49 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:38:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G17155VX"]}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5c8d5ed3a23b697cfc0ae53641700524>b7f46a22e4ded5a63a1306fe59dfe71f", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G17155VX\"}"}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:38:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHD4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:38:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHD4"}, "ts": "2023-07-14 14:38:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8-1"}, "ts": "2023-07-14 14:39:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:39:12 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 26}, "ts": "2023-07-14 14:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 14:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-14 14:39:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24338"}, "ts": "2023-07-14 14:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18336837", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:39:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18336837", "type": "PubMed"}, "ts": "2023-07-14 14:39:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29293", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:39:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29293"}, "ts": "2023-07-14 14:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13255", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:39:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13255"}, "ts": "2023-07-14 14:39:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q86YD5", "cluster_type": "unselected"}, "ts": "2023-07-14 14:40:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YD5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 14:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YD5", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 14:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:41:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJF9"}, "ts": "2023-07-14 14:41:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:41:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96R45"}, "ts": "2023-07-14 14:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17050-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-14 14:41:47 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-14 14:41:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-14 14:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920B0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:41:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q920B0.372.372"}, "ts": "2023-07-14 14:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WU79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WU79"}, "ts": "2023-07-14 14:42:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-14 14:42:23 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:42:33 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:42:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "31124603"}, "ts": "2023-07-14 14:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 14:42:59 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G99342HD"]}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27eb7bb70db333c8d79d44d08d755190>0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G99342HD\"}"}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:00 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:43:14 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:43:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0S2-1"}, "ts": "2023-07-14 14:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0S2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G99342HD"]}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419>0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G99342HD\"}"}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:43:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:21 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:43:26 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:43:26 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G99342HD"]}, "ts": "2023-07-14 14:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419>0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G99342HD\"}"}, "ts": "2023-07-14 14:43:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:43:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:30 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:43:34 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:43:34 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Compound", "input_idlist": ["G99342HD"]}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419>0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"G99342HD\"}"}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:43:47 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:43:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92530"}, "ts": "2023-07-14 14:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92530", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:43:51 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Compound", "input_idlist": ["G99342HD"]}, "ts": "2023-07-14 14:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419>0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"G99342HD\"}"}, "ts": "2023-07-14 14:43:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:43:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05279MG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:43:54 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:43:57 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F2YMG0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:43:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F2YMG0"}, "ts": "2023-07-14 14:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G87377KZ"]}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b7f46a22e4ded5a63a1306fe59dfe71f>3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G87377KZ\"}"}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:44:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17085597", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:44:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17085597", "type": "PubMed"}, "ts": "2023-07-14 14:44:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15336.52.52"}, "ts": "2023-07-14 14:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15336", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:44:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6N5"}, "ts": "2023-07-14 14:44:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H7X7.137.137"}, "ts": "2023-07-14 14:44:42 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:44:43 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7X7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:44:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULS5"}, "ts": "2023-07-14 14:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:44:47 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G87377KZ"]}, "ts": "2023-07-14 14:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:44:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60>3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G87377KZ\"}"}, "ts": "2023-07-14 14:44:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:44:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:44:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:44:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:44:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:44:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09014"}, "ts": "2023-07-14 14:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09014", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:45:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7M0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:45:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7M0"}, "ts": "2023-07-14 14:45:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84467IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:45:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZJ6.64.64"}, "ts": "2023-07-14 14:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:45:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2819876"}, "ts": "2023-07-14 14:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:45:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-14 14:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49910", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:45:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49910"}, "ts": "2023-07-14 14:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI38-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:45:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JI38-1"}, "ts": "2023-07-14 14:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:46:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00613.9.9"}, "ts": "2023-07-14 14:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9V2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9V2"}, "ts": "2023-07-14 14:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21926", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21926"}, "ts": "2023-07-14 14:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00206"}, "ts": "2023-07-14 14:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00206", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:46:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2VEC9-1"}, "ts": "2023-07-14 14:46:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2VEC9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:46:22 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 26}, "ts": "2023-07-14 14:46:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 14:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14192", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14192"}, "ts": "2023-07-14 14:46:23 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-14 14:46:26 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:46:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQL9"}, "ts": "2023-07-14 14:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQL9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:46:30 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G95298UR"]}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0e7e6183d56e5585e0e004a46be1c419>0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G95298UR\"}"}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:46:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-14 14:46:41 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:47:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:47:01 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G95298UR"]}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb>0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G95298UR\"}"}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17785844", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:47:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17785844", "type": "PubMed"}, "ts": "2023-07-14 14:47:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922D8-1"}, "ts": "2023-07-14 14:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922D8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:47:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54652-1"}, "ts": "2023-07-14 14:47:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-14 14:48:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6Q3-1"}, "ts": "2023-07-14 14:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6Q3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:48:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15659642", "type": "PubMed"}, "ts": "2023-07-14 14:48:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15659642", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:48:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:48:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JC9"}, "ts": "2023-07-14 14:48:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04049", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:48:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04049"}, "ts": "2023-07-14 14:48:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JMB0.25.25"}, "ts": "2023-07-14 14:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JMB0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:48:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75914"}, "ts": "2023-07-14 14:49:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75914", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUB3"}, "ts": "2023-07-14 14:49:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10909", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:49:55 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:50:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59861-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:50:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-14 14:50:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-14 14:50:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-14 14:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-14 14:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-14 14:50:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59861-1"}, "ts": "2023-07-14 14:50:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-14 14:50:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22625SJ"}, "ts": "2023-07-14 14:50:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-14 14:50:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-14 14:50:26 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G87377KZ"]}, "ts": "2023-07-14 14:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62305", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62305"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26271XI"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34617SM"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0b2f24aff6cbca531c922af642bb86bb>3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G87377KZ\"}"}, "ts": "2023-07-14 14:50:27 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39689FZ"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10486CT"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04672QB"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12313PD"}, "ts": "2023-07-14 14:50:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-14 14:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12341GU"}, "ts": "2023-07-14 14:50:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24835MQ"}, "ts": "2023-07-14 14:50:29 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:50:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:50:36 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:50:36 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G87377KZ"]}, "ts": "2023-07-14 14:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60>3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G87377KZ\"}"}, "ts": "2023-07-14 14:50:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:50:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:50:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZQ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:50:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZQ6.29.29"}, "ts": "2023-07-14 14:50:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11886874", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:50:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11886874", "type": "PubMed"}, "ts": "2023-07-14 14:50:46 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 14:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 14:50:52 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 14:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 14:50:59 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G16956YO"]}, "ts": "2023-07-14 14:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60>4098827c34bc89d2f683b972c543892e", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G16956YO\"}"}, "ts": "2023-07-14 14:50:59 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:59 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 14:50:59 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 14:50:59 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 14:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22865833", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:51:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22865833", "type": "PubMed"}, "ts": "2023-07-14 14:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:51:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJ66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:51:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BJ66"}, "ts": "2023-07-14 14:51:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23714778", "type": "PubMed"}, "ts": "2023-07-14 14:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23714778", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:51:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LS0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LS0"}, "ts": "2023-07-14 14:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00987-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00987-1"}, "ts": "2023-07-14 14:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99523", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99523"}, "ts": "2023-07-14 14:52:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23984SE"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77582RK"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16175ZV"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47448YK"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 14:52:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-14 14:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-14 14:52:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 14:52:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32971"}, "ts": "2023-07-14 14:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:52:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32971", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:52:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35606", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:52:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35606.287.287"}, "ts": "2023-07-14 14:52:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86Z20.43.43"}, "ts": "2023-07-14 14:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Z20", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08670", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:52:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17658481", "type": "PubMed"}, "ts": "2023-07-14 14:53:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17658481", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:53:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20700442", "type": "PubMed"}, "ts": "2023-07-14 14:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20700442", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VXI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:53:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VXI9"}, "ts": "2023-07-14 14:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RJT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:53:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5RJT2"}, "ts": "2023-07-14 14:53:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HB55.255.255"}, "ts": "2023-07-14 14:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB55", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20336", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:53:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20336"}, "ts": "2023-07-14 14:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:53:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHU5"}, "ts": "2023-07-14 14:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23919"}, "ts": "2023-07-14 14:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30728", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:54:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30728.173.173"}, "ts": "2023-07-14 14:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MK8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:54:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99MK8.670.670"}, "ts": "2023-07-14 14:54:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225"}, "ts": "2023-07-14 14:55:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61878", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61878"}, "ts": "2023-07-14 14:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70434", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:55:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70434.426.426"}, "ts": "2023-07-14 14:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43403", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:55:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43403.69.69"}, "ts": "2023-07-14 14:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:55:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01350"}, "ts": "2023-07-14 14:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:55:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21512573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:55:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21512573", "type": "PubMed"}, "ts": "2023-07-14 14:55:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F25", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:55:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96F25"}, "ts": "2023-07-14 14:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09012", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:55:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09012"}, "ts": "2023-07-14 14:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGV6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGV6"}, "ts": "2023-07-14 14:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12161445", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:56:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12161445", "type": "PubMed"}, "ts": "2023-07-14 14:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08103", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:56:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08103.207.207"}, "ts": "2023-07-14 14:56:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY5"}, "ts": "2023-07-14 14:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:56:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33240"}, "ts": "2023-07-14 14:57:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2VEC9-1"}, "ts": "2023-07-14 14:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2VEC9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:57:19 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 26}, "ts": "2023-07-14 14:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 14:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-14 14:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JMI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:57:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JMI0"}, "ts": "2023-07-14 14:57:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "32442579"}, "ts": "2023-07-14 14:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35332", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:57:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35332"}, "ts": "2023-07-14 14:57:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30012220", "type": "PubMed"}, "ts": "2023-07-14 14:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30012220", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:57:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00736"}, "ts": "2023-07-14 14:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00736", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:58:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8CG34", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:58:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8CG34"}, "ts": "2023-07-14 14:58:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 14:58:19 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-14 14:58:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 14:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88456-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-14 14:58:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88456-1"}, "ts": "2023-07-14 14:58:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C811"}, "ts": "2023-07-14 14:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C811", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:58:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1423622", "type": "PubMed"}, "ts": "2023-07-14 14:58:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1423622", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 14:58:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80T03-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:58:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80T03-1"}, "ts": "2023-07-14 14:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 14:58:55 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 26}, "ts": "2023-07-14 14:58:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-14 14:58:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14B70"}, "ts": "2023-07-14 14:59:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14B70", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 14:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMY6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:59:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMY6.239.239"}, "ts": "2023-07-14 14:59:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:59:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13439.1776.1776"}, "ts": "2023-07-14 14:59:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-14 14:59:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:59:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23497.362.362"}, "ts": "2023-07-14 14:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 14:59:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09466"}, "ts": "2023-07-14 14:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09466", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 14:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 15:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 15:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 15:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 15:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 15:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 15:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2137557", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:00:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2137557", "type": "PubMed"}, "ts": "2023-07-14 15:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYB3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:00:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYB3-1"}, "ts": "2023-07-14 15:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:00:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AP7"}, "ts": "2023-07-14 15:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35555", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 15:01:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P35555", "cluster_type": "unselected"}, "ts": "2023-07-14 15:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35555", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 15:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y237"}, "ts": "2023-07-14 15:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:01:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92753"}, "ts": "2023-07-14 15:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92753", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TMC8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:01:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TMC8-1"}, "ts": "2023-07-14 15:01:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSI4-1"}, "ts": "2023-07-14 15:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSI4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31151"}, "ts": "2023-07-14 15:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40121", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 15:02:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P40121", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 15:02:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60884.394.394"}, "ts": "2023-07-14 15:02:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60884", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:02:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11226-1"}, "ts": "2023-07-14 15:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16763566", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:02:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16763566", "type": "PubMed"}, "ts": "2023-07-14 15:02:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-14 15:02:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4VC44.696.696"}, "ts": "2023-07-14 15:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC44", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:02:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86Z20.43.43"}, "ts": "2023-07-14 15:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSA4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:03:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BSA4.246.246"}, "ts": "2023-07-14 15:03:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYQ5"}, "ts": "2023-07-14 15:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54652-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19703557", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:03:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19703557", "type": "PubMed"}, "ts": "2023-07-14 15:03:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92879", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92879"}, "ts": "2023-07-14 15:03:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51801"}, "ts": "2023-07-14 15:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51801", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:04:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU1"}, "ts": "2023-07-14 15:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11099500", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:05:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11099500", "type": "PubMed"}, "ts": "2023-07-14 15:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T8P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:05:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T8P6"}, "ts": "2023-07-14 15:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84084", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84084"}, "ts": "2023-07-14 15:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TD94", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:05:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TD94.564.564"}, "ts": "2023-07-14 15:05:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:06:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQW8"}, "ts": "2023-07-14 15:06:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61028", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:06:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61028.180.180"}, "ts": "2023-07-14 15:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L8L6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:06:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L8L6.256.256"}, "ts": "2023-07-14 15:06:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16442"}, "ts": "2023-07-14 15:06:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43462.336.336"}, "ts": "2023-07-14 15:06:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:07:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRR3"}, "ts": "2023-07-14 15:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:07:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SD1"}, "ts": "2023-07-14 15:07:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XN4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:07:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XN4-1"}, "ts": "2023-07-14 15:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CFS6-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:07:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CFS6-1"}, "ts": "2023-07-14 15:07:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20637728", "type": "PubMed"}, "ts": "2023-07-14 15:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20637728", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:08:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17693.134.134"}, "ts": "2023-07-14 15:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17693", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:08:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-14 15:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:09:13 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-14 15:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 15:09:14 EDT-0400"}, {"api": "/job/detail/", "req": {"jobid": 26}, "ts": "2023-07-14 15:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast search modification initiated"}, "ts": "2023-07-14 15:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1977069", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:09:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1977069", "type": "PubMed"}, "ts": "2023-07-14 15:09:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED \",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.1,\"num_alignments\":250}}"}, "ts": "2023-07-14 15:09:24 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED ", "targetdb": "canonicalsequences_all", "evalue": 0.1, "num_alignments": 250}}}, "ts": "2023-07-14 15:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDY8"}, "ts": "2023-07-14 15:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:09:29 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 27}, "ts": "2023-07-14 15:09:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26>27", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=27"}, "ts": "2023-07-14 15:09:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 15:09:29 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 27}, "ts": "2023-07-14 15:09:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1, A0A0G2JXL5-1, D3ZCV6-1, Q62635-1, M0R3P0-1, P98088-1, O55225-1, D3ZAU0-1, F7EZQ4-1, O75509-1, O88799-1, E9PVG8-1"}, "ts": "2023-07-14 15:09:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-14 15:09:32 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-14 15:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 15:09:43 EDT-0400"}, {"api": "/job/detail/", "req": {"jobid": 27}, "ts": "2023-07-14 15:09:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast search modification initiated"}, "ts": "2023-07-14 15:09:43 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED ", "targetdb": "canonicalsequences_all", "evalue": 0.01, "num_alignments": 250}}}, "ts": "2023-07-14 15:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED \",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.01,\"num_alignments\":250}}"}, "ts": "2023-07-14 15:09:52 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 28}, "ts": "2023-07-14 15:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27>28", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=28"}, "ts": "2023-07-14 15:09:54 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 28}, "ts": "2023-07-14 15:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 15:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1, A0A0G2JXL5-1, D3ZCV6-1, Q62635-1, M0R3P0-1, P98088-1, O55225-1, D3ZAU0-1, F7EZQ4-1"}, "ts": "2023-07-14 15:09:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:09:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H334"}, "ts": "2023-07-14 15:09:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H334", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:09:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27542219", "type": "PubMed"}, "ts": "2023-07-14 15:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27542219", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14541", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:10:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14541"}, "ts": "2023-07-14 15:10:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:10:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15239"}, "ts": "2023-07-14 15:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15239", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:10:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQG1"}, "ts": "2023-07-14 15:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:10:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QR8"}, "ts": "2023-07-14 15:10:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGV4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:10:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGV4-1"}, "ts": "2023-07-14 15:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNE3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:10:46 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-14 15:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 15:10:56 EDT-0400"}, {"api": "/job/detail/", "req": {"jobid": 27}, "ts": "2023-07-14 15:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast search modification initiated"}, "ts": "2023-07-14 15:10:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNE3"}, "ts": "2023-07-14 15:11:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88632"}, "ts": "2023-07-14 15:11:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED \",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.01,\"num_alignments\":250}}"}, "ts": "2023-07-14 15:11:10 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED ", "targetdb": "canonicalsequences_all", "evalue": 0.01, "num_alignments": 250}}}, "ts": "2023-07-14 15:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53675", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:11:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P53675.61.61"}, "ts": "2023-07-14 15:11:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:11:12 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 29}, "ts": "2023-07-14 15:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27>29", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=29"}, "ts": "2023-07-14 15:11:13 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 29}, "ts": "2023-07-14 15:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 15:11:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23528-1"}, "ts": "2023-07-14 15:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1, A0A0G2JXL5-1, D3ZCV6-1, Q62635-1, M0R3P0-1, P98088-1, O55225-1, D3ZAU0-1, F7EZQ4-1"}, "ts": "2023-07-14 15:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13619", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:11:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13619"}, "ts": "2023-07-14 15:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5MCW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:11:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5MCW4"}, "ts": "2023-07-14 15:11:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P218", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:11:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P218.9.9"}, "ts": "2023-07-14 15:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:11:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D98"}, "ts": "2023-07-14 15:11:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275-1"}, "ts": "2023-07-14 15:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:12:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04784US"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06330RB"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07799LX"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15038BD"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29279QO"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33567AB"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41044JW"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51413EV"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75568BH"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77582RK"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-14 15:12:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16175ZV"}, "ts": "2023-07-14 15:12:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-14 15:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:12:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92888"}, "ts": "2023-07-14 15:12:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32709749", "type": "PubMed"}, "ts": "2023-07-14 15:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32709749", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32709749", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 15:12:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:12:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5A9"}, "ts": "2023-07-14 15:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:13:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07954.363.363"}, "ts": "2023-07-14 15:13:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01024"}, "ts": "2023-07-14 15:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5ZPR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5ZPR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:13:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31841187", "type": "PubMed"}, "ts": "2023-07-14 15:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31841187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31841187", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 15:13:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-14 15:13:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5ZPR3"}, "ts": "2023-07-14 15:13:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60235", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:13:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60235.265.265"}, "ts": "2023-07-14 15:13:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQX5-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 15:13:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NQX5-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 15:13:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NH60.264.264"}, "ts": "2023-07-14 15:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH60", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5ZPR3"}, "ts": "2023-07-14 15:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:14:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-14 15:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78364", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:14:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78364.898.898"}, "ts": "2023-07-14 15:14:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99104-1"}, "ts": "2023-07-14 15:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZRI0-1"}, "ts": "2023-07-14 15:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRI0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:15:14 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 29}, "ts": "2023-07-14 15:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-14 15:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1, A0A0G2JXL5-1, D3ZCV6-1, Q62635-1, M0R3P0-1, P98088-1, O55225-1, D3ZAU0-1, F7EZQ4-1"}, "ts": "2023-07-14 15:15:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWZ3"}, "ts": "2023-07-14 15:15:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:15:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:15:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-14 15:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AX9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:15:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96AX9.743.743"}, "ts": "2023-07-14 15:15:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32845802", "type": "PubMed"}, "ts": "2023-07-14 15:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32845802", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TB9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:16:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86TB9.4.4"}, "ts": "2023-07-14 15:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGV5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:17:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGV5.86.86"}, "ts": "2023-07-14 15:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:17:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGA0"}, "ts": "2023-07-14 15:17:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R919-1"}, "ts": "2023-07-14 15:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R919-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54784"}, "ts": "2023-07-14 15:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54784", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q687X5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:17:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q687X5.91.91"}, "ts": "2023-07-14 15:17:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80VP8"}, "ts": "2023-07-14 15:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80VP8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:17:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99523", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:17:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99523"}, "ts": "2023-07-14 15:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WEN9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:18:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2WEN9.329.329"}, "ts": "2023-07-14 15:18:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11226-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15031", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:18:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:18:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B96"}, "ts": "2023-07-14 15:18:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:19:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC3"}, "ts": "2023-07-14 15:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRI0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:19:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZRI0.699.699"}, "ts": "2023-07-14 15:19:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11741838", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:19:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11741838", "type": "PubMed"}, "ts": "2023-07-14 15:19:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97678.142.142"}, "ts": "2023-07-14 15:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97678", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:19:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78504.670.670"}, "ts": "2023-07-14 15:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78504", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:19:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48146.218.218"}, "ts": "2023-07-14 15:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48146", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01230", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:19:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01230"}, "ts": "2023-07-14 15:19:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-14 15:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01026", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 15:19:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01026", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 15:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30571485", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:20:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30571485", "type": "PubMed"}, "ts": "2023-07-14 15:20:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKI8-1"}, "ts": "2023-07-14 15:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKI8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:20:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43252"}, "ts": "2023-07-14 15:20:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NZQ6"}, "ts": "2023-07-14 15:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JB8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:20:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99JB8.276.276"}, "ts": "2023-07-14 15:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:21:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-14 15:21:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67733JP"}, "ts": "2023-07-14 15:21:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12056827", "type": "PubMed"}, "ts": "2023-07-14 15:21:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12056827", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:21:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJ57-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:21:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJ57-1"}, "ts": "2023-07-14 15:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29371604", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:21:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29371604", "type": "PubMed"}, "ts": "2023-07-14 15:21:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32144205", "type": "PubMed"}, "ts": "2023-07-14 15:21:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UD5.338.338"}, "ts": "2023-07-14 15:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32144205", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02161"}, "ts": "2023-07-14 15:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:21:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-14 15:21:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92062TF"}, "ts": "2023-07-14 15:21:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-14 15:21:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-14 15:21:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 15:21:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKU7"}, "ts": "2023-07-14 15:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKU7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:21:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20108"}, "ts": "2023-07-14 15:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A6L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:22:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A6L1"}, "ts": "2023-07-14 15:22:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30485414", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:22:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30485414", "type": "PubMed"}, "ts": "2023-07-14 15:22:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZE55-1"}, "ts": "2023-07-14 15:22:42 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZE55-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00222.354.354"}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31742892", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:23:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31742892", "type": "PubMed"}, "ts": "2023-07-14 15:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:23:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11021"}, "ts": "2023-07-14 15:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4098827c34bc89d2f683b972c543892e", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:23:11 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G40428GO"]}, "ts": "2023-07-14 15:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4098827c34bc89d2f683b972c543892e>3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G40428GO\"}"}, "ts": "2023-07-14 15:23:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:23:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:23:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:23:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:23:12 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:23:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:23:24 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:23:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:23:24 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G40428GO"]}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f>3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G40428GO\"}"}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:23:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXA5"}, "ts": "2023-07-14 15:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35070", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:24:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35070.151.151"}, "ts": "2023-07-14 15:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78383", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:24:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:24:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78383"}, "ts": "2023-07-14 15:24:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TB73", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:24:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TB73.508.508"}, "ts": "2023-07-14 15:24:40 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:25:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07120", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:25:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07120.20.20"}, "ts": "2023-07-14 15:25:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCU5"}, "ts": "2023-07-14 15:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:25:54 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G36787EI"]}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f>f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G36787EI\"}"}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:26:00 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:26:15 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:26:20 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G36787EI"]}, "ts": "2023-07-14 15:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890>f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G36787EI\"}"}, "ts": "2023-07-14 15:26:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:26:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:26:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:26:21 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53933HU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:26:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53933HU"}, "ts": "2023-07-14 15:26:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12393264", "type": "PubMed"}, "ts": "2023-07-14 15:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12393264", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:26:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17513616", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:26:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17513616", "type": "PubMed"}, "ts": "2023-07-14 15:26:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-14 15:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23528-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:27:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838"}, "ts": "2023-07-14 15:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34758338", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:27:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34758338", "type": "PubMed"}, "ts": "2023-07-14 15:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34758338", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 15:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15397", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15397"}, "ts": "2023-07-14 15:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33305507", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:28:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33305507", "type": "PubMed"}, "ts": "2023-07-14 15:28:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33305507", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 15:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28592839", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:28:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28592839", "type": "PubMed"}, "ts": "2023-07-14 15:28:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PD5.181.181"}, "ts": "2023-07-14 15:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:28:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-14 15:28:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-14 15:28:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30519-1"}, "ts": "2023-07-14 15:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30519-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:29:06 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-14 15:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 15:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-14 15:29:09 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:29:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBX8.572.572"}, "ts": "2023-07-14 15:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBX8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:29:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01024", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:29:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-14 15:29:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76417NN"}, "ts": "2023-07-14 15:29:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-14 15:29:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14796IU"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75607BQ"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46902YN"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-14 15:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55383ZG"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59536GA"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-14 15:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689EW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:30:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689EW"}, "ts": "2023-07-14 15:30:13 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:30:57 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:30:57 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G75308SV"]}, "ts": "2023-07-14 15:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890>56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G75308SV\"}"}, "ts": "2023-07-14 15:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:31:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUM9"}, "ts": "2023-07-14 15:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:31:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:31:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:20 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:31:36 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:31:36 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:31:36 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:31:39 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:31:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G75308SV"]}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924>56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G75308SV\"}"}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:31:40 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G31991IV"]}, "ts": "2023-07-14 15:31:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:31:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f77ace301b3493ff30eb3f45ef8ad60>536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G31991IV\"}"}, "ts": "2023-07-14 15:31:46 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:31:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:31:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKY1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:31:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKY1.26.26"}, "ts": "2023-07-14 15:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95721", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:32:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95721.78.78"}, "ts": "2023-07-14 15:32:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01019"}, "ts": "2023-07-14 15:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47501YS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:32:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47501YS"}, "ts": "2023-07-14 15:32:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-14 15:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53434XO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2J0"}, "ts": "2023-07-14 15:32:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13636.35.35"}, "ts": "2023-07-14 15:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13636", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2J0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:32:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-14 15:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:32:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3732516", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:32:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3732516", "type": "PubMed"}, "ts": "2023-07-14 15:32:48 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:32:50 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G75308SV"]}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9>56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G75308SV\"}"}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:32:53 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:33:15 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:33:29 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G26080SE"]}, "ts": "2023-07-14 15:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924>229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G26080SE\"}"}, "ts": "2023-07-14 15:33:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:33:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:33:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:33:30 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:33:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-14 15:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MU7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:33:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MU7"}, "ts": "2023-07-14 15:33:41 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:33:44 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:33:44 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G26080SE"]}, "ts": "2023-07-14 15:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:33:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7>229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G26080SE\"}"}, "ts": "2023-07-14 15:33:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:33:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:33:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:33:49 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:33:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:33:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10535940", "type": "PubMed"}, "ts": "2023-07-14 15:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10535940", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:33:55 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:34:07 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:34:07 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G36787EI"]}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56688a29cb1acf82a689664b5fdf1924>f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G36787EI\"}"}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07686"}, "ts": "2023-07-14 15:34:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25386IJ"}, "ts": "2023-07-14 15:34:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 15:34:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08011QI"}, "ts": "2023-07-14 15:34:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-14 15:34:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51623PN"}, "ts": "2023-07-14 15:34:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84155GY"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02402FF"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10601XM"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43947VZ"}, "ts": "2023-07-14 15:34:23 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:34:27 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:34:27 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G36787EI"]}, "ts": "2023-07-14 15:34:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:34:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890>f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G36787EI\"}"}, "ts": "2023-07-14 15:34:31 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:34:32 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:34:32 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:34:32 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR97", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:34:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR97.663.663"}, "ts": "2023-07-14 15:34:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13497"}, "ts": "2023-07-14 15:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00722-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:35:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00722-1"}, "ts": "2023-07-14 15:35:10 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:35:23 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:35:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-14 15:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4U2R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:35:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4U2R8"}, "ts": "2023-07-14 15:35:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:35:32 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G40428GO"]}, "ts": "2023-07-14 15:35:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H330.877.877"}, "ts": "2023-07-14 15:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H330", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f140dc22aaf3556bb48747501ac96890>3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G40428GO\"}"}, "ts": "2023-07-14 15:35:33 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:35:33 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:35:33 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:35:33 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "3452cc7a184b18420e6e83692860fc3f", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49815-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:35:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49815-1"}, "ts": "2023-07-14 15:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:35:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M730"}, "ts": "2023-07-14 15:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:35:44 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:35:46 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:35:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14847.174.174"}, "ts": "2023-07-14 15:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18938DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14847", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:35:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28105280", "type": "PubMed"}, "ts": "2023-07-14 15:35:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CWL2"}, "ts": "2023-07-14 15:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28105280", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:36:02 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G31991IV"]}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CWL2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "229a153af184897c5044d83af3b7e3e7>536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G31991IV\"}"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-14 15:36:04 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:36:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:36:16 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:36:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:36:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EQX9.131.131"}, "ts": "2023-07-14 15:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQX9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:36:20 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Substance", "input_idlist": ["G31991IV"]}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9>536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Substance\",\"input_idlist\":\"G31991IV\"}"}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-14 15:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00587"}, "ts": "2023-07-14 15:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00587"}, "ts": "2023-07-14 15:36:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9H4"}, "ts": "2023-07-14 15:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9H4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00587"}, "ts": "2023-07-14 15:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:36:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7901236", "type": "PubMed"}, "ts": "2023-07-14 15:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7901236", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13123"}, "ts": "2023-07-14 15:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13123", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:37:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95081", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:37:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95081.176.176"}, "ts": "2023-07-14 15:38:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8897595", "type": "PubMed"}, "ts": "2023-07-14 15:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8897595", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:38:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63142"}, "ts": "2023-07-14 15:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21849505", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:38:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21849505", "type": "PubMed"}, "ts": "2023-07-14 15:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:38:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86T26.71.71"}, "ts": "2023-07-14 15:38:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880"}, "ts": "2023-07-14 15:39:15 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-14 15:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-14 15:39:33 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-14 15:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "536e41343312dc96bb50490dc306b9e9", "user": "Undecided", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-14 15:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MZM0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:39:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6MZM0.685.685"}, "ts": "2023-07-14 15:39:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80VD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:39:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80VD1"}, "ts": "2023-07-14 15:39:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556"}, "ts": "2023-07-14 15:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14896-1"}, "ts": "2023-07-14 15:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14896-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70398", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:40:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70398.374.374"}, "ts": "2023-07-14 15:40:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84852GW"}, "ts": "2023-07-14 15:40:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14497.255.255"}, "ts": "2023-07-14 15:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:40:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50552.157.157"}, "ts": "2023-07-14 15:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50552", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C7R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:41:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C7R7"}, "ts": "2023-07-14 15:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YZ3"}, "ts": "2023-07-14 15:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WW12", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:41:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WW12.148.148"}, "ts": "2023-07-14 15:41:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96D42.263.263"}, "ts": "2023-07-14 15:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D42", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25626177", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:41:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25626177", "type": "PubMed"}, "ts": "2023-07-14 15:41:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0A0-1"}, "ts": "2023-07-14 15:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0A0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40428GO"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40428GO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40428GO"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81452FP"}, "ts": "2023-07-14 15:41:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55216FT"}, "ts": "2023-07-14 15:41:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04794OZ"}, "ts": "2023-07-14 15:41:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14973187", "type": "PubMed"}, "ts": "2023-07-14 15:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IV0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:41:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IV0-1"}, "ts": "2023-07-14 15:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14973187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U3K5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:41:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5U3K5.594.594"}, "ts": "2023-07-14 15:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:42:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERT9"}, "ts": "2023-07-14 15:42:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:42:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF09"}, "ts": "2023-07-14 15:42:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11185750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:42:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11185750", "type": "PubMed"}, "ts": "2023-07-14 15:42:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-14 15:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5ND56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:42:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5ND56"}, "ts": "2023-07-14 15:42:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXU5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:42:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXU5"}, "ts": "2023-07-14 15:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37840-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:43:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-14 15:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18627", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18627"}, "ts": "2023-07-14 15:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:43:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2HXU8"}, "ts": "2023-07-14 15:43:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2HXU8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19804", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:44:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19804"}, "ts": "2023-07-14 15:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21846770", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:44:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21846770", "type": "PubMed"}, "ts": "2023-07-14 15:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01042-1"}, "ts": "2023-07-14 15:44:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06110VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:44:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX01"}, "ts": "2023-07-14 15:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:44:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BU76.217.217"}, "ts": "2023-07-14 15:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BU76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:44:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13158.194.194"}, "ts": "2023-07-14 15:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13158", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:45:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBG0"}, "ts": "2023-07-14 15:45:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34081950", "type": "PubMed"}, "ts": "2023-07-14 15:46:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34081950", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:46:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18270262", "type": "PubMed"}, "ts": "2023-07-14 15:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18270262", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:47:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12032"}, "ts": "2023-07-14 15:47:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12032", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:47:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21730"}, "ts": "2023-07-14 15:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:47:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60259"}, "ts": "2023-07-14 15:47:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60259", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:48:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01230"}, "ts": "2023-07-14 15:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01230", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:49:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48735"}, "ts": "2023-07-14 15:49:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR16.243.243"}, "ts": "2023-07-14 15:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR16", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:49:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02766"}, "ts": "2023-07-14 15:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MF6"}, "ts": "2023-07-14 15:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MF6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:50:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYW0.123.123"}, "ts": "2023-07-14 15:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAM5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4FZU8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:50:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4FZU8.452.452"}, "ts": "2023-07-14 15:50:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAM5"}, "ts": "2023-07-14 15:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37091", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:50:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37091"}, "ts": "2023-07-14 15:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:50:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJF7-1"}, "ts": "2023-07-14 15:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJF7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLF7"}, "ts": "2023-07-14 15:50:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-14 15:50:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09211.48.48"}, "ts": "2023-07-14 15:50:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09211", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:50:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6X2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-14 15:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51654"}, "ts": "2023-07-14 15:51:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78504", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:51:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78504.272.272"}, "ts": "2023-07-14 15:51:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26262", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:51:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26262.396.396"}, "ts": "2023-07-14 15:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14416", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:51:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14416.127.127"}, "ts": "2023-07-14 15:51:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01023-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01023-1"}, "ts": "2023-07-14 15:52:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UM73.711.711"}, "ts": "2023-07-14 15:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM73", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZA3"}, "ts": "2023-07-14 15:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:53:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NEZ2.174.174"}, "ts": "2023-07-14 15:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:53:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD2"}, "ts": "2023-07-14 15:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:53:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NV58.449.449"}, "ts": "2023-07-14 15:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV58", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:53:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJT0.412.412"}, "ts": "2023-07-14 15:53:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQT8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:53:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJT0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:53:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQT8.1635.1635"}, "ts": "2023-07-14 15:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBD1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 15:53:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9HBD1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 15:53:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O76024.809.809"}, "ts": "2023-07-14 15:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76024", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:53:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9DB26-1", "cluster_type": "unselected"}, "ts": "2023-07-14 15:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DB26-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 15:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DB26-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 15:54:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLN9-1"}, "ts": "2023-07-14 15:54:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43819.90.90"}, "ts": "2023-07-14 15:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2U0"}, "ts": "2023-07-14 15:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2U0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08516-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:54:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08516-1"}, "ts": "2023-07-14 15:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG04", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:54:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG04"}, "ts": "2023-07-14 15:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4G0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:55:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H4G0.269.269"}, "ts": "2023-07-14 15:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:55:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00966"}, "ts": "2023-07-14 15:55:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12821.475.475"}, "ts": "2023-07-14 15:55:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12821", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:56:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22253933", "type": "PubMed"}, "ts": "2023-07-14 15:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22253933", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:56:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L590", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:56:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L590.93.93"}, "ts": "2023-07-14 15:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27471034", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:56:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27471034", "type": "PubMed"}, "ts": "2023-07-14 15:56:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BRT1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BRT1-1"}, "ts": "2023-07-14 15:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25963", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:57:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25963"}, "ts": "2023-07-14 15:57:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DJR0-1"}, "ts": "2023-07-14 15:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DJR0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35968-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:57:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35968-1.1214.1214"}, "ts": "2023-07-14 15:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T749", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:57:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T749.38.38"}, "ts": "2023-07-14 15:57:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1396582", "type": "PubMed"}, "ts": "2023-07-14 15:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1396582", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0K0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:58:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0K0"}, "ts": "2023-07-14 15:58:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23354437", "type": "PubMed"}, "ts": "2023-07-14 15:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23354437", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:58:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3C1"}, "ts": "2023-07-14 15:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 15:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2473156", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:58:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2473156", "type": "PubMed"}, "ts": "2023-07-14 15:58:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:59:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGM9"}, "ts": "2023-07-14 15:59:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:59:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27374339", "type": "PubMed"}, "ts": "2023-07-14 15:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27374339", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 15:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:59:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX38"}, "ts": "2023-07-14 15:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15530"}, "ts": "2023-07-14 15:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15530", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 15:59:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJS5-1"}, "ts": "2023-07-14 15:59:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:59:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6R4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 15:59:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6R4"}, "ts": "2023-07-14 15:59:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26038", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 15:59:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26038.157.157"}, "ts": "2023-07-14 15:59:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UH06.1180.1180"}, "ts": "2023-07-14 16:00:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UH06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 16:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 16:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 16:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 16:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 16:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 16:00:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19041750", "type": "PubMed"}, "ts": "2023-07-14 16:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19041750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01042-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:00:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-14 16:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28473"}, "ts": "2023-07-14 16:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28473", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:00:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-14 16:01:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71142DF"}, "ts": "2023-07-14 16:01:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19258394", "type": "PubMed"}, "ts": "2023-07-14 16:01:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C6I2-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 16:01:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8C6I2-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 16:01:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-14 16:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-14 16:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-14 16:01:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32374SR"}, "ts": "2023-07-14 16:01:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19258394", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:01:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LS93"}, "ts": "2023-07-14 16:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LS93", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:01:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26718"}, "ts": "2023-07-14 16:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26718", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:01:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7A3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:01:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z7A3.330.330"}, "ts": "2023-07-14 16:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WU79"}, "ts": "2023-07-14 16:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WU79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:01:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17927"}, "ts": "2023-07-14 16:01:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54285KU"}, "ts": "2023-07-14 16:02:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-14 16:02:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 16:02:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-14 16:02:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q75VX8.183.183"}, "ts": "2023-07-14 16:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75VX8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:02:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86795LJ"}, "ts": "2023-07-14 16:02:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23511"}, "ts": "2023-07-14 16:02:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18593892", "type": "PubMed"}, "ts": "2023-07-14 16:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18593892", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15260", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:02:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15260.50.50"}, "ts": "2023-07-14 16:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 16:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 16:02:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P31785", "cluster_type": "unselected"}, "ts": "2023-07-14 16:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 16:03:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5X9.195.195"}, "ts": "2023-07-14 16:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5X9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49459", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:03:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49459"}, "ts": "2023-07-14 16:03:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54254"}, "ts": "2023-07-14 16:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54254", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:03:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IW52.309.309"}, "ts": "2023-07-14 16:03:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW52", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:03:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:03:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06418.380.380"}, "ts": "2023-07-14 16:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06418", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:03:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02311IE"}, "ts": "2023-07-14 16:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGI0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:04:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGI0.316.316"}, "ts": "2023-07-14 16:04:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22223"}, "ts": "2023-07-14 16:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:04:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734-1"}, "ts": "2023-07-14 16:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:04:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14990571", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:05:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14990571", "type": "PubMed"}, "ts": "2023-07-14 16:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMB0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:05:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMB0.78.78"}, "ts": "2023-07-14 16:05:30 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 16:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 16:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 16:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-14 16:05:41 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 16:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:05:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35573.564.564"}, "ts": "2023-07-14 16:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35573", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:06:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZM21-1"}, "ts": "2023-07-14 16:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZM21-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2Z0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:06:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2Z0"}, "ts": "2023-07-14 16:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05724UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25089", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:06:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25089"}, "ts": "2023-07-14 16:06:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVM6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:07:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NVM6.292.292"}, "ts": "2023-07-14 16:07:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:07:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42226"}, "ts": "2023-07-14 16:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:07:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052"}, "ts": "2023-07-14 16:07:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y277"}, "ts": "2023-07-14 16:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11601988", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:07:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11601988", "type": "PubMed"}, "ts": "2023-07-14 16:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13464", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:07:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13464"}, "ts": "2023-07-14 16:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13443", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7B0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:07:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13443"}, "ts": "2023-07-14 16:07:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7B0"}, "ts": "2023-07-14 16:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:07:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZI9"}, "ts": "2023-07-14 16:07:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35475-1"}, "ts": "2023-07-14 16:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35475-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BU02", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:08:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BU02"}, "ts": "2023-07-14 16:08:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZV73.554.554"}, "ts": "2023-07-14 16:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZV73", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:08:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14543-1"}, "ts": "2023-07-14 16:08:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14543-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:08:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:08:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17661.419.419"}, "ts": "2023-07-14 16:08:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P53041.153.153"}, "ts": "2023-07-14 16:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53041", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:08:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07266.142.142"}, "ts": "2023-07-14 16:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07266", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:08:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35579"}, "ts": "2023-07-14 16:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:09:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZA3"}, "ts": "2023-07-14 16:09:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5I2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:09:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5I2.401.401"}, "ts": "2023-07-14 16:09:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:10:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00839"}, "ts": "2023-07-14 16:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00839", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:10:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15917656", "type": "PubMed"}, "ts": "2023-07-14 16:10:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15917656", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15983046", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05141", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:10:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15983046", "type": "PubMed"}, "ts": "2023-07-14 16:10:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05141.44.44"}, "ts": "2023-07-14 16:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI38"}, "ts": "2023-07-14 16:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14660639", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:11:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14660639", "type": "PubMed"}, "ts": "2023-07-14 16:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:11:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GV91"}, "ts": "2023-07-14 16:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GV91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:11:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36222.38.38"}, "ts": "2023-07-14 16:11:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20120020", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:11:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20120020", "type": "PubMed"}, "ts": "2023-07-14 16:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:11:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KN4-1"}, "ts": "2023-07-14 16:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KN4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:11:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43521.123.123"}, "ts": "2023-07-14 16:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43521", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQC3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:11:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQC3-1"}, "ts": "2023-07-14 16:11:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4G055.21.21"}, "ts": "2023-07-14 16:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G055", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:11:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31695"}, "ts": "2023-07-14 16:11:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15322104", "type": "PubMed"}, "ts": "2023-07-14 16:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15322104", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99698", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:12:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99698.1289.1289"}, "ts": "2023-07-14 16:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3417683", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:12:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3417683", "type": "PubMed"}, "ts": "2023-07-14 16:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969V4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:12:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969V4-1"}, "ts": "2023-07-14 16:12:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88665.380.380"}, "ts": "2023-07-14 16:12:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88665", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:12:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11071668", "type": "PubMed"}, "ts": "2023-07-14 16:12:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11071668", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:12:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12560222", "type": "PubMed"}, "ts": "2023-07-14 16:12:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12560222", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:12:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34992299", "type": "PubMed"}, "ts": "2023-07-14 16:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34992299", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:12:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13515-1"}, "ts": "2023-07-14 16:13:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13515-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:13:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46013"}, "ts": "2023-07-14 16:13:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:13:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34100899", "type": "PubMed"}, "ts": "2023-07-14 16:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34100899", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:13:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-14 16:13:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BUH6.152.152"}, "ts": "2023-07-14 16:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUH6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16557"}, "ts": "2023-07-14 16:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16557", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:13:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q969S2.257.257"}, "ts": "2023-07-14 16:13:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969S2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:13:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47501YS"}, "ts": "2023-07-14 16:14:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47501YS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:14:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21926"}, "ts": "2023-07-14 16:14:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21926", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:14:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75789AR"}, "ts": "2023-07-14 16:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75789AR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:15:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75789AR"}, "ts": "2023-07-14 16:15:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30664IS"}, "ts": "2023-07-14 16:15:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25889HA"}, "ts": "2023-07-14 16:15:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64818UY"}, "ts": "2023-07-14 16:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27025MB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:15:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-14 16:15:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-14 16:15:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-14 16:15:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-14 16:15:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFU0"}, "ts": "2023-07-14 16:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFU0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:16:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMS9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:17:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMS9"}, "ts": "2023-07-14 16:17:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94988.304.304"}, "ts": "2023-07-14 16:17:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94988", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:17:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04355-1"}, "ts": "2023-07-14 16:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04355-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:18:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q70SY1.445.445"}, "ts": "2023-07-14 16:18:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70SY1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:18:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:18:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A08"}, "ts": "2023-07-14 16:18:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2QC08"}, "ts": "2023-07-14 16:18:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2QC08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:18:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-14 16:19:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-14 16:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CRB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:19:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CRB6"}, "ts": "2023-07-14 16:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3879970", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:19:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3879970", "type": "PubMed"}, "ts": "2023-07-14 16:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02311IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:19:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-14 16:20:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y3M2.20.20"}, "ts": "2023-07-14 16:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3M2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00076PK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:20:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00076PK"}, "ts": "2023-07-14 16:20:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79809MM"}, "ts": "2023-07-14 16:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79809MM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35225", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:20:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35225.63.63"}, "ts": "2023-07-14 16:20:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZJ1.768.768"}, "ts": "2023-07-14 16:20:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZJ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99569-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:21:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99569-1"}, "ts": "2023-07-14 16:21:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95789.1172.1172"}, "ts": "2023-07-14 16:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95789", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTB9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:21:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VTB9"}, "ts": "2023-07-14 16:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IFW6-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 16:22:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6IFW6-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 16:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU9"}, "ts": "2023-07-14 16:22:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3YU81"}, "ts": "2023-07-14 16:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YU81", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7753797", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:22:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7753797", "type": "PubMed"}, "ts": "2023-07-14 16:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35917", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:23:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11500363", "type": "PubMed"}, "ts": "2023-07-14 16:23:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35917.830.830"}, "ts": "2023-07-14 16:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11500363", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:23:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IF42"}, "ts": "2023-07-14 16:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IF42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11076040", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:23:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11076040", "type": "PubMed"}, "ts": "2023-07-14 16:23:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BM72-1"}, "ts": "2023-07-14 16:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BM72-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:23:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12800.291.291"}, "ts": "2023-07-14 16:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12800", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0M9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:24:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0M9-1"}, "ts": "2023-07-14 16:24:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P68400.344.344"}, "ts": "2023-07-14 16:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68400", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61978", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:24:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61978.414.414"}, "ts": "2023-07-14 16:24:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:25:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZS5-1"}, "ts": "2023-07-14 16:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEA7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:25:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEA7"}, "ts": "2023-07-14 16:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11094164", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:25:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11094164", "type": "PubMed"}, "ts": "2023-07-14 16:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92769", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:25:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92769.422.422"}, "ts": "2023-07-14 16:25:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12792.82.82"}, "ts": "2023-07-14 16:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12792", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15684392", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:25:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15684392", "type": "PubMed"}, "ts": "2023-07-14 16:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "InChI=1S/C23H39NO20/c25-2-7(30)12(32)18-11(24-10(31)5-28)6(29)1-23(43-18,22(38)39)44-19-13(33)8(3-26)41-21(16(19)36)42-17-9(4-27)40-20(37)15(35)14(17)34/h6-9,11-21,25-30,32-37H,1-5H2,(H,24,31)(H,38,39)/t6-,7 ,8 ,9 ,11 ,12 ,13-,14 ,15 ,16 ,17 ,18 ,19-,20 ,21-,23-/m0/s1", "user": "Undecided", "type": "user", "page": "glycan", "message": "Performing Global Search"}, "ts": "2023-07-14 16:25:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15304-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "NVMUTWNBCCAIGX-OIYRJNEJSA-N", "user": "Undecided", "type": "user", "page": "glycan", "message": "Performing Global Search"}, "ts": "2023-07-14 16:26:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15304-1"}, "ts": "2023-07-14 16:26:01 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "NVMUTWNBCCAIGX-OIYRJNEJSA-N"}, "ts": "2023-07-14 16:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 16:26:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-14 16:26:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "NVMUTWNBCCAIGX-OIYRJNEJSA-N", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=NVMUTWNBCCAIGX-OIYRJNEJSA-N"}, "ts": "2023-07-14 16:26:10 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "074910914d4845d3cfa817d73637dd30", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-14 16:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "074910914d4845d3cfa817d73637dd30", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 16:26:16 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-14 16:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "074910914d4845d3cfa817d73637dd30", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 16:26:29 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "074910914d4845d3cfa817d73637dd30", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_data", "operator": "OR", "selected": ["Binding"]}]}, "ts": "2023-07-14 16:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "074910914d4845d3cfa817d73637dd30", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-14 16:26:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "074910914d4845d3cfa817d73637dd30", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_data", "operator": "OR", "selected": ["Glycation", "Binding"]}]}, "ts": "2023-07-14 16:26:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R100"}, "ts": "2023-07-14 16:26:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:26:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8697101", "type": "PubMed"}, "ts": "2023-07-14 16:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8697101", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:26:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05CL8.260.260"}, "ts": "2023-07-14 16:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05CL8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUM0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:27:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WUM0.214.214"}, "ts": "2023-07-14 16:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:27:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAU9"}, "ts": "2023-07-14 16:27:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28641113", "type": "PubMed"}, "ts": "2023-07-14 16:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28641113", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22768VO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00535", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:28:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00535"}, "ts": "2023-07-14 16:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39905", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:28:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39905.33.33"}, "ts": "2023-07-14 16:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97689-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:28:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R171-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:28:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R171-1"}, "ts": "2023-07-14 16:28:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97689-1"}, "ts": "2023-07-14 16:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SP6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:29:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86SP6.408.408"}, "ts": "2023-07-14 16:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25963", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:29:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25963"}, "ts": "2023-07-14 16:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20774", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:29:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20774"}, "ts": "2023-07-14 16:29:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13500"}, "ts": "2023-07-14 16:29:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75783.357.357"}, "ts": "2023-07-14 16:29:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75783", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:29:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15260.179.179"}, "ts": "2023-07-14 16:29:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15260", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3922975", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:29:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3922975", "type": "PubMed"}, "ts": "2023-07-14 16:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64394MX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:29:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18757743", "type": "PubMed"}, "ts": "2023-07-14 16:30:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18757743", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:30:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16199542", "type": "PubMed"}, "ts": "2023-07-14 16:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16199542", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:30:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07196.407.407"}, "ts": "2023-07-14 16:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07196", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:30:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15104-1"}, "ts": "2023-07-14 16:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A5D8V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:31:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A5D8V7"}, "ts": "2023-07-14 16:31:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40241-1"}, "ts": "2023-07-14 16:31:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40241-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:31:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NHP8.515.515"}, "ts": "2023-07-14 16:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHP8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:31:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-14 16:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:32:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUN9"}, "ts": "2023-07-14 16:32:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH50-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:32:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH50-1"}, "ts": "2023-07-14 16:32:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61025", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:32:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61025"}, "ts": "2023-07-14 16:32:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-14 16:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:32:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95819.656.656"}, "ts": "2023-07-14 16:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49747", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:32:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49747.411.411"}, "ts": "2023-07-14 16:32:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43516.344.344"}, "ts": "2023-07-14 16:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43516", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:33:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10847681", "type": "PubMed"}, "ts": "2023-07-14 16:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10847681", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:33:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P99029", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:33:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P99029.178.178"}, "ts": "2023-07-14 16:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33486765", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:33:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33486765", "type": "PubMed"}, "ts": "2023-07-14 16:33:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33486765", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 16:33:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96EP5.78.78"}, "ts": "2023-07-14 16:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:33:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV53-1"}, "ts": "2023-07-14 16:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV53-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:34:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13443"}, "ts": "2023-07-14 16:34:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SUR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:34:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5SUR0.215.215"}, "ts": "2023-07-14 16:34:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19419", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:34:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13443", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:34:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19419.383.383"}, "ts": "2023-07-14 16:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95857", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:34:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95857.93.93"}, "ts": "2023-07-14 16:34:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P290", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:34:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P290"}, "ts": "2023-07-14 16:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16429395", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:34:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16429395", "type": "PubMed"}, "ts": "2023-07-14 16:34:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07195"}, "ts": "2023-07-14 16:34:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32418"}, "ts": "2023-07-14 16:35:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PK6.220.220"}, "ts": "2023-07-14 16:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NDL8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:35:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NDL8.309.309"}, "ts": "2023-07-14 16:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14687", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:36:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14687.907.907"}, "ts": "2023-07-14 16:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:36:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-14 16:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00115"}, "ts": "2023-07-14 16:36:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:36:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6QIY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:36:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6QIY3"}, "ts": "2023-07-14 16:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11163772", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:36:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11163772", "type": "PubMed"}, "ts": "2023-07-14 16:36:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50120-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:36:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50120-1"}, "ts": "2023-07-14 16:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:37:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2KHM9.287.287"}, "ts": "2023-07-14 16:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15090", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:37:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15090.20.20"}, "ts": "2023-07-14 16:37:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8034651", "type": "PubMed"}, "ts": "2023-07-14 16:37:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8034651", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:37:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95372"}, "ts": "2023-07-14 16:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:37:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04771"}, "ts": "2023-07-14 16:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12707385", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:38:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12707385", "type": "PubMed"}, "ts": "2023-07-14 16:38:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6VN19"}, "ts": "2023-07-14 16:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6VN19", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99ME6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:40:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99ME6"}, "ts": "2023-07-14 16:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1C3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:40:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N1C3.333.333"}, "ts": "2023-07-14 16:40:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33151.58.58"}, "ts": "2023-07-14 16:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33151", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:40:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6NUN7.149.149"}, "ts": "2023-07-14 16:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUN7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:40:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKY4.22.22"}, "ts": "2023-07-14 16:40:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKY4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:41:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-14 16:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:41:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM45-1"}, "ts": "2023-07-14 16:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM45-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31629", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:41:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31629.1286.1286"}, "ts": "2023-07-14 16:41:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-14 16:41:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NHG4.2.2"}, "ts": "2023-07-14 16:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NHG4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13362-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:42:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g29068fm"}, "ts": "2023-07-14 16:42:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-14 16:42:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75427"}, "ts": "2023-07-14 16:42:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13362-1"}, "ts": "2023-07-14 16:42:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2LCV6.145.145"}, "ts": "2023-07-14 16:42:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2LCV6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:42:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31955-1"}, "ts": "2023-07-14 16:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31955-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40307-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:43:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40307-1"}, "ts": "2023-07-14 16:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49908", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SQI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:43:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49908.176.176"}, "ts": "2023-07-14 16:43:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SQI0"}, "ts": "2023-07-14 16:43:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-14 16:43:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AQ25"}, "ts": "2023-07-14 16:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AQ25", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:43:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60568"}, "ts": "2023-07-14 16:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08253-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:44:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08253-1"}, "ts": "2023-07-14 16:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:44:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11940.454.454"}, "ts": "2023-07-14 16:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:44:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0F1.122.122"}, "ts": "2023-07-14 16:44:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D1E6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:44:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D1E6.98.98"}, "ts": "2023-07-14 16:44:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29353"}, "ts": "2023-07-14 16:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94915", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:45:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94915.627.627"}, "ts": "2023-07-14 16:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13500", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2L0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2L0"}, "ts": "2023-07-14 16:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19339517", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:46:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19339517", "type": "PubMed"}, "ts": "2023-07-14 16:46:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13586.521.521"}, "ts": "2023-07-14 16:46:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64237-1"}, "ts": "2023-07-14 16:46:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13586", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64237-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:46:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21127"}, "ts": "2023-07-14 16:46:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26446845", "type": "PubMed"}, "ts": "2023-07-14 16:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26446845", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23219-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:46:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23219-1"}, "ts": "2023-07-14 16:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:47:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WQY2"}, "ts": "2023-07-14 16:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WQY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A5X5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:47:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A5X5"}, "ts": "2023-07-14 16:47:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04771"}, "ts": "2023-07-14 16:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:47:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42867-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:48:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42867-1"}, "ts": "2023-07-14 16:48:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D563"}, "ts": "2023-07-14 16:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:48:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60932.206.206"}, "ts": "2023-07-14 16:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60932", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:48:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:48:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19320"}, "ts": "2023-07-14 16:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19320", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:48:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K664"}, "ts": "2023-07-14 16:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K664", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K664", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 16:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PEX3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PEX3"}, "ts": "2023-07-14 16:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27486062", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:48:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27486062", "type": "PubMed"}, "ts": "2023-07-14 16:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:48:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62807.118.118"}, "ts": "2023-07-14 16:49:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62807", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:49:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16882988", "type": "PubMed"}, "ts": "2023-07-14 16:49:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16882988", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:49:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY33-1"}, "ts": "2023-07-14 16:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TP1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:50:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY33-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:50:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TP1"}, "ts": "2023-07-14 16:50:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9811450", "type": "PubMed"}, "ts": "2023-07-14 16:50:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9811450", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3H5"}, "ts": "2023-07-14 16:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3H5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:51:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54132-1"}, "ts": "2023-07-14 16:51:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:51:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15644441", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:52:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15644441", "type": "PubMed"}, "ts": "2023-07-14 16:52:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BSL4"}, "ts": "2023-07-14 16:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BSL4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 16:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00395TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 16:52:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04629-1.701.701"}, "ts": "2023-07-14 16:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04629-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:52:29 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000069", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-14 16:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000069", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 16:52:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50052"}, "ts": "2023-07-14 16:52:30 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000069", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-14 16:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00115", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX15", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:52:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UX15.117.117"}, "ts": "2023-07-14 16:52:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31520422", "type": "PubMed"}, "ts": "2023-07-14 16:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31520422", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:53:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14508"}, "ts": "2023-07-14 16:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:53:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16849.581.581"}, "ts": "2023-07-14 16:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16849", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:54:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEQ0.438.438"}, "ts": "2023-07-14 16:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16569669", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:54:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16569669", "type": "PubMed"}, "ts": "2023-07-14 16:54:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-14 16:54:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97797-1"}, "ts": "2023-07-14 16:54:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48552"}, "ts": "2023-07-14 16:55:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:55:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05469.853.853"}, "ts": "2023-07-14 16:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05469", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:56:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60765"}, "ts": "2023-07-14 16:56:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3N1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:57:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3N1.228.228"}, "ts": "2023-07-14 16:57:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYD8"}, "ts": "2023-07-14 16:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:57:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13638-1"}, "ts": "2023-07-14 16:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5Y3"}, "ts": "2023-07-14 16:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HF8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:58:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HF8-1"}, "ts": "2023-07-14 16:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MJT0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:58:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2MJT0-1"}, "ts": "2023-07-14 16:58:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFU0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:58:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFU0"}, "ts": "2023-07-14 16:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCB5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 16:58:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PCB5.32.32"}, "ts": "2023-07-14 16:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:59:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11399750", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 16:59:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11399750", "type": "PubMed"}, "ts": "2023-07-14 16:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 16:59:48 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 17:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 17:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 17:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 17:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 17:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 17:00:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZM1.1915.1915"}, "ts": "2023-07-14 17:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:00:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND56"}, "ts": "2023-07-14 17:00:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17234884", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:00:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17234884", "type": "PubMed"}, "ts": "2023-07-14 17:00:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKD2.161.161"}, "ts": "2023-07-14 17:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKD2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:00:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15924"}, "ts": "2023-07-14 17:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2QC33-1"}, "ts": "2023-07-14 17:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2QC33-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:00:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5M9N0.710.710"}, "ts": "2023-07-14 17:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M9N0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:00:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-14 17:00:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21127"}, "ts": "2023-07-14 17:00:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12660"}, "ts": "2023-07-14 17:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29353", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:00:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M758", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:01:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7M758.235.235"}, "ts": "2023-07-14 17:01:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JK66"}, "ts": "2023-07-14 17:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADJ5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADJ5"}, "ts": "2023-07-14 17:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21447318", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:02:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21447318", "type": "PubMed"}, "ts": "2023-07-14 17:02:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12867411", "type": "PubMed"}, "ts": "2023-07-14 17:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12867411", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:02:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VWI1.406.406"}, "ts": "2023-07-14 17:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWI1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYQ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:03:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WYQ9.785.785"}, "ts": "2023-07-14 17:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13485", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13485"}, "ts": "2023-07-14 17:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56730", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:03:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56730.622.622"}, "ts": "2023-07-14 17:03:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62832-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:03:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62832-1"}, "ts": "2023-07-14 17:03:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P67936", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 17:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67936", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 17:04:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23644659", "type": "PubMed"}, "ts": "2023-07-14 17:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23644659", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62101-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:05:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62101-1"}, "ts": "2023-07-14 17:05:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-14 17:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVI8"}, "ts": "2023-07-14 17:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000012", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 17:06:05 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000012", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-14 17:06:06 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000012", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-14 17:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-14 17:06:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9751059", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:07:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9751059", "type": "PubMed"}, "ts": "2023-07-14 17:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3C6"}, "ts": "2023-07-14 17:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3C6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23746446", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:07:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23746446", "type": "PubMed"}, "ts": "2023-07-14 17:07:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51679"}, "ts": "2023-07-14 17:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95396", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95396"}, "ts": "2023-07-14 17:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6JVL5-1"}, "ts": "2023-07-14 17:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6JVL5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:09:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D2Z1.53.53"}, "ts": "2023-07-14 17:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2Z1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:09:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADI3"}, "ts": "2023-07-14 17:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADI3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:10:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19835.569.569"}, "ts": "2023-07-14 17:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19835", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14638", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14638"}, "ts": "2023-07-14 17:10:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04141.108.108"}, "ts": "2023-07-14 17:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04141", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:10:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI60-1"}, "ts": "2023-07-14 17:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI60-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25031892", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:10:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25031892", "type": "PubMed"}, "ts": "2023-07-14 17:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38432"}, "ts": "2023-07-14 17:10:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI7"}, "ts": "2023-07-14 17:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97797-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHX8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:11:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UHX8-1"}, "ts": "2023-07-14 17:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38159", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:11:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38159.88.88"}, "ts": "2023-07-14 17:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55012", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:11:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43156.837.837"}, "ts": "2023-07-14 17:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43156", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:11:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55012"}, "ts": "2023-07-14 17:11:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49300"}, "ts": "2023-07-14 17:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49300", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:11:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22033-1"}, "ts": "2023-07-14 17:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:11:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29718959", "type": "PubMed"}, "ts": "2023-07-14 17:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29718959", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99342HD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:11:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99342HD"}, "ts": "2023-07-14 17:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11237865", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:12:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11237865", "type": "PubMed"}, "ts": "2023-07-14 17:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6D5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 17:12:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8N6D5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 17:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29812"}, "ts": "2023-07-14 17:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11201"}, "ts": "2023-07-14 17:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11201", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:13:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55196-4"}, "ts": "2023-07-14 17:13:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14786", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:13:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14786.531.531"}, "ts": "2023-07-14 17:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13638-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:13:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14112.359.359"}, "ts": "2023-07-14 17:13:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30081852", "type": "PubMed"}, "ts": "2023-07-14 17:13:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30081852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:13:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43116"}, "ts": "2023-07-14 17:14:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28670437", "type": "PubMed"}, "ts": "2023-07-14 17:14:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28670437", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:14:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQK1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:15:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQK1"}, "ts": "2023-07-14 17:15:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34155039", "type": "PubMed"}, "ts": "2023-07-14 17:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34155039", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:15:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75112"}, "ts": "2023-07-14 17:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:15:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21957496", "type": "PubMed"}, "ts": "2023-07-14 17:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21957496", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:15:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4C1.171.171"}, "ts": "2023-07-14 17:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02533"}, "ts": "2023-07-14 17:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:15:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29508"}, "ts": "2023-07-14 17:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:16:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19618VN"}, "ts": "2023-07-14 17:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19618VN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17006639", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:16:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17006639", "type": "PubMed"}, "ts": "2023-07-14 17:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15924", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14843DJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:16:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:16:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:16:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V339"}, "ts": "2023-07-14 17:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V339", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:16:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56817-1"}, "ts": "2023-07-14 17:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31477743", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:17:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31477743", "type": "PubMed"}, "ts": "2023-07-14 17:17:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50454"}, "ts": "2023-07-14 17:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JUK2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:18:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JUK2.40.40"}, "ts": "2023-07-14 17:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43657", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 17:18:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O43657", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 17:18:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-14 17:18:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KQU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:18:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KQU3"}, "ts": "2023-07-14 17:18:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922C1"}, "ts": "2023-07-14 17:18:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:18:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8QZV6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:20:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8QZV6-1"}, "ts": "2023-07-14 17:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA29", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:20:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA29"}, "ts": "2023-07-14 17:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23693", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:20:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23693.45.45"}, "ts": "2023-07-14 17:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG37", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:21:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CG37"}, "ts": "2023-07-14 17:21:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:21:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R0S2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:21:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R0S2.923.923"}, "ts": "2023-07-14 17:22:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14782"}, "ts": "2023-07-14 17:22:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14782", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:22:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MYP8-1"}, "ts": "2023-07-14 17:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MYP8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:22:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19235.456.456"}, "ts": "2023-07-14 17:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19235", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21097718", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:23:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21097718", "type": "PubMed"}, "ts": "2023-07-14 17:23:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A5D6W6"}, "ts": "2023-07-14 17:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A5D6W6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:23:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04900"}, "ts": "2023-07-14 17:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:23:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHP6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:23:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PHP6.381.381"}, "ts": "2023-07-14 17:23:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-14 17:24:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:24:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15391"}, "ts": "2023-07-14 17:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:24:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZVN8"}, "ts": "2023-07-14 17:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZVN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2Q9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:24:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P2Q9"}, "ts": "2023-07-14 17:24:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29314-1"}, "ts": "2023-07-14 17:25:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NX45", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:25:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NX45"}, "ts": "2023-07-14 17:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29314-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q505D1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:25:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q505D1"}, "ts": "2023-07-14 17:25:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9466920", "type": "PubMed"}, "ts": "2023-07-14 17:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9466920", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:25:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHI5"}, "ts": "2023-07-14 17:25:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14654.921.921"}, "ts": "2023-07-14 17:26:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14654", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:26:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33830999", "type": "PubMed"}, "ts": "2023-07-14 17:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33830999", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05516", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:27:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05516.417.417"}, "ts": "2023-07-14 17:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12346", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12346"}, "ts": "2023-07-14 17:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-14 17:27:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06280"}, "ts": "2023-07-14 17:28:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08243"}, "ts": "2023-07-14 17:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK45", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:28:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JK45.89.89"}, "ts": "2023-07-14 17:28:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08243"}, "ts": "2023-07-14 17:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55196-4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8697101", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:29:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8697101", "type": "PubMed"}, "ts": "2023-07-14 17:29:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHG3-1"}, "ts": "2023-07-14 17:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHG3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AS55", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:30:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AS55"}, "ts": "2023-07-14 17:30:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61361"}, "ts": "2023-07-14 17:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:30:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LZM0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:30:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LZM0"}, "ts": "2023-07-14 17:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33352118", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:30:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33352118", "type": "PubMed"}, "ts": "2023-07-14 17:30:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11532"}, "ts": "2023-07-14 17:30:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9405394", "type": "PubMed"}, "ts": "2023-07-14 17:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9405394", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:30:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14136"}, "ts": "2023-07-14 17:30:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19720741", "type": "PubMed"}, "ts": "2023-07-14 17:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19720741", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78324", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:31:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78324.75.75"}, "ts": "2023-07-14 17:31:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11003655", "type": "PubMed"}, "ts": "2023-07-14 17:31:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11003655", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:31:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31729379", "type": "PubMed"}, "ts": "2023-07-14 17:31:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31729379", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:31:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92750.524.524"}, "ts": "2023-07-14 17:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92750", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPT6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:31:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPT6.462.462"}, "ts": "2023-07-14 17:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Z20", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:31:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86Z20.274.274"}, "ts": "2023-07-14 17:31:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:32:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55289.461.461"}, "ts": "2023-07-14 17:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55289", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:32:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75037"}, "ts": "2023-07-14 17:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78411", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:33:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78411.328.328"}, "ts": "2023-07-14 17:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:33:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULX6.292.292"}, "ts": "2023-07-14 17:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:33:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96EY7.645.645"}, "ts": "2023-07-14 17:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EY7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:33:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24963132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:33:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24963132", "type": "PubMed"}, "ts": "2023-07-14 17:33:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04264"}, "ts": "2023-07-14 17:33:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70371-1"}, "ts": "2023-07-14 17:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70371-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:33:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:34:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:35:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56402"}, "ts": "2023-07-14 17:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZN4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:35:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZN4"}, "ts": "2023-07-14 17:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYV4.464.464"}, "ts": "2023-07-14 17:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NI29.219.219"}, "ts": "2023-07-14 17:36:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2BH40", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:36:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2BH40.384.384"}, "ts": "2023-07-14 17:36:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18094042", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:36:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18094042", "type": "PubMed"}, "ts": "2023-07-14 17:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53QZ3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:37:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53QZ3"}, "ts": "2023-07-14 17:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:37:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZL6.229.229"}, "ts": "2023-07-14 17:37:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92888"}, "ts": "2023-07-14 17:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXX0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:37:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXX0.14.14"}, "ts": "2023-07-14 17:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16460"}, "ts": "2023-07-14 17:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16460", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:38:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RD9.795.795"}, "ts": "2023-07-14 17:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CHJ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:38:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CHJ4-1"}, "ts": "2023-07-14 17:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10390347", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:39:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10390347", "type": "PubMed"}, "ts": "2023-07-14 17:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZZ26", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:40:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXA5"}, "ts": "2023-07-14 17:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75912-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75912-1"}, "ts": "2023-07-14 17:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94907"}, "ts": "2023-07-14 17:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:41:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00451.258.258"}, "ts": "2023-07-14 17:41:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12139397", "type": "PubMed"}, "ts": "2023-07-14 17:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12139397", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:41:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P85037"}, "ts": "2023-07-14 17:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16429395", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:41:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16429395", "type": "PubMed"}, "ts": "2023-07-14 17:41:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13671.31.31"}, "ts": "2023-07-14 17:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17436251", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:42:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17436251", "type": "PubMed"}, "ts": "2023-07-14 17:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MJT0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:42:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2MJT0-1"}, "ts": "2023-07-14 17:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26590355", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:42:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26590355", "type": "PubMed"}, "ts": "2023-07-14 17:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:42:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81533KY"}, "ts": "2023-07-14 17:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81533KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:42:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81533KY"}, "ts": "2023-07-14 17:42:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76685HR"}, "ts": "2023-07-14 17:42:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99347TW"}, "ts": "2023-07-14 17:42:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451-1"}, "ts": "2023-07-14 17:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33175978", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:43:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33175978", "type": "PubMed"}, "ts": "2023-07-14 17:43:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14973", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:43:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14973.167.167"}, "ts": "2023-07-14 17:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12939276", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:43:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12939276", "type": "PubMed"}, "ts": "2023-07-14 17:43:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:44:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61513"}, "ts": "2023-07-14 17:44:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G95865ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 17:44:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95865ZB"}, "ts": "2023-07-14 17:44:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08243", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:44:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGI2.195.195"}, "ts": "2023-07-14 17:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGI2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:44:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20918-1"}, "ts": "2023-07-14 17:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20918-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:44:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26721934", "type": "PubMed"}, "ts": "2023-07-14 17:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26721934", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:45:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830"}, "ts": "2023-07-14 17:45:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33997955", "type": "PubMed"}, "ts": "2023-07-14 17:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33997955", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:45:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4B5.685.685"}, "ts": "2023-07-14 17:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4B5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63912", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:46:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63912"}, "ts": "2023-07-14 17:46:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06748.4.4"}, "ts": "2023-07-14 17:46:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06748", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:46:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVV4.497.497"}, "ts": "2023-07-14 17:46:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:46:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15164"}, "ts": "2023-07-14 17:46:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02786"}, "ts": "2023-07-14 17:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14136", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:46:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UP83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:47:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UP83.598.598"}, "ts": "2023-07-14 17:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Y3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:47:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5Y3.332.332"}, "ts": "2023-07-14 17:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31228474", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:47:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31228474", "type": "PubMed"}, "ts": "2023-07-14 17:47:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7FL00"}, "ts": "2023-07-14 17:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7FL00", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:47:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23625947", "type": "PubMed"}, "ts": "2023-07-14 17:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23625947", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:48:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NS56.585.585"}, "ts": "2023-07-14 17:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS56", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:48:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97876-1"}, "ts": "2023-07-14 17:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97876-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:48:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91XQ5.128.128"}, "ts": "2023-07-14 17:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XQ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D4K7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:48:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D4K7.372.372"}, "ts": "2023-07-14 17:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23383720", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:49:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23383720", "type": "PubMed"}, "ts": "2023-07-14 17:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:49:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88632"}, "ts": "2023-07-14 17:49:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21078997", "type": "PubMed"}, "ts": "2023-07-14 17:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21078997", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:49:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10604746", "type": "PubMed"}, "ts": "2023-07-14 17:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10604746", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40879", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:50:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40879"}, "ts": "2023-07-14 17:50:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32398261", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:51:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32398261", "type": "PubMed"}, "ts": "2023-07-14 17:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QGZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24097068", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:51:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24097068", "type": "PubMed"}, "ts": "2023-07-14 17:51:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QGZ9"}, "ts": "2023-07-14 17:51:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24097068", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 17:51:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62899", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:51:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62899"}, "ts": "2023-07-14 17:51:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V909"}, "ts": "2023-07-14 17:51:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V909", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12930840", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:51:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12930840", "type": "PubMed"}, "ts": "2023-07-14 17:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06710", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:51:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06710.381.381"}, "ts": "2023-07-14 17:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50549", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:52:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50549.216.216"}, "ts": "2023-07-14 17:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23171796", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:52:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23171796", "type": "PubMed"}, "ts": "2023-07-14 17:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:52:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ75", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:52:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQ75"}, "ts": "2023-07-14 17:52:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NE86"}, "ts": "2023-07-14 17:52:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZY4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:53:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8JZY4-1"}, "ts": "2023-07-14 17:53:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:53:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06576.224.224"}, "ts": "2023-07-14 17:53:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBT1"}, "ts": "2023-07-14 17:53:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBT1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:53:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWI5.63.63"}, "ts": "2023-07-14 17:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWI5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:53:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03252.422.422"}, "ts": "2023-07-14 17:53:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03252", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:53:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWZ8"}, "ts": "2023-07-14 17:54:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62484"}, "ts": "2023-07-14 17:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JMI7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:55:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JMI7-1"}, "ts": "2023-07-14 17:55:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T9G4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:55:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T9G4"}, "ts": "2023-07-14 17:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUL7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:55:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUL7-1"}, "ts": "2023-07-14 17:55:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17105", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:55:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17105"}, "ts": "2023-07-14 17:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L1J6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:55:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A1L1J6.103.103"}, "ts": "2023-07-14 17:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EY4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EY4"}, "ts": "2023-07-14 17:55:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26369427", "type": "PubMed"}, "ts": "2023-07-14 17:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26369427", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:56:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2K6.694.694"}, "ts": "2023-07-14 17:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:56:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHB9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:56:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHB9"}, "ts": "2023-07-14 17:56:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GE4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:56:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96GE4.35.35"}, "ts": "2023-07-14 17:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50539", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:56:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50539.24.24"}, "ts": "2023-07-14 17:56:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18826608", "type": "PubMed"}, "ts": "2023-07-14 17:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18826608", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:57:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:57:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19387550", "type": "PubMed"}, "ts": "2023-07-14 17:58:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19387550", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:58:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24043-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:58:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24043-1.1700.1700"}, "ts": "2023-07-14 17:58:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4A3"}, "ts": "2023-07-14 17:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14392", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 17:59:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14392.263.263"}, "ts": "2023-07-14 17:59:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26766442", "type": "PubMed"}, "ts": "2023-07-14 17:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26766442", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 17:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63312", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 17:59:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63312"}, "ts": "2023-07-14 17:59:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:59:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYC5"}, "ts": "2023-07-14 17:59:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L11"}, "ts": "2023-07-14 17:59:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 17:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 18:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 18:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 18:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 18:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 18:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 18:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63850", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63850"}, "ts": "2023-07-14 18:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:00:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19287377", "type": "PubMed"}, "ts": "2023-07-14 18:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19287377", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:00:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NVI1.556.556"}, "ts": "2023-07-14 18:00:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48431"}, "ts": "2023-07-14 18:00:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13727.25.25"}, "ts": "2023-07-14 18:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13727", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:00:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20030CU"}, "ts": "2023-07-14 18:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20030CU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62314", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:00:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62314.277.277"}, "ts": "2023-07-14 18:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-14 18:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7EQX9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:01:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7EQX9-1"}, "ts": "2023-07-14 18:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:01:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-14 18:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34775375", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:01:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34775375", "type": "PubMed"}, "ts": "2023-07-14 18:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34775375", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 18:01:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10716"}, "ts": "2023-07-14 18:02:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10644702", "type": "PubMed"}, "ts": "2023-07-14 18:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10644702", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:02:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.60.60"}, "ts": "2023-07-14 18:02:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:02:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60520", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:02:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60520"}, "ts": "2023-07-14 18:02:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-14 18:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JM7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:02:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JM7.243.243"}, "ts": "2023-07-14 18:02:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQW4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:03:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQW4"}, "ts": "2023-07-14 18:03:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55288-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:03:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55288-1.540.540"}, "ts": "2023-07-14 18:03:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GM5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:03:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GM5-1"}, "ts": "2023-07-14 18:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2P2-1"}, "ts": "2023-07-14 18:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2P2-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MC2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:03:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MC2"}, "ts": "2023-07-14 18:03:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZT21"}, "ts": "2023-07-14 18:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZT21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNK9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:04:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNK9"}, "ts": "2023-07-14 18:04:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15121", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15121", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:04:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:04:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16594.206.206"}, "ts": "2023-07-14 18:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16594", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:05:31 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NY61", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY61", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:05:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXD2"}, "ts": "2023-07-14 18:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:05:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULB1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULB1"}, "ts": "2023-07-14 18:05:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-14 18:06:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9598321", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:06:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9598321", "type": "PubMed"}, "ts": "2023-07-14 18:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15221008", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:06:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15221008", "type": "PubMed"}, "ts": "2023-07-14 18:06:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08435", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:06:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08435"}, "ts": "2023-07-14 18:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16401", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:06:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16401.18.18"}, "ts": "2023-07-14 18:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VW22-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:06:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VW22-1"}, "ts": "2023-07-14 18:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35105861", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:06:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35105861", "type": "PubMed"}, "ts": "2023-07-14 18:06:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11978764", "type": "PubMed"}, "ts": "2023-07-14 18:06:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11978764", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1V9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:06:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17236138", "type": "PubMed"}, "ts": "2023-07-14 18:07:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17236138", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:07:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12782636", "type": "PubMed"}, "ts": "2023-07-14 18:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12782636", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:07:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876"}, "ts": "2023-07-14 18:07:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46658HL"}, "ts": "2023-07-14 18:08:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2475908", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:08:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2475908", "type": "PubMed"}, "ts": "2023-07-14 18:08:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88831"}, "ts": "2023-07-14 18:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88831", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:08:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9R1V6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1V6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:08:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q658P3"}, "ts": "2023-07-14 18:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q658P3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:09:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QF0"}, "ts": "2023-07-14 18:09:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QF0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-14 18:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-14 18:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:10:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N264.391.391"}, "ts": "2023-07-14 18:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62484", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34972", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:11:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34972"}, "ts": "2023-07-14 18:11:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10051622", "type": "PubMed"}, "ts": "2023-07-14 18:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10051622", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:11:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NV88.415.415"}, "ts": "2023-07-14 18:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV88", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:11:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFD8"}, "ts": "2023-07-14 18:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:11:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IG2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:11:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96IG2.10.10"}, "ts": "2023-07-14 18:12:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAP6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:12:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAP6-1"}, "ts": "2023-07-14 18:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16037490", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:12:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16037490", "type": "PubMed"}, "ts": "2023-07-14 18:12:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22889169", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:12:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22889169", "type": "PubMed"}, "ts": "2023-07-14 18:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-14 18:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24243019", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:13:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24243019", "type": "PubMed"}, "ts": "2023-07-14 18:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12391161", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:13:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12391161", "type": "PubMed"}, "ts": "2023-07-14 18:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8689688", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VA45-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:13:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8689688", "type": "PubMed"}, "ts": "2023-07-14 18:13:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VA45-1"}, "ts": "2023-07-14 18:13:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNH4-1"}, "ts": "2023-07-14 18:14:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNH4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:14:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H6X5.376.376"}, "ts": "2023-07-14 18:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6X5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:14:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14451"}, "ts": "2023-07-14 18:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:14:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23434"}, "ts": "2023-07-14 18:14:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49321"}, "ts": "2023-07-14 18:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:15:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZTQ4.61.61"}, "ts": "2023-07-14 18:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZTQ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49321", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31331361", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:16:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31331361", "type": "PubMed"}, "ts": "2023-07-14 18:16:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31331361", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 18:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98160-1"}, "ts": "2023-07-14 18:16:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98160-1"}, "ts": "2023-07-14 18:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A075B7F1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:16:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A075B7F1.98.98"}, "ts": "2023-07-14 18:16:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:17:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55658LR"}, "ts": "2023-07-14 18:17:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55658LR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:17:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30939", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:17:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30939.5.5"}, "ts": "2023-07-14 18:17:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6T3U3.416.416"}, "ts": "2023-07-14 18:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6T3U3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10381378", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:18:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10381378", "type": "PubMed"}, "ts": "2023-07-14 18:18:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01827.512.512"}, "ts": "2023-07-14 18:18:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01827", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:18:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P531"}, "ts": "2023-07-14 18:18:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WTS6-1"}, "ts": "2023-07-14 18:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WTS6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:18:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3J9-1"}, "ts": "2023-07-14 18:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG18", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG18"}, "ts": "2023-07-14 18:19:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33684622", "type": "PubMed"}, "ts": "2023-07-14 18:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33684622", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45844-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45844-1"}, "ts": "2023-07-14 18:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFU0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:19:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFU0"}, "ts": "2023-07-14 18:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30765789", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:20:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30765789", "type": "PubMed"}, "ts": "2023-07-14 18:20:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62917"}, "ts": "2023-07-14 18:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N135", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:20:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8N135", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y397", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:20:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y397"}, "ts": "2023-07-14 18:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23415", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:20:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23415.174.174"}, "ts": "2023-07-14 18:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:21:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-14 18:21:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A009"}, "ts": "2023-07-14 18:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A009", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:21:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32298"}, "ts": "2023-07-14 18:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32298", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K482", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:21:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K482.51.51"}, "ts": "2023-07-14 18:21:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32043568", "type": "PubMed"}, "ts": "2023-07-14 18:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32043568", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16422", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:22:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16422.4.4"}, "ts": "2023-07-14 18:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:22:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12923.2023.2023"}, "ts": "2023-07-14 18:22:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01484.895.895"}, "ts": "2023-07-14 18:22:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01484", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:22:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07982RO"}, "ts": "2023-07-14 18:22:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07982RO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:22:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12918-1"}, "ts": "2023-07-14 18:23:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12918-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:23:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06702.39.39"}, "ts": "2023-07-14 18:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06702", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N687", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:23:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N687"}, "ts": "2023-07-14 18:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:23:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-14 18:24:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2Q2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:24:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2Q2.304.304"}, "ts": "2023-07-14 18:24:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBE9"}, "ts": "2023-07-14 18:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBE9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJW2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:24:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJW2.191.191"}, "ts": "2023-07-14 18:24:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48550"}, "ts": "2023-07-14 18:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48550", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:25:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12604616", "type": "PubMed"}, "ts": "2023-07-14 18:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12604616", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:25:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-14 18:25:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:25:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHD0"}, "ts": "2023-07-14 18:25:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q1KZI0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q1KZI0-1"}, "ts": "2023-07-14 18:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15911618", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:25:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15911618", "type": "PubMed"}, "ts": "2023-07-14 18:25:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBR0.965.965"}, "ts": "2023-07-14 18:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:26:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51690"}, "ts": "2023-07-14 18:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3857624", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:26:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3857624", "type": "PubMed"}, "ts": "2023-07-14 18:26:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10493.331.331"}, "ts": "2023-07-14 18:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10493", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:27:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85767HW"}, "ts": "2023-07-14 18:27:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-14 18:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62333", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:28:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P62333", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:28:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51174"}, "ts": "2023-07-14 18:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY61", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:28:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY61.428.428"}, "ts": "2023-07-14 18:28:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:28:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11912", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:29:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11912.59.59"}, "ts": "2023-07-14 18:29:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX02", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX02"}, "ts": "2023-07-14 18:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70170", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70170"}, "ts": "2023-07-14 18:29:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33606788", "type": "PubMed"}, "ts": "2023-07-14 18:30:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33606788", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33606788", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 18:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GM1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:30:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96GM1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:30:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03113.324.324"}, "ts": "2023-07-14 18:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03113", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:30:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94875"}, "ts": "2023-07-14 18:31:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8T0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:31:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8T0-1"}, "ts": "2023-07-14 18:31:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZW19-1"}, "ts": "2023-07-14 18:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZW19-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:31:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JA1-1"}, "ts": "2023-07-14 18:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JA1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:31:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UFT3"}, "ts": "2023-07-14 18:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UFT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98160-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98160-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:32:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28471"}, "ts": "2023-07-14 18:32:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28471", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:32:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9463366", "type": "PubMed"}, "ts": "2023-07-14 18:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9463366", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:32:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2M5"}, "ts": "2023-07-14 18:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2M5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:33:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:33:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37023"}, "ts": "2023-07-14 18:33:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:33:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37023"}, "ts": "2023-07-14 18:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:34:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-14 18:34:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-14 18:34:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01033-1"}, "ts": "2023-07-14 18:34:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35269", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:34:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35269.217.217"}, "ts": "2023-07-14 18:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75063", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:34:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75063.193.193"}, "ts": "2023-07-14 18:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q701N2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:35:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q701N2.31.31"}, "ts": "2023-07-14 18:35:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22577140", "type": "PubMed"}, "ts": "2023-07-14 18:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22577140", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:35:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:35:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H799.856.856"}, "ts": "2023-07-14 18:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H799", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13379", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:35:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13379.452.452"}, "ts": "2023-07-14 18:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z1W5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:36:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z1W5"}, "ts": "2023-07-14 18:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50395", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:36:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P50395", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80VC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80VC9"}, "ts": "2023-07-14 18:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LW4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:37:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LW4.394.394"}, "ts": "2023-07-14 18:37:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CRD4.119.119"}, "ts": "2023-07-14 18:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CRD4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16220"}, "ts": "2023-07-14 18:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1N4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:39:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1N4"}, "ts": "2023-07-14 18:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8619876", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:40:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8619876", "type": "PubMed"}, "ts": "2023-07-14 18:40:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TL54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:40:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TL54"}, "ts": "2023-07-14 18:40:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00548", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:40:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00548"}, "ts": "2023-07-14 18:40:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 18:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PC5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:40:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PC5.1294.1294"}, "ts": "2023-07-14 18:40:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-14 18:40:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-14 18:41:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:41:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXX7"}, "ts": "2023-07-14 18:41:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A7MD48"}, "ts": "2023-07-14 18:41:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A7MD48", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:41:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A7E1W8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:41:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A7E1W8"}, "ts": "2023-07-14 18:41:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11274", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:41:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11274.25.25"}, "ts": "2023-07-14 18:41:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51690", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:42:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-14 18:42:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14749729", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:42:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14749729", "type": "PubMed"}, "ts": "2023-07-14 18:42:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55006"}, "ts": "2023-07-14 18:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55006", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85767HW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:43:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-14 18:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-14 18:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:44:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10814723", "type": "PubMed"}, "ts": "2023-07-14 18:45:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10814723", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:45:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60334", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:45:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60334"}, "ts": "2023-07-14 18:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:45:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11146440", "type": "PubMed"}, "ts": "2023-07-14 18:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11146440", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40818-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40818-1"}, "ts": "2023-07-14 18:46:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-14 18:46:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZI2.191.191"}, "ts": "2023-07-14 18:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94875", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:46:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62170-1"}, "ts": "2023-07-14 18:46:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62170-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:47:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LI63"}, "ts": "2023-07-14 18:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQA6"}, "ts": "2023-07-14 18:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01042", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:47:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01042.170.170"}, "ts": "2023-07-14 18:47:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWQ8"}, "ts": "2023-07-14 18:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWQ8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62426-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:47:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62426-1"}, "ts": "2023-07-14 18:47:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4Q2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:48:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-14 18:48:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ8"}, "ts": "2023-07-14 18:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28097769", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:48:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28097769", "type": "PubMed"}, "ts": "2023-07-14 18:48:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12640130", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:48:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12640130", "type": "PubMed"}, "ts": "2023-07-14 18:48:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394"}, "ts": "2023-07-14 18:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05DH4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:49:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05DH4.435.435"}, "ts": "2023-07-14 18:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25115-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:49:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25115-1"}, "ts": "2023-07-14 18:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22310AV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4I7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:50:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z4I7.26.26"}, "ts": "2023-07-14 18:50:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.205.205"}, "ts": "2023-07-14 18:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:50:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18293376", "type": "PubMed"}, "ts": "2023-07-14 18:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18293376", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:51:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50213.304.304"}, "ts": "2023-07-14 18:51:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50213", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:51:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16785532", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:51:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16785532", "type": "PubMed"}, "ts": "2023-07-14 18:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:51:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02751-15.1236.1236"}, "ts": "2023-07-14 18:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M9N0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 18:52:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5M9N0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 18:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35626"}, "ts": "2023-07-14 18:52:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00993", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:53:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00993"}, "ts": "2023-07-14 18:53:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SZ6-1"}, "ts": "2023-07-14 18:53:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SZ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-14 18:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:53:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94911"}, "ts": "2023-07-14 18:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94911", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:53:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SQS7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:53:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5SQS7.80.80"}, "ts": "2023-07-14 18:53:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:53:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15165", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:53:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15165"}, "ts": "2023-07-14 18:53:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-14 18:54:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H422-1"}, "ts": "2023-07-14 18:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H422-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JY77", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:54:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JY77.409.409"}, "ts": "2023-07-14 18:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21056967", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:54:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21056967", "type": "PubMed"}, "ts": "2023-07-14 18:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-14 18:55:15 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-14 18:55:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-14 18:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKD1"}, "ts": "2023-07-14 18:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:55:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q504Y2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:55:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q504Y2.148.148"}, "ts": "2023-07-14 18:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11238726", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:55:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11238726", "type": "PubMed"}, "ts": "2023-07-14 18:55:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-14 18:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BG84-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:55:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BG84-1"}, "ts": "2023-07-14 18:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3S9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:55:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3S9.80.80"}, "ts": "2023-07-14 18:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BV66-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:56:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BV66-1"}, "ts": "2023-07-14 18:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80858MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:57:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15117"}, "ts": "2023-07-14 18:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15117", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:57:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96QE4.844.844"}, "ts": "2023-07-14 18:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QE4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9192866", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 18:57:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9192866", "type": "PubMed"}, "ts": "2023-07-14 18:57:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQP2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:57:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PQP2-1"}, "ts": "2023-07-14 18:57:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16284", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 18:57:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16284.344.344"}, "ts": "2023-07-14 18:57:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH37", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 18:58:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH37"}, "ts": "2023-07-14 18:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 18:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13726"}, "ts": "2023-07-14 18:58:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N2B3"}, "ts": "2023-07-14 18:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N2B3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:58:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:58:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75830"}, "ts": "2023-07-14 18:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:59:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ84"}, "ts": "2023-07-14 18:59:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13721-1"}, "ts": "2023-07-14 18:59:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13721-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 18:59:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZT9"}, "ts": "2023-07-14 18:59:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42166-1"}, "ts": "2023-07-14 18:59:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42166-1"}, "ts": "2023-07-14 18:59:33 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 19:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 19:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 19:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 19:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 19:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 19:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:00:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DMV9.633.633"}, "ts": "2023-07-14 19:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4FZC9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4FZC9"}, "ts": "2023-07-14 19:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6VV64", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:00:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6VV64.264.264"}, "ts": "2023-07-14 19:00:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TAZ6.240.240"}, "ts": "2023-07-14 19:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAZ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14522", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:00:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14522.547.547"}, "ts": "2023-07-14 19:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07996-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:01:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07996-1.212.212"}, "ts": "2023-07-14 19:01:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43121"}, "ts": "2023-07-14 19:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92793-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UFC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:04:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UFC0.251.251"}, "ts": "2023-07-14 19:04:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB2"}, "ts": "2023-07-14 19:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:04:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-14 19:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:05:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N196.525.525"}, "ts": "2023-07-14 19:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N196", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:05:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17936", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:05:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17936.155.155"}, "ts": "2023-07-14 19:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP70-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:05:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP70-1"}, "ts": "2023-07-14 19:05:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05787.333.333"}, "ts": "2023-07-14 19:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05787", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:06:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92519.190.190"}, "ts": "2023-07-14 19:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92519", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:06:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NXS2.70.70"}, "ts": "2023-07-14 19:06:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXS2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:06:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C7U0.591.591"}, "ts": "2023-07-14 19:06:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7U0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:06:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:06:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-14 19:06:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05682.638.638"}, "ts": "2023-07-14 19:07:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05682", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:07:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-14 19:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:07:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54819.58.58"}, "ts": "2023-07-14 19:07:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 19:07:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WW12"}, "ts": "2023-07-14 19:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WW12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64605", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:09:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64605"}, "ts": "2023-07-14 19:09:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:09:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56280", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:09:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56280"}, "ts": "2023-07-14 19:09:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BU70-1"}, "ts": "2023-07-14 19:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BU70-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:09:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10449908", "type": "PubMed"}, "ts": "2023-07-14 19:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10449908", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY57", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IY57"}, "ts": "2023-07-14 19:10:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86XP3.642.642"}, "ts": "2023-07-14 19:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XP3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:10:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXI9"}, "ts": "2023-07-14 19:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:10:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-14 19:11:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22625SJ"}, "ts": "2023-07-14 19:11:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 19:11:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-14 19:11:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-14 19:11:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-14 19:11:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-14 19:11:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91636VS"}, "ts": "2023-07-14 19:11:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-14 19:11:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95977AE"}, "ts": "2023-07-14 19:11:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24835MQ"}, "ts": "2023-07-14 19:11:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72667IM"}, "ts": "2023-07-14 19:11:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71142DF"}, "ts": "2023-07-14 19:11:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R0W6-1"}, "ts": "2023-07-14 19:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R0W6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:11:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRD8.350.350"}, "ts": "2023-07-14 19:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRD8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:12:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24204001", "type": "PubMed"}, "ts": "2023-07-14 19:13:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24204001", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:13:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3198605", "type": "PubMed"}, "ts": "2023-07-14 19:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3198605", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:13:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULH4"}, "ts": "2023-07-14 19:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17379241", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:14:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17379241", "type": "PubMed"}, "ts": "2023-07-14 19:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYP9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:14:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYP9-1"}, "ts": "2023-07-14 19:14:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUE4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:14:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUE4"}, "ts": "2023-07-14 19:14:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:14:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P225"}, "ts": "2023-07-14 19:14:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:14:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYM9-1"}, "ts": "2023-07-14 19:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYM9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:14:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16555.287.287"}, "ts": "2023-07-14 19:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42166-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:16:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14210.98.98"}, "ts": "2023-07-14 19:16:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-14 19:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35590", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:16:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35590.608.608"}, "ts": "2023-07-14 19:16:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JYU6"}, "ts": "2023-07-14 19:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JYU6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:17:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-14 19:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34059", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:18:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P34059.31.31"}, "ts": "2023-07-14 19:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:18:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-14 19:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:19:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUI6"}, "ts": "2023-07-14 19:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60231", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:20:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60231.276.276"}, "ts": "2023-07-14 19:20:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0K9"}, "ts": "2023-07-14 19:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:20:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6K3"}, "ts": "2023-07-14 19:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6K3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:21:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X55"}, "ts": "2023-07-14 19:21:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26192331", "type": "PubMed"}, "ts": "2023-07-14 19:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26192331", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:21:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10361"}, "ts": "2023-07-14 19:22:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15249688", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:22:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15249688", "type": "PubMed"}, "ts": "2023-07-14 19:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80966KZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43628", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:23:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43628.37.37"}, "ts": "2023-07-14 19:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:23:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-14 19:24:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80108"}, "ts": "2023-07-14 19:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31482", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:25:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31482"}, "ts": "2023-07-14 19:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12130714", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:25:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12130714", "type": "PubMed"}, "ts": "2023-07-14 19:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:25:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-14 19:25:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-14 19:25:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1V7"}, "ts": "2023-07-14 19:26:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:26:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08950", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:26:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08950"}, "ts": "2023-07-14 19:26:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42694-1"}, "ts": "2023-07-14 19:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42694-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16383", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:27:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16383.17.17"}, "ts": "2023-07-14 19:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:28:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B23"}, "ts": "2023-07-14 19:28:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TAH2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:28:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TAH2.514.514"}, "ts": "2023-07-14 19:28:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23025-1"}, "ts": "2023-07-14 19:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-14 19:29:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23025-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A9QM74", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:29:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A9QM74"}, "ts": "2023-07-14 19:29:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61769"}, "ts": "2023-07-14 19:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61769", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:30:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-14 19:31:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:32:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BTC0.100.100"}, "ts": "2023-07-14 19:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P158", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:32:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P158"}, "ts": "2023-07-14 19:32:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-14 19:33:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21245134", "type": "PubMed"}, "ts": "2023-07-14 19:33:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21245134", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL25", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:33:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UL25.59.59"}, "ts": "2023-07-14 19:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:33:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-14 19:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:35:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-14 19:35:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:35:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20849"}, "ts": "2023-07-14 19:35:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31785.159.159"}, "ts": "2023-07-14 19:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U4F4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:35:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U4F4"}, "ts": "2023-07-14 19:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 19:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63425", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:37:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63425.1020.1020"}, "ts": "2023-07-14 19:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:37:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.6.6"}, "ts": "2023-07-14 19:37:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52209"}, "ts": "2023-07-14 19:37:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 19:38:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-14 19:38:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:38:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-14 19:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:40:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2209617", "type": "PubMed"}, "ts": "2023-07-14 19:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2209617", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:41:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-14 19:41:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:41:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N122"}, "ts": "2023-07-14 19:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:42:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08881.30.30"}, "ts": "2023-07-14 19:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08881", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:42:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX24"}, "ts": "2023-07-14 19:42:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8170997", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:43:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8170997", "type": "PubMed"}, "ts": "2023-07-14 19:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZT98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:43:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZT98"}, "ts": "2023-07-14 19:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9600966", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:43:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9600966", "type": "PubMed"}, "ts": "2023-07-14 19:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:44:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Q9.1231.1231"}, "ts": "2023-07-14 19:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYX2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:44:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYX2.436.436"}, "ts": "2023-07-14 19:44:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37275"}, "ts": "2023-07-14 19:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:44:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95070"}, "ts": "2023-07-14 19:44:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P69"}, "ts": "2023-07-14 19:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P69", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:45:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61666.111.111"}, "ts": "2023-07-14 19:45:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:45:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:46:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGW1"}, "ts": "2023-07-14 19:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:46:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGJ9"}, "ts": "2023-07-14 19:46:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMC3"}, "ts": "2023-07-14 19:46:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M3G7-1"}, "ts": "2023-07-14 19:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:46:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMC3"}, "ts": "2023-07-14 19:46:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M3G7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:46:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LD0"}, "ts": "2023-07-14 19:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z739"}, "ts": "2023-07-14 19:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-14 19:47:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDY8-1"}, "ts": "2023-07-14 19:47:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDY8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:47:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-14 19:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:47:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62888"}, "ts": "2023-07-14 19:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:47:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42574"}, "ts": "2023-07-14 19:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:47:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56A73"}, "ts": "2023-07-14 19:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56A73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:48:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54756.266.266"}, "ts": "2023-07-14 19:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14842", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:48:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14842"}, "ts": "2023-07-14 19:48:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54756", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:49:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UW1"}, "ts": "2023-07-14 19:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42831WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:51:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42831WZ"}, "ts": "2023-07-14 19:51:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y314"}, "ts": "2023-07-14 19:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:51:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3D5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3D5"}, "ts": "2023-07-14 19:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAE6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:52:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAE6"}, "ts": "2023-07-14 19:52:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P57739", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 19:52:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-14 19:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57739", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 19:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57739", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 19:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12872", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:52:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12872"}, "ts": "2023-07-14 19:52:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9573336", "type": "PubMed"}, "ts": "2023-07-14 19:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9573336", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8987814", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:53:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8987814", "type": "PubMed"}, "ts": "2023-07-14 19:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922B1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:54:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922B1"}, "ts": "2023-07-14 19:54:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99988", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:54:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99988"}, "ts": "2023-07-14 19:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 19:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 19:55:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P18564", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 19:55:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18564", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 19:55:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-14 19:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31560841", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 19:56:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31560841", "type": "PubMed"}, "ts": "2023-07-14 19:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31560841", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 19:56:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-14 19:57:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60765", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:57:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60765"}, "ts": "2023-07-14 19:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF74", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:57:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF74"}, "ts": "2023-07-14 19:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99K67", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:57:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99K67"}, "ts": "2023-07-14 19:57:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43426"}, "ts": "2023-07-14 19:57:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-14 19:57:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94842", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:58:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94842.353.353"}, "ts": "2023-07-14 19:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CPW7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 19:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CPW7"}, "ts": "2023-07-14 19:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-14 19:58:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43916"}, "ts": "2023-07-14 19:58:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39654"}, "ts": "2023-07-14 19:58:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39654", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 19:58:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-14 19:58:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50750.180.180"}, "ts": "2023-07-14 19:59:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50750", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 19:59:04 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 20:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 20:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 20:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 20:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 20:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00738", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:00:17 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P00738", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 20:00:27 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 20:00:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 20:00:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:00:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y251"}, "ts": "2023-07-14 20:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y251", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:00:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-14 20:00:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61221"}, "ts": "2023-07-14 20:01:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A9E2"}, "ts": "2023-07-14 20:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A9E2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:01:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22083"}, "ts": "2023-07-14 20:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63081", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:01:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63081"}, "ts": "2023-07-14 20:01:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12955.847.847"}, "ts": "2023-07-14 20:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12955", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75818", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:02:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75818"}, "ts": "2023-07-14 20:02:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:02:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z127"}, "ts": "2023-07-14 20:02:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253-1"}, "ts": "2023-07-14 20:02:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95864", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:03:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O95864", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33435-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:03:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33435-1"}, "ts": "2023-07-14 20:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:03:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19056886", "type": "PubMed"}, "ts": "2023-07-14 20:03:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19056886", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:03:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22509"}, "ts": "2023-07-14 20:03:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50427EO"}, "ts": "2023-07-14 20:04:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:04:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63155"}, "ts": "2023-07-14 20:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:04:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43451", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:04:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43451.296.296"}, "ts": "2023-07-14 20:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:05:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P06213", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:05:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7522053", "type": "PubMed"}, "ts": "2023-07-14 20:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7522053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54840"}, "ts": "2023-07-14 20:05:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14571.937.937"}, "ts": "2023-07-14 20:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14571", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:05:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:06:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ3"}, "ts": "2023-07-14 20:06:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-14 20:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04085-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04085-1"}, "ts": "2023-07-14 20:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-14 20:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28002401", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:07:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28002401", "type": "PubMed"}, "ts": "2023-07-14 20:07:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:08:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A597"}, "ts": "2023-07-14 20:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60710", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:08:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60710.52.52"}, "ts": "2023-07-14 20:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:08:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE69"}, "ts": "2023-07-14 20:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE69", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:08:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-14 20:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-14 20:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:09:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21526146", "type": "PubMed"}, "ts": "2023-07-14 20:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21526146", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:09:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-14 20:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:11:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-14 20:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g00052mo", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1430234", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:12:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1430234", "type": "PubMed"}, "ts": "2023-07-14 20:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29772575", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:12:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29772575", "type": "PubMed"}, "ts": "2023-07-14 20:12:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:13:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:13:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:13:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53350", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:14:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P53350", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9473480", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:14:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9473480", "type": "PubMed"}, "ts": "2023-07-14 20:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14126", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14126"}, "ts": "2023-07-14 20:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29386545", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:15:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29386545", "type": "PubMed"}, "ts": "2023-07-14 20:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29386545", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 20:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63623", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:15:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63623"}, "ts": "2023-07-14 20:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14324", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14324"}, "ts": "2023-07-14 20:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI37"}, "ts": "2023-07-14 20:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI37", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61221", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:17:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q499R6-1"}, "ts": "2023-07-14 20:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q499R6-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q499R6-1", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 20:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62219", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:17:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62219"}, "ts": "2023-07-14 20:17:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY64", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:17:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NY64", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:17:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925J9"}, "ts": "2023-07-14 20:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925J9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:18:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49225WK"}, "ts": "2023-07-14 20:18:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52565"}, "ts": "2023-07-14 20:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VE6"}, "ts": "2023-07-14 20:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VE6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:20:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QY30"}, "ts": "2023-07-14 20:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:20:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHV9"}, "ts": "2023-07-14 20:20:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-14 20:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Y7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:21:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5Y7"}, "ts": "2023-07-14 20:21:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-14 20:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35640", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:21:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35640"}, "ts": "2023-07-14 20:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:21:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56516KW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:21:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56516KW"}, "ts": "2023-07-14 20:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-14 20:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06455-1"}, "ts": "2023-07-14 20:22:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56516KW"}, "ts": "2023-07-14 20:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-14 20:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-14 20:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-14 20:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35280FV"}, "ts": "2023-07-14 20:22:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06455-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65937TS"}, "ts": "2023-07-14 20:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13034JT"}, "ts": "2023-07-14 20:22:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:22:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 20:22:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BUN5-1"}, "ts": "2023-07-14 20:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BUN5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:24:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-14 20:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37868ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:24:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60606", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:24:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60606"}, "ts": "2023-07-14 20:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9593744", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:26:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9593744", "type": "PubMed"}, "ts": "2023-07-14 20:26:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-14 20:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:26:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:26:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXN9"}, "ts": "2023-07-14 20:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI77"}, "ts": "2023-07-14 20:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:28:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:28:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30154.54.54"}, "ts": "2023-07-14 20:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30154", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:28:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-14 20:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-14 20:29:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-14 20:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:29:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14165"}, "ts": "2023-07-14 20:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14165", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:30:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKV0"}, "ts": "2023-07-14 20:30:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:31:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41252"}, "ts": "2023-07-14 20:31:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13427.576.576"}, "ts": "2023-07-14 20:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13427", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28980301", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:32:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28980301", "type": "PubMed"}, "ts": "2023-07-14 20:32:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY76.177.177"}, "ts": "2023-07-14 20:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:32:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-14 20:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A6P1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:34:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A6P1"}, "ts": "2023-07-14 20:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49225WK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:34:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0AUV4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:35:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0AUV4"}, "ts": "2023-07-14 20:35:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-14 20:35:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52565", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61081-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:35:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61081-1"}, "ts": "2023-07-14 20:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08910", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:36:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08910"}, "ts": "2023-07-14 20:36:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4LDG9"}, "ts": "2023-07-14 20:36:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4LDG9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:36:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGP4"}, "ts": "2023-07-14 20:37:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99460"}, "ts": "2023-07-14 20:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:37:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:37:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26384929", "type": "PubMed"}, "ts": "2023-07-14 20:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26384929", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:37:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0A3"}, "ts": "2023-07-14 20:37:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70468-1"}, "ts": "2023-07-14 20:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70468-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:38:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75604.587.587"}, "ts": "2023-07-14 20:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75604", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYF1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:38:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYF1.432.432"}, "ts": "2023-07-14 20:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10230404", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:39:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10230404", "type": "PubMed"}, "ts": "2023-07-14 20:39:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06210"}, "ts": "2023-07-14 20:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:40:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12421765", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:40:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12421765", "type": "PubMed"}, "ts": "2023-07-14 20:40:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P10636", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10636", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYG8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:41:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYG8.3.3"}, "ts": "2023-07-14 20:41:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60675", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:41:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60675.15.15"}, "ts": "2023-07-14 20:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D3W4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:42:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D3W4-1"}, "ts": "2023-07-14 20:42:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:42:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13231"}, "ts": "2023-07-14 20:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01024", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:42:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01024"}, "ts": "2023-07-14 20:42:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CDW1"}, "ts": "2023-07-14 20:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CDW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:43:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67850YF"}, "ts": "2023-07-14 20:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6A0A9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:43:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6A0A9"}, "ts": "2023-07-14 20:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62702-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:43:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62702-1"}, "ts": "2023-07-14 20:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCS0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:43:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCS0"}, "ts": "2023-07-14 20:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2S2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:44:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2S2.1180.1180"}, "ts": "2023-07-14 20:44:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31949"}, "ts": "2023-07-14 20:44:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-14 20:44:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RJ0"}, "ts": "2023-07-14 20:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19958IL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 20:45:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09234"}, "ts": "2023-07-14 20:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09234", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12866", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:46:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12866.935.935"}, "ts": "2023-07-14 20:46:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P23921", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23921", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25445"}, "ts": "2023-07-14 20:46:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3484703", "type": "PubMed"}, "ts": "2023-07-14 20:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3484703", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:47:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-14 20:47:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10854283", "type": "PubMed"}, "ts": "2023-07-14 20:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10854283", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:49:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29788"}, "ts": "2023-07-14 20:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10374881", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:49:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10374881", "type": "PubMed"}, "ts": "2023-07-14 20:49:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68036-1"}, "ts": "2023-07-14 20:50:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68036-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:50:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14527413", "type": "PubMed"}, "ts": "2023-07-14 20:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14527413", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:51:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83295QG"}, "ts": "2023-07-14 20:51:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83295QG"}, "ts": "2023-07-14 20:51:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21964"}, "ts": "2023-07-14 20:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35973-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:51:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35973-1"}, "ts": "2023-07-14 20:51:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14410", "cluster_type": "unselected"}, "ts": "2023-07-14 20:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14410", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:52:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14410", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 20:52:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15217", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15217"}, "ts": "2023-07-14 20:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TR09"}, "ts": "2023-07-14 20:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TR09", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:53:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92485", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 20:53:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92485", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 20:53:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04217.466.466"}, "ts": "2023-07-14 20:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04217", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:53:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48960"}, "ts": "2023-07-14 20:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A140T8J6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:54:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A140T8J6-1"}, "ts": "2023-07-14 20:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F46", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 20:54:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96F46.54.54"}, "ts": "2023-07-14 20:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:54:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11247"}, "ts": "2023-07-14 20:54:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-14 20:54:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-14 20:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-14 20:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y274-1"}, "ts": "2023-07-14 20:55:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y274-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 20:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4H9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:56:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4H9"}, "ts": "2023-07-14 20:56:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95295"}, "ts": "2023-07-14 20:57:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-14 20:57:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61916"}, "ts": "2023-07-14 20:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15055", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:57:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15055"}, "ts": "2023-07-14 20:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YH6"}, "ts": "2023-07-14 20:57:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25963006", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 20:58:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25963006", "type": "PubMed"}, "ts": "2023-07-14 20:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:59:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15041"}, "ts": "2023-07-14 20:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15041", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 20:59:27 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 21:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 21:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 21:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 21:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 21:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 21:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30827496", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:00:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30827496", "type": "PubMed"}, "ts": "2023-07-14 21:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:00:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17426"}, "ts": "2023-07-14 21:00:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-14 21:00:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UX06.352.352"}, "ts": "2023-07-14 21:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19174", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:01:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19174"}, "ts": "2023-07-14 21:01:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:02:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-14 21:02:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:03:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJU2.128.128"}, "ts": "2023-07-14 21:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34392586", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:04:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34392586", "type": "PubMed"}, "ts": "2023-07-14 21:04:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34392586", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 21:04:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N0Y5.61.61"}, "ts": "2023-07-14 21:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0Y5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:04:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18065"}, "ts": "2023-07-14 21:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NNW5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:04:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NNW5.883.883"}, "ts": "2023-07-14 21:04:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:05:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1748679"}, "ts": "2023-07-14 21:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 21:05:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y618.1109.1109"}, "ts": "2023-07-14 21:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:06:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49454"}, "ts": "2023-07-14 21:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE82", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:07:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TE82.684.684"}, "ts": "2023-07-14 21:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20347429", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:07:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20347429", "type": "PubMed"}, "ts": "2023-07-14 21:07:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60780-1"}, "ts": "2023-07-14 21:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60780-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:07:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P31042", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 21:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9647647", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 21:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83295QG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:07:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9647647", "type": "PubMed"}, "ts": "2023-07-14 21:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31042", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 21:07:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3T4-1"}, "ts": "2023-07-14 21:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83295QG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3T4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:07:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95517DQ"}, "ts": "2023-07-14 21:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83295QG"}, "ts": "2023-07-14 21:07:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28790AT"}, "ts": "2023-07-14 21:07:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40992GJ"}, "ts": "2023-07-14 21:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21964", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:07:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X67"}, "ts": "2023-07-14 21:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:08:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-14 21:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:08:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98256YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:08:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98256YA"}, "ts": "2023-07-14 21:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04760", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:08:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04760"}, "ts": "2023-07-14 21:08:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI33", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:08:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UI33.282.282"}, "ts": "2023-07-14 21:08:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69849"}, "ts": "2023-07-14 21:09:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28347"}, "ts": "2023-07-14 21:09:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13349", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:09:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13349"}, "ts": "2023-07-14 21:09:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-14 21:09:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI44"}, "ts": "2023-07-14 21:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI44", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922H4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:09:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922H4"}, "ts": "2023-07-14 21:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48960", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:09:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-14 21:09:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZQY2"}, "ts": "2023-07-14 21:10:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZQY2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:10:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30835", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:10:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33065005", "type": "PubMed"}, "ts": "2023-07-14 21:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33065005", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:10:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40967"}, "ts": "2023-07-14 21:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40967", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43390", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:11:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43390.391.391"}, "ts": "2023-07-14 21:11:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23103875", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:11:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23103875", "type": "PubMed"}, "ts": "2023-07-14 21:11:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35550"}, "ts": "2023-07-14 21:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15072", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:12:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15072.475.475"}, "ts": "2023-07-14 21:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:12:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05091"}, "ts": "2023-07-14 21:12:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05091", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:12:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25348153", "type": "PubMed"}, "ts": "2023-07-14 21:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25348153", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15561936", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:12:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15561936", "type": "PubMed"}, "ts": "2023-07-14 21:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95295", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:13:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "30789418"}, "ts": "2023-07-14 21:13:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-14 21:14:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20983SP"}, "ts": "2023-07-14 21:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:16:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZR69"}, "ts": "2023-07-14 21:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZR69", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D731", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D731"}, "ts": "2023-07-14 21:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:19:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-14 21:19:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70606"}, "ts": "2023-07-14 21:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70606", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:19:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96P31.561.561"}, "ts": "2023-07-14 21:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P31", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18065", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15111"}, "ts": "2023-07-14 21:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15111", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:20:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT04", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:20:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT04"}, "ts": "2023-07-14 21:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:20:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-14 21:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80WG5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:21:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80WG5-1"}, "ts": "2023-07-14 21:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:22:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19783", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:22:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19783"}, "ts": "2023-07-14 21:22:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LX8"}, "ts": "2023-07-14 21:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:22:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01650"}, "ts": "2023-07-14 21:22:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5F9.526.526"}, "ts": "2023-07-14 21:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:23:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43255-1"}, "ts": "2023-07-14 21:23:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43255-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:23:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:23:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JPE7"}, "ts": "2023-07-14 21:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JPE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:23:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:24:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-14 21:24:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-14 21:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:25:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:25:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75899.307.307"}, "ts": "2023-07-14 21:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75899", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:25:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FM1"}, "ts": "2023-07-14 21:25:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FM1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKA9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:26:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKA9.308.308"}, "ts": "2023-07-14 21:26:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-14 21:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:26:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15117"}, "ts": "2023-07-14 21:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15117", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:26:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V9L6"}, "ts": "2023-07-14 21:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V9L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:27:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56524.246.246"}, "ts": "2023-07-14 21:27:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56524", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34711117", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:28:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34711117", "type": "PubMed"}, "ts": "2023-07-14 21:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34711117", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 21:28:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-14 21:28:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:28:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99715-1.1031.1031"}, "ts": "2023-07-14 21:28:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99715-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:28:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294"}, "ts": "2023-07-14 21:29:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09429", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 21:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 21:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZL50", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:29:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZL50"}, "ts": "2023-07-14 21:29:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-14 21:30:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7472412", "type": "PubMed"}, "ts": "2023-07-14 21:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13111", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:30:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13111"}, "ts": "2023-07-14 21:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:30:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3353370", "type": "PubMed"}, "ts": "2023-07-14 21:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3353370", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06211", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:31:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06211.542.542"}, "ts": "2023-07-14 21:31:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20983SP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19858347", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:31:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19858347", "type": "PubMed"}, "ts": "2023-07-14 21:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:31:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04264.557.557"}, "ts": "2023-07-14 21:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17108144", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:32:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17108144", "type": "PubMed"}, "ts": "2023-07-14 21:32:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-14 21:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V16"}, "ts": "2023-07-14 21:35:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V16", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:35:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49913"}, "ts": "2023-07-14 21:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:35:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-14 21:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WN2"}, "ts": "2023-07-14 21:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-14 21:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZE7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:36:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZE7"}, "ts": "2023-07-14 21:36:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q93033.75.75"}, "ts": "2023-07-14 21:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93033", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:36:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-14 21:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14561", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14561"}, "ts": "2023-07-14 21:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17433EW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-14 21:38:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A523"}, "ts": "2023-07-14 21:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A523", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:38:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16875", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:38:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16875.356.356"}, "ts": "2023-07-14 21:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:38:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTM4"}, "ts": "2023-07-14 21:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:39:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13541"}, "ts": "2023-07-14 21:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13541", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:39:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z5A7"}, "ts": "2023-07-14 21:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64449", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:39:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64449"}, "ts": "2023-07-14 21:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:40:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-14 21:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:41:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZF1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:42:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZF1.14.14"}, "ts": "2023-07-14 21:42:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42765"}, "ts": "2023-07-14 21:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:44:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-14 21:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00507", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:44:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00507"}, "ts": "2023-07-14 21:44:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-14 21:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:44:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:45:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08462.888.888"}, "ts": "2023-07-14 21:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00846", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:45:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00846"}, "ts": "2023-07-14 21:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8412563", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:46:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8412563", "type": "PubMed"}, "ts": "2023-07-14 21:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15205-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:46:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15205-1"}, "ts": "2023-07-14 21:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:46:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL68"}, "ts": "2023-07-14 21:46:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:46:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18449195", "type": "PubMed"}, "ts": "2023-07-14 21:47:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18449195", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:47:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16586.141.141"}, "ts": "2023-07-14 21:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16586", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29419", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:48:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29419"}, "ts": "2023-07-14 21:48:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-14 21:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8689688", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:48:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8689688", "type": "PubMed"}, "ts": "2023-07-14 21:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RD76"}, "ts": "2023-07-14 21:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RD76", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:49:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y237"}, "ts": "2023-07-14 21:49:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80U16", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:49:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80U16"}, "ts": "2023-07-14 21:49:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24096322", "type": "PubMed"}, "ts": "2023-07-14 21:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24096322", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00053MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 21:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:51:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:51:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.523.523"}, "ts": "2023-07-14 21:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:51:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3G5-1.346.346"}, "ts": "2023-07-14 21:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3G5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12259", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P995"}, "ts": "2023-07-14 21:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P995", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03721", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:52:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03721.342.342"}, "ts": "2023-07-14 21:52:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N3V7.566.566"}, "ts": "2023-07-14 21:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3V7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6Y1"}, "ts": "2023-07-14 21:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13115"}, "ts": "2023-07-14 21:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13115", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:53:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-14 21:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GX9"}, "ts": "2023-07-14 21:54:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GX9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY77"}, "ts": "2023-07-14 21:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLM2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 21:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLM2"}, "ts": "2023-07-14 21:55:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09875", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:55:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09875"}, "ts": "2023-07-14 21:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1386496", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:56:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1386496", "type": "PubMed"}, "ts": "2023-07-14 21:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35089-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:56:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35089-1"}, "ts": "2023-07-14 21:56:52 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 21:57:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 21:57:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 21:57:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11029056", "type": "PubMed"}, "ts": "2023-07-14 21:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11029056", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NJZ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 21:57:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NJZ7.17.17"}, "ts": "2023-07-14 21:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-14 21:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-14 21:57:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70207"}, "ts": "2023-07-14 21:58:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33649851", "type": "PubMed"}, "ts": "2023-07-14 21:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33649851", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33649851", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 21:59:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2946589", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 21:59:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2946589", "type": "PubMed"}, "ts": "2023-07-14 21:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 21:59:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63151"}, "ts": "2023-07-14 21:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A35", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:00:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96A35.24.24"}, "ts": "2023-07-14 22:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 22:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 22:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 22:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 22:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 22:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 22:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3N2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:00:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3N2-1"}, "ts": "2023-07-14 22:00:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-14 22:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NC57", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:00:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NC57.244.244"}, "ts": "2023-07-14 22:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9668159", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:00:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9668159", "type": "PubMed"}, "ts": "2023-07-14 22:00:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFP4"}, "ts": "2023-07-14 22:01:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFP4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:01:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12770.132.132"}, "ts": "2023-07-14 22:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12770", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:01:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19096"}, "ts": "2023-07-14 22:01:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:02:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18160040", "type": "PubMed"}, "ts": "2023-07-14 22:02:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18160040", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:02:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H227"}, "ts": "2023-07-14 22:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:02:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UY5"}, "ts": "2023-07-14 22:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:02:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JXZ4"}, "ts": "2023-07-14 22:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JXZ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCN3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:03:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCN3.217.217"}, "ts": "2023-07-14 22:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08113"}, "ts": "2023-07-14 22:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08113", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:03:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17931"}, "ts": "2023-07-14 22:03:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34008862", "type": "PubMed"}, "ts": "2023-07-14 22:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34008862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:04:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U44"}, "ts": "2023-07-14 22:04:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515"}, "ts": "2023-07-14 22:04:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-14 22:04:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28476", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:04:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28476"}, "ts": "2023-07-14 22:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:04:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:04:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:04:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06643"}, "ts": "2023-07-14 22:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20929727", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:04:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20929727", "type": "PubMed"}, "ts": "2023-07-14 22:04:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UF12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:05:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UF12"}, "ts": "2023-07-14 22:05:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15118"}, "ts": "2023-07-14 22:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67809", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:07:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P67809"}, "ts": "2023-07-14 22:07:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33651882", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:08:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33651882", "type": "PubMed"}, "ts": "2023-07-14 22:08:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59598"}, "ts": "2023-07-14 22:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59598", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:08:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:08:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCK4"}, "ts": "2023-07-14 22:08:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:08:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81533KY"}, "ts": "2023-07-14 22:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81533KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:08:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81533KY"}, "ts": "2023-07-14 22:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76685HR"}, "ts": "2023-07-14 22:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99347TW"}, "ts": "2023-07-14 22:08:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-14 22:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:08:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q769K2"}, "ts": "2023-07-14 22:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q769K2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:09:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52907", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:10:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52907.160.160"}, "ts": "2023-07-14 22:10:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:10:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81533KY"}, "ts": "2023-07-14 22:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81533KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:11:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12821"}, "ts": "2023-07-14 22:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12821", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:11:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T4T1"}, "ts": "2023-07-14 22:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:11:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:13:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG78"}, "ts": "2023-07-14 22:13:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-14 22:13:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:13:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-14 22:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R007"}, "ts": "2023-07-14 22:14:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TR1"}, "ts": "2023-07-14 22:15:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42166.131.131"}, "ts": "2023-07-14 22:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42166", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:15:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RK0"}, "ts": "2023-07-14 22:16:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:16:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2H2.593.593"}, "ts": "2023-07-14 22:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2H2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:16:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30982744", "type": "PubMed"}, "ts": "2023-07-14 22:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30982744", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275"}, "ts": "2023-07-14 22:16:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-14 22:17:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15311", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:18:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15311"}, "ts": "2023-07-14 22:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10085131", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:18:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10085131", "type": "PubMed"}, "ts": "2023-07-14 22:18:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20398921", "type": "PubMed"}, "ts": "2023-07-14 22:18:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20398921", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:18:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PAL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:18:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98191-1"}, "ts": "2023-07-14 22:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98191-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:18:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX15"}, "ts": "2023-07-14 22:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PAL1"}, "ts": "2023-07-14 22:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28660"}, "ts": "2023-07-14 22:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10425SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63096"}, "ts": "2023-07-14 22:20:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-14 22:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-14 22:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29391"}, "ts": "2023-07-14 22:21:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29391"}, "ts": "2023-07-14 22:21:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDG4"}, "ts": "2023-07-14 22:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:22:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZZC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZZC9"}, "ts": "2023-07-14 22:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:22:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-14 22:22:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:22:47 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-14 22:23:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15407YE"}, "ts": "2023-07-14 22:24:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-14 22:24:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07237"}, "ts": "2023-07-14 22:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 22:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70SY1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:26:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q70SY1.101.101"}, "ts": "2023-07-14 22:26:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AF73", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:26:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AF73"}, "ts": "2023-07-14 22:26:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-14 22:26:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJW2.225.225"}, "ts": "2023-07-14 22:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJW2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11349134", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:27:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11349134", "type": "PubMed"}, "ts": "2023-07-14 22:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:28:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC07"}, "ts": "2023-07-14 22:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q4Z2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:28:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q4Z2"}, "ts": "2023-07-14 22:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2G1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:28:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2G1"}, "ts": "2023-07-14 22:28:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10696", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:28:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10696"}, "ts": "2023-07-14 22:28:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01009", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:29:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01009"}, "ts": "2023-07-14 22:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95072-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:29:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95072-1"}, "ts": "2023-07-14 22:29:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12093919", "type": "PubMed"}, "ts": "2023-07-14 22:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12093919", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51907", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:29:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51907.521.521"}, "ts": "2023-07-14 22:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14392", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:30:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14392.203.203"}, "ts": "2023-07-14 22:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:30:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08431"}, "ts": "2023-07-14 22:30:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY65"}, "ts": "2023-07-14 22:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54923", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:30:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54923"}, "ts": "2023-07-14 22:30:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34056"}, "ts": "2023-07-14 22:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34056", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:30:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20686522", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:30:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20686522", "type": "PubMed"}, "ts": "2023-07-14 22:30:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43638"}, "ts": "2023-07-14 22:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43638", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:30:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9711874", "type": "PubMed"}, "ts": "2023-07-14 22:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9711874", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:30:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCM1"}, "ts": "2023-07-14 22:30:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40424"}, "ts": "2023-07-14 22:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0U6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:31:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MD8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:31:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99MD8"}, "ts": "2023-07-14 22:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:31:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "29395496"}, "ts": "2023-07-14 22:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 22:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:32:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P57052.245.245"}, "ts": "2023-07-14 22:32:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-14 22:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G44211QA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53680"}, "ts": "2023-07-14 22:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJN8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:33:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G44211QA"}, "ts": "2023-07-14 22:33:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJN8-1"}, "ts": "2023-07-14 22:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12207932", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:33:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12207932", "type": "PubMed"}, "ts": "2023-07-14 22:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:33:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924L1"}, "ts": "2023-07-14 22:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:33:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12907"}, "ts": "2023-07-14 22:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:34:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPU6"}, "ts": "2023-07-14 22:34:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14759560", "type": "PubMed"}, "ts": "2023-07-14 22:34:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14759560", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:34:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-14 22:34:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29317"}, "ts": "2023-07-14 22:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPU6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:34:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RJK8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5RJK8"}, "ts": "2023-07-14 22:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9Z8"}, "ts": "2023-07-14 22:35:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9Z8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95817", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:35:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95817.562.562"}, "ts": "2023-07-14 22:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM22"}, "ts": "2023-07-14 22:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHY7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHY7"}, "ts": "2023-07-14 22:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYF1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:36:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYF1-1"}, "ts": "2023-07-14 22:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:36:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30531.591.591"}, "ts": "2023-07-14 22:36:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY25"}, "ts": "2023-07-14 22:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:36:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97570"}, "ts": "2023-07-14 22:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97570", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01484", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P91645", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P91645"}, "ts": "2023-07-14 22:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGI6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 22:37:16 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UGI6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 22:37:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14920-1"}, "ts": "2023-07-14 22:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:37:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13637"}, "ts": "2023-07-14 22:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14920-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19631610", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:37:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19631610", "type": "PubMed"}, "ts": "2023-07-14 22:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:37:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03001", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:37:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03001.42.42"}, "ts": "2023-07-14 22:37:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01484"}, "ts": "2023-07-14 22:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CC6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:38:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CC6"}, "ts": "2023-07-14 22:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:38:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT76"}, "ts": "2023-07-14 22:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01780", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:38:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01780"}, "ts": "2023-07-14 22:38:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9121482", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:39:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9121482", "type": "PubMed"}, "ts": "2023-07-14 22:39:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18005679", "type": "PubMed"}, "ts": "2023-07-14 22:39:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18005679", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:39:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49748"}, "ts": "2023-07-14 22:39:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11163210", "type": "PubMed"}, "ts": "2023-07-14 22:39:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11163210", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20002496", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:40:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20002496", "type": "PubMed"}, "ts": "2023-07-14 22:40:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95071.23.23"}, "ts": "2023-07-14 22:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95071", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15407YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73004SD", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:40:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "G73004SD.2330.2330"}, "ts": "2023-07-14 22:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73004SD", "user": "Undecided", "type": "error", "page": "Siteview", "message": "Network error. Site Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 22:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:40:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-14 22:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49790", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:41:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-14 22:41:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13500.69.69"}, "ts": "2023-07-14 22:41:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49790"}, "ts": "2023-07-14 22:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13500", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:41:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28476"}, "ts": "2023-07-14 22:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28476", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99J85", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:42:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F6TUL9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:42:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F6TUL9-1"}, "ts": "2023-07-14 22:42:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99J85"}, "ts": "2023-07-14 22:42:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:42:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-14 22:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWX6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:43:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21290RB"}, "ts": "2023-07-14 22:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 22:43:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWX6"}, "ts": "2023-07-14 22:43:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20391ZE"}, "ts": "2023-07-14 22:43:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03838OG"}, "ts": "2023-07-14 22:43:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21290RB"}, "ts": "2023-07-14 22:43:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06042JP"}, "ts": "2023-07-14 22:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YR3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:43:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80YR3"}, "ts": "2023-07-14 22:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PK18"}, "ts": "2023-07-14 22:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBQ6"}, "ts": "2023-07-14 22:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:43:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54849"}, "ts": "2023-07-14 22:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-14 22:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07998"}, "ts": "2023-07-14 22:43:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPT6.563.563"}, "ts": "2023-07-14 22:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPT6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:44:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32004.671.671"}, "ts": "2023-07-14 22:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32004", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:44:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BWG8"}, "ts": "2023-07-14 22:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BWG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:44:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-14 22:44:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBV2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:45:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBV2.31.31"}, "ts": "2023-07-14 22:45:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JVZ2"}, "ts": "2023-07-14 22:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JVZ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:45:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UL3.53.53"}, "ts": "2023-07-14 22:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:46:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "23349634"}, "ts": "2023-07-14 22:46:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZY8"}, "ts": "2023-07-14 22:46:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYZ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYZ4"}, "ts": "2023-07-14 22:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01859", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:46:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01859.106.106"}, "ts": "2023-07-14 22:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:46:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Y2E6"}, "ts": "2023-07-14 22:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Y2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:46:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:46:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12931.556.556"}, "ts": "2023-07-14 22:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12931", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76094", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:47:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76094"}, "ts": "2023-07-14 22:47:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQ92"}, "ts": "2023-07-14 22:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:47:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBV8.38.38"}, "ts": "2023-07-14 22:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:47:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-14 22:48:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQ92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:48:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZP93"}, "ts": "2023-07-14 22:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZP93", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-14 22:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3T4-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 22:48:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8K3T4-1", "cluster_type": "unselected"}, "ts": "2023-07-14 22:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3T4-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 22:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:48:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13507"}, "ts": "2023-07-14 22:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7J9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 22:48:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q7Z7J9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 22:48:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7J9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-14 22:48:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-14 22:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:50:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32929.5.5"}, "ts": "2023-07-14 22:50:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32929", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:50:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-14 22:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1478675", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:51:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1478675", "type": "PubMed"}, "ts": "2023-07-14 22:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PD6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 22:51:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PD6"}, "ts": "2023-07-14 22:51:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-14 22:52:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20863"}, "ts": "2023-07-14 22:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 22:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCG1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 22:52:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8TCG1", "cluster_type": "unselected"}, "ts": "2023-07-14 22:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCG1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-14 22:52:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20863"}, "ts": "2023-07-14 22:52:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12917326", "type": "PubMed"}, "ts": "2023-07-14 22:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12917326", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:53:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54132"}, "ts": "2023-07-14 22:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14868", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14868"}, "ts": "2023-07-14 22:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22695"}, "ts": "2023-07-14 22:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16585200", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:54:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16585200", "type": "PubMed"}, "ts": "2023-07-14 22:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:55:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22695"}, "ts": "2023-07-14 22:55:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNB7"}, "ts": "2023-07-14 22:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P218", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:55:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P218.49.49"}, "ts": "2023-07-14 22:55:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-14 22:55:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-14 22:55:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61699", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 22:55:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61699.510.510"}, "ts": "2023-07-14 22:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31930", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:55:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31930"}, "ts": "2023-07-14 22:55:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LYX9"}, "ts": "2023-07-14 22:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LYX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:56:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-14 22:56:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16131492", "type": "PubMed"}, "ts": "2023-07-14 22:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16131492", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "index.html", "message": "page access"}, "ts": "2023-07-14 22:57:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50053", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:57:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50053"}, "ts": "2023-07-14 22:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:57:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPR5"}, "ts": "2023-07-14 22:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPR5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:57:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31639"}, "ts": "2023-07-14 22:57:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-14 22:57:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYE9"}, "ts": "2023-07-14 22:58:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:58:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LTX8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:58:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LTX8-1"}, "ts": "2023-07-14 22:58:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75795"}, "ts": "2023-07-14 22:58:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75795", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:58:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30459171", "type": "PubMed"}, "ts": "2023-07-14 22:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30459171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 22:58:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-14 22:59:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYM4"}, "ts": "2023-07-14 22:59:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:59:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27947YN"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17015OC"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23729WG"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29063QY"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30190ML"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35029YA"}, "ts": "2023-07-14 22:59:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36670VW"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40740AD"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57317CE"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59626AS"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62595EF"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-14 22:59:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14920-1"}, "ts": "2023-07-14 22:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14920-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 22:59:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-14 23:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-14 23:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-14 23:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-14 23:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-14 23:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-14 23:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16706.808.808"}, "ts": "2023-07-14 23:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16706", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27391WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11278523", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:00:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11278523", "type": "PubMed"}, "ts": "2023-07-14 23:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-14 23:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:01:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36414FS"}, "ts": "2023-07-14 23:01:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-14 23:01:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-14 23:01:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6R6"}, "ts": "2023-07-14 23:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:01:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06702"}, "ts": "2023-07-14 23:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:02:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751"}, "ts": "2023-07-14 23:02:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88713"}, "ts": "2023-07-14 23:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88713", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:02:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15878"}, "ts": "2023-07-14 23:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15878", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2U1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:03:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2U1.847.847"}, "ts": "2023-07-14 23:03:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07477"}, "ts": "2023-07-14 23:03:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-14 23:03:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8052307", "type": "PubMed"}, "ts": "2023-07-14 23:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8052307", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DME0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:04:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DME0"}, "ts": "2023-07-14 23:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:05:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17287340", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:05:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17287340", "type": "PubMed"}, "ts": "2023-07-14 23:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHL4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:06:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHL4-1"}, "ts": "2023-07-14 23:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:07:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-14 23:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23435", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:07:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23435"}, "ts": "2023-07-14 23:07:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14166.238.238"}, "ts": "2023-07-14 23:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14166", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69ZI1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:07:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69ZI1-1"}, "ts": "2023-07-14 23:07:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KR82"}, "ts": "2023-07-14 23:07:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KR82", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:07:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 23:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 23:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 23:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23467", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:08:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23467.1163.1163"}, "ts": "2023-07-14 23:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5J3F6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5J3F6"}, "ts": "2023-07-14 23:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60866-1"}, "ts": "2023-07-14 23:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60866-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:08:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSI4"}, "ts": "2023-07-14 23:08:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:08:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:08:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HK5"}, "ts": "2023-07-14 23:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20863", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20863", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62306", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:09:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62306"}, "ts": "2023-07-14 23:09:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:09:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02628JF"}, "ts": "2023-07-14 23:10:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61191"}, "ts": "2023-07-14 23:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61191", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-14 23:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:11:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-14 23:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:11:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19415009", "type": "PubMed"}, "ts": "2023-07-14 23:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19415009", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:11:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75027"}, "ts": "2023-07-14 23:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:12:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-14 23:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N138", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:14:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N138.146.146"}, "ts": "2023-07-14 23:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93091", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:14:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93091"}, "ts": "2023-07-14 23:14:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-14 23:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N983", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 23:14:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8N983", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 23:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:15:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-14 23:15:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01024-1.939.939"}, "ts": "2023-07-14 23:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01024-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:15:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWR8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:15:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWR8"}, "ts": "2023-07-14 23:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17809-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 23:15:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P17809-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 23:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96028-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:15:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O96028-1.310.310"}, "ts": "2023-07-14 23:15:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1K0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:15:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1K0.583.583"}, "ts": "2023-07-14 23:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EP82-1"}, "ts": "2023-07-14 23:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP82-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:15:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:16:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95390"}, "ts": "2023-07-14 23:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11562357", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:16:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11562357", "type": "PubMed"}, "ts": "2023-07-14 23:16:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60981-1"}, "ts": "2023-07-14 23:16:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:16:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan_search.html", "message": "page access"}, "ts": "2023-07-14 23:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24644286", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:17:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24644286", "type": "PubMed"}, "ts": "2023-07-14 23:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52801", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:17:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52801"}, "ts": "2023-07-14 23:17:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31626376", "type": "PubMed"}, "ts": "2023-07-14 23:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31626376", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06702", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:18:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NWZ5.53.53"}, "ts": "2023-07-14 23:18:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWZ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:18:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-14 23:19:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7-1"}, "ts": "2023-07-14 23:20:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q61818", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 23:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61818", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 23:20:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55735"}, "ts": "2023-07-14 23:21:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15003", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:21:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15003"}, "ts": "2023-07-14 23:21:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15287722", "type": "PubMed"}, "ts": "2023-07-14 23:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15287722", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VW38", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:22:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VW38.493.493"}, "ts": "2023-07-14 23:22:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKL3.875.875"}, "ts": "2023-07-14 23:22:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:22:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-14 23:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:23:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60706"}, "ts": "2023-07-14 23:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60706", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22241472", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:23:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22241472", "type": "PubMed"}, "ts": "2023-07-14 23:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCE2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:24:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NCE2.530.530"}, "ts": "2023-07-14 23:24:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JMI9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:24:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JMI9-1"}, "ts": "2023-07-14 23:24:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8E2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:25:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8E2-1"}, "ts": "2023-07-14 23:25:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99698", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:26:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99698.1189.1189"}, "ts": "2023-07-14 23:26:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-14 23:26:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8C156.25.25"}, "ts": "2023-07-14 23:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C156", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:26:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y546"}, "ts": "2023-07-14 23:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-14 23:26:52 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-14 23:26:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2YDW2-1"}, "ts": "2023-07-14 23:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2YDW2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAW7"}, "ts": "2023-07-14 23:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18846", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:27:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18846.221.221"}, "ts": "2023-07-14 23:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0M6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:27:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0M6"}, "ts": "2023-07-14 23:27:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:28:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-14 23:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493-1"}, "ts": "2023-07-14 23:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:30:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-14 23:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UND0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:30:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UND0.197.197"}, "ts": "2023-07-14 23:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:31:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15643"}, "ts": "2023-07-14 23:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MV1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:32:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MV1"}, "ts": "2023-07-14 23:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXT5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:32:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXT5"}, "ts": "2023-07-14 23:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:33:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20264.325.325"}, "ts": "2023-07-14 23:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7597030", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:34:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7597030", "type": "PubMed"}, "ts": "2023-07-14 23:34:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-14 23:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80WM5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:35:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80WM5"}, "ts": "2023-07-14 23:35:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21390062", "type": "PubMed"}, "ts": "2023-07-14 23:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21390062", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:35:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PK18"}, "ts": "2023-07-14 23:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-14 23:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20489-1"}, "ts": "2023-07-14 23:36:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969D9-1"}, "ts": "2023-07-14 23:36:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969D9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:36:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWB6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:36:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWB6.627.627"}, "ts": "2023-07-14 23:36:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z407.346.346"}, "ts": "2023-07-14 23:37:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z407", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:37:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-14 23:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:37:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P31042", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-14 23:37:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279"}, "ts": "2023-07-14 23:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31042", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-14 23:37:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924M7"}, "ts": "2023-07-14 23:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924M7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:37:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10624965", "type": "PubMed"}, "ts": "2023-07-14 23:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10624965", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:37:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TLR7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TLR7"}, "ts": "2023-07-14 23:38:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-14 23:38:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14980"}, "ts": "2023-07-14 23:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:39:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:40:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-14 23:40:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22863785", "type": "PubMed"}, "ts": "2023-07-14 23:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22863785", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11746050", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:41:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11746050", "type": "PubMed"}, "ts": "2023-07-14 23:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:41:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03135.14.14"}, "ts": "2023-07-14 23:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04179"}, "ts": "2023-07-14 23:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04179", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:42:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-14 23:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96028-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:44:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O96028-1.310.310"}, "ts": "2023-07-14 23:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22732"}, "ts": "2023-07-14 23:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:45:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:45:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11247"}, "ts": "2023-07-14 23:45:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34611256", "type": "PubMed"}, "ts": "2023-07-14 23:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34611256", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-14 23:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:47:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1Q3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:47:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1Q3-1"}, "ts": "2023-07-14 23:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:48:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05121.288.288"}, "ts": "2023-07-14 23:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:48:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51124.24.24"}, "ts": "2023-07-14 23:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51124", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:48:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHR9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:48:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHR9"}, "ts": "2023-07-14 23:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P055", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:49:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P055"}, "ts": "2023-07-14 23:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q29980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:49:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q29980"}, "ts": "2023-07-14 23:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:49:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14766.1168.1168"}, "ts": "2023-07-14 23:49:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L4E1"}, "ts": "2023-07-14 23:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L4E1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:50:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37231"}, "ts": "2023-07-14 23:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZT2"}, "ts": "2023-07-14 23:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14247"}, "ts": "2023-07-14 23:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:53:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08857-1"}, "ts": "2023-07-14 23:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99805"}, "ts": "2023-07-14 23:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4S2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:54:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4S2"}, "ts": "2023-07-14 23:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:55:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY15"}, "ts": "2023-07-14 23:55:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUU9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUU9"}, "ts": "2023-07-14 23:55:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ5"}, "ts": "2023-07-14 23:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01614ZM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08047"}, "ts": "2023-07-14 23:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:56:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4G6"}, "ts": "2023-07-14 23:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4G6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:56:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-14 23:57:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2R7"}, "ts": "2023-07-14 23:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49790", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-14 23:57:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49790.182.182"}, "ts": "2023-07-14 23:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-14 23:57:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-14 23:58:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14625"}, "ts": "2023-07-14 23:58:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02815KT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q499M4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-14 23:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-14 23:58:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q499M4"}, "ts": "2023-07-14 23:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13627", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-14 23:58:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13627"}, "ts": "2023-07-14 23:58:37 EDT-0400"}]