[{"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 00:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 00:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 00:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 00:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 00:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 00:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10361"}, "ts": "2023-07-13 00:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:00:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-13 00:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16348", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:01:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16348.435.435"}, "ts": "2023-07-13 00:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47410OF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:01:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47410OF"}, "ts": "2023-07-13 00:01:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N461.1.1"}, "ts": "2023-07-13 00:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N461", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16348", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:01:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16348"}, "ts": "2023-07-13 00:01:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A140UHX6"}, "ts": "2023-07-13 00:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A140UHX6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SLC6A6", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:02:16 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SLC6A6"}, "ts": "2023-07-13 00:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SLC6A6", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SLC6A6"}, "ts": "2023-07-13 00:02:17 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5155298c7ce83aeede9f2fc5c5dba654", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:02:19 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "5155298c7ce83aeede9f2fc5c5dba654", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95897", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:02:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95897.77.77"}, "ts": "2023-07-13 00:02:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31641-1"}, "ts": "2023-07-13 00:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31641-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:02:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QE4"}, "ts": "2023-07-13 00:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:03:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SLC6A13", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:03:29 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SLC6A13"}, "ts": "2023-07-13 00:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SLC6A13", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SLC6A13"}, "ts": "2023-07-13 00:03:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:03:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "afc43263c5fdb0ba220a921e233aa6ae", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:03:31 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "afc43263c5fdb0ba220a921e233aa6ae", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:03:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:03:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSD5-1"}, "ts": "2023-07-13 00:03:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-13 00:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11577110", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:04:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11577110", "type": "PubMed"}, "ts": "2023-07-13 00:04:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N323"}, "ts": "2023-07-13 00:04:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N323", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ABCB6", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:04:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56574"}, "ts": "2023-07-13 00:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:04:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60602"}, "ts": "2023-07-13 00:04:30 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "ABCB6"}, "ts": "2023-07-13 00:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ABCB6", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=ABCB6"}, "ts": "2023-07-13 00:04:31 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12d01866511537ef6ab533499fcc5a49", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:04:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "12d01866511537ef6ab533499fcc5a49", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:04:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP58-1"}, "ts": "2023-07-13 00:04:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP58-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:04:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QV1"}, "ts": "2023-07-13 00:04:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QV1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:04:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 00:04:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15923-1"}, "ts": "2023-07-13 00:04:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15923-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:04:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97707"}, "ts": "2023-07-13 00:04:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7918467", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:04:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35083852", "type": "PubMed"}, "ts": "2023-07-13 00:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35083852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:05:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:05:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14207", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:05:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14207.554.554"}, "ts": "2023-07-13 00:05:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7918467", "type": "PubMed"}, "ts": "2023-07-13 00:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96577RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:05:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:05:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35499"}, "ts": "2023-07-13 00:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02311IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35499", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13241-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:06:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13241-1"}, "ts": "2023-07-13 00:06:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:06:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00747"}, "ts": "2023-07-13 00:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND94", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:06:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8ND94.212.212"}, "ts": "2023-07-13 00:06:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-13 00:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:06:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 00:06:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-13 00:06:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 00:06:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-13 00:06:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 00:06:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-13 00:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43915", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:07:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43915"}, "ts": "2023-07-13 00:07:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:07:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTW9"}, "ts": "2023-07-13 00:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16294", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:08:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16294.235.235"}, "ts": "2023-07-13 00:08:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-13 00:08:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00487", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:08:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00487.188.188"}, "ts": "2023-07-13 00:08:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23064873", "type": "PubMed"}, "ts": "2023-07-13 00:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23064873", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PEPT1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:08:59 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "PEPT1"}, "ts": "2023-07-13 00:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PEPT1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=PEPT1"}, "ts": "2023-07-13 00:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8cc74a80dd781745af7c7689f8bc0dc7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:09:01 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:09:01 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "8cc74a80dd781745af7c7689f8bc0dc7", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:09:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46059-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:09:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46059-1"}, "ts": "2023-07-13 00:09:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54840"}, "ts": "2023-07-13 00:09:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07900"}, "ts": "2023-07-13 00:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK42", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:10:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JK42"}, "ts": "2023-07-13 00:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75844", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75844"}, "ts": "2023-07-13 00:10:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11627.1107.1107"}, "ts": "2023-07-13 00:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11627", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:11:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:11:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618"}, "ts": "2023-07-13 00:11:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NX95.396.396"}, "ts": "2023-07-13 00:11:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX95", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:11:18 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:11:22 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "8cc74a80dd781745af7c7689f8bc0dc7", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8cc74a80dd781745af7c7689f8bc0dc7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:11:22 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "PEPT1"}, "ts": "2023-07-13 00:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PEPT1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=PEPT1"}, "ts": "2023-07-13 00:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP58-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:11:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP58-1"}, "ts": "2023-07-13 00:11:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26485758", "type": "PubMed"}, "ts": "2023-07-13 00:12:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-13 00:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26485758", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:12:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U28-1"}, "ts": "2023-07-13 00:12:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U28-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:12:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23979", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:12:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23979.190.190"}, "ts": "2023-07-13 00:12:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JLA3.1015.1015"}, "ts": "2023-07-13 00:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLA3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18089", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:12:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18089"}, "ts": "2023-07-13 00:12:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65562ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:13:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56817-1"}, "ts": "2023-07-13 00:13:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05937.174.174"}, "ts": "2023-07-13 00:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05937", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:13:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75688-1"}, "ts": "2023-07-13 00:14:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP58"}, "ts": "2023-07-13 00:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75688-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G97501MA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:14:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97501MA"}, "ts": "2023-07-13 00:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62834-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:14:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62834-1"}, "ts": "2023-07-13 00:14:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JTR4-1"}, "ts": "2023-07-13 00:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JTR4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:14:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61955"}, "ts": "2023-07-13 00:14:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61955", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9047384", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:15:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9047384", "type": "PubMed"}, "ts": "2023-07-13 00:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00587"}, "ts": "2023-07-13 00:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12d01866511537ef6ab533499fcc5a49", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:15:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13796.290.290"}, "ts": "2023-07-13 00:15:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:15:31 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "12d01866511537ef6ab533499fcc5a49", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13796", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:15:33 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "ABCB6"}, "ts": "2023-07-13 00:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ABCB6", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=ABCB6"}, "ts": "2023-07-13 00:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:15:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSD5-1"}, "ts": "2023-07-13 00:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30312703", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:16:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30312703", "type": "PubMed"}, "ts": "2023-07-13 00:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28733313", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:16:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28733313", "type": "PubMed"}, "ts": "2023-07-13 00:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28733313", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 00:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:16:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-13 00:16:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2L5.279.279"}, "ts": "2023-07-13 00:16:46 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:16:47 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "afc43263c5fdb0ba220a921e233aa6ae", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "afc43263c5fdb0ba220a921e233aa6ae", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2L5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:16:47 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "SLC6A13"}, "ts": "2023-07-13 00:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "SLC6A13", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=SLC6A13"}, "ts": "2023-07-13 00:16:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31641-1"}, "ts": "2023-07-13 00:16:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31641-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14047PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56VL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:17:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q56VL3.75.75"}, "ts": "2023-07-13 00:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62182OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:17:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-13 00:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:17:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEI7"}, "ts": "2023-07-13 00:17:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y3S1.1400.1400"}, "ts": "2023-07-13 00:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3S1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:18:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-13 00:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80920RR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP58-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:18:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP58-1"}, "ts": "2023-07-13 00:18:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-13 00:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:20:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:20:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75460"}, "ts": "2023-07-13 00:20:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13500"}, "ts": "2023-07-13 00:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:20:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "U3KPV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:20:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "U3KPV4"}, "ts": "2023-07-13 00:20:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17192266", "type": "PubMed"}, "ts": "2023-07-13 00:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17192266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:21:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17192266", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 00:21:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16665"}, "ts": "2023-07-13 00:21:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14521"}, "ts": "2023-07-13 00:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14521", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61043-3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61043-3"}, "ts": "2023-07-13 00:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-13 00:22:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20700-1"}, "ts": "2023-07-13 00:23:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:23:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04150"}, "ts": "2023-07-13 00:23:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04150", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:23:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-13 00:24:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12523936", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:25:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12523936", "type": "PubMed"}, "ts": "2023-07-13 00:25:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97321-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:25:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97321-1"}, "ts": "2023-07-13 00:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:25:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19793"}, "ts": "2023-07-13 00:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19793", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:25:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:25:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-13 00:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:26:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-13 00:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97708", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:26:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97708"}, "ts": "2023-07-13 00:26:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDY2.437.437"}, "ts": "2023-07-13 00:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDY2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:27:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75443", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75443"}, "ts": "2023-07-13 00:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97861", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:27:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97861"}, "ts": "2023-07-13 00:27:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:27:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43614.161.161"}, "ts": "2023-07-13 00:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43614", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJ48", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:27:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BJ48"}, "ts": "2023-07-13 00:27:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVM7"}, "ts": "2023-07-13 00:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVM7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:28:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T9"}, "ts": "2023-07-13 00:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:28:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8631787", "type": "PubMed"}, "ts": "2023-07-13 00:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8631787", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:28:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-13 00:29:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:29:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-13 00:29:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:29:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21723284", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:29:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21723284", "type": "PubMed"}, "ts": "2023-07-13 00:29:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61513"}, "ts": "2023-07-13 00:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-13 00:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "K9J7F4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:30:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "K9J7F4"}, "ts": "2023-07-13 00:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:30:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5"}, "ts": "2023-07-13 00:30:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-13 00:30:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92622", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:31:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92622"}, "ts": "2023-07-13 00:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ASQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:31:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2ASQ1.571.571"}, "ts": "2023-07-13 00:31:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LRJ8"}, "ts": "2023-07-13 00:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LRJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:32:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA4"}, "ts": "2023-07-13 00:32:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-13 00:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ALAD", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:32:23 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "ALAD"}, "ts": "2023-07-13 00:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ALAD", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=ALAD"}, "ts": "2023-07-13 00:32:24 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8c3f09e096a6bf64a8da2adc0a182933", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:32:25 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "8c3f09e096a6bf64a8da2adc0a182933", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:32:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13716-1"}, "ts": "2023-07-13 00:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13716-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:32:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:32:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDU6.237.237"}, "ts": "2023-07-13 00:32:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12665513", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:34:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12665513", "type": "PubMed"}, "ts": "2023-07-13 00:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:34:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYQ5"}, "ts": "2023-07-13 00:34:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24700572", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:35:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24700572", "type": "PubMed"}, "ts": "2023-07-13 00:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PBGD", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:35:30 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "PBGD"}, "ts": "2023-07-13 00:35:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PBGD", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=PBGD"}, "ts": "2023-07-13 00:35:31 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d602bdba5442a428bf105f1447ade26b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:35:34 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d602bdba5442a428bf105f1447ade26b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "UROS", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-13 00:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:35:56 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "UROS"}, "ts": "2023-07-13 00:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "UROS", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=UROS"}, "ts": "2023-07-13 00:35:57 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d530aaa256b445cff58a147d9074805e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:35:59 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d530aaa256b445cff58a147d9074805e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:35:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10746-1"}, "ts": "2023-07-13 00:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10746-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:36:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13500", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "UROD", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:36:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:36:46 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "UROD"}, "ts": "2023-07-13 00:36:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "UROD", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=UROD"}, "ts": "2023-07-13 00:36:47 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b9a4abfbd61e89159df83949fa816bb9", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:36:51 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b9a4abfbd61e89159df83949fa816bb9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06132-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06132-1"}, "ts": "2023-07-13 00:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-13 00:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16665", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:37:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-13 00:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-13 00:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CPOX", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 00:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 00:38:06 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "CPOX"}, "ts": "2023-07-13 00:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CPOX", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=CPOX"}, "ts": "2023-07-13 00:38:06 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 00:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f5d7031c9f9cfef711fbe4f53171c1a", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 00:38:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3f5d7031c9f9cfef711fbe4f53171c1a", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 00:38:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36551-1"}, "ts": "2023-07-13 00:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36551-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:38:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-13 00:38:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-13 00:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-13 00:38:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FK6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:39:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FK6-1"}, "ts": "2023-07-13 00:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "static", "message": "page access"}, "ts": "2023-07-13 00:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20700-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88454"}, "ts": "2023-07-13 00:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02545", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:39:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02545.603.603"}, "ts": "2023-07-13 00:39:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:39:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43121"}, "ts": "2023-07-13 00:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7H5"}, "ts": "2023-07-13 00:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:40:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13315"}, "ts": "2023-07-13 00:40:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27694"}, "ts": "2023-07-13 00:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27694", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00156-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-13 00:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-13 00:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13637"}, "ts": "2023-07-13 00:41:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14921"}, "ts": "2023-07-13 00:42:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43252"}, "ts": "2023-07-13 00:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H773", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H773"}, "ts": "2023-07-13 00:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-13 00:43:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01583", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:46:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31949"}, "ts": "2023-07-13 00:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:46:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TP1"}, "ts": "2023-07-13 00:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:48:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:49:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZL4"}, "ts": "2023-07-13 00:49:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:50:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H792"}, "ts": "2023-07-13 00:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:51:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21673.98.98"}, "ts": "2023-07-13 00:51:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38532-1"}, "ts": "2023-07-13 00:51:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38532-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:51:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNG2"}, "ts": "2023-07-13 00:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58173"}, "ts": "2023-07-13 00:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18550849", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:53:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18550849", "type": "PubMed"}, "ts": "2023-07-13 00:53:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23763432", "type": "PubMed"}, "ts": "2023-07-13 00:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23763432", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LV01-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:53:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LV01-1"}, "ts": "2023-07-13 00:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07483YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUP2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:53:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WUP2.193.193"}, "ts": "2023-07-13 00:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:53:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:54:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24642916", "type": "PubMed"}, "ts": "2023-07-13 00:54:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24642916", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:54:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45187EI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 00:54:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45187EI"}, "ts": "2023-07-13 00:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46821", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:55:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46821.1275.1275"}, "ts": "2023-07-13 00:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24373353", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:55:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24373353", "type": "PubMed"}, "ts": "2023-07-13 00:55:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-13 00:55:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-13 00:55:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QG7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:56:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QG7"}, "ts": "2023-07-13 00:56:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13315", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:56:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00896-1"}, "ts": "2023-07-13 00:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00896-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:57:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395-1"}, "ts": "2023-07-13 00:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43491", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 00:58:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43491.930.930"}, "ts": "2023-07-13 00:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95816", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:58:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95816"}, "ts": "2023-07-13 00:58:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:58:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27246854", "type": "PubMed"}, "ts": "2023-07-13 00:59:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27246854", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 00:59:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5RJK0"}, "ts": "2023-07-13 00:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RJK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50990-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 00:59:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50990-1"}, "ts": "2023-07-13 00:59:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52624", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 00:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52624"}, "ts": "2023-07-13 00:59:49 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 01:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 01:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 01:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 01:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 01:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 01:00:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9759503", "type": "PubMed"}, "ts": "2023-07-13 01:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02765", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9759503", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:00:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02765.138.138"}, "ts": "2023-07-13 01:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14697522", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:00:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14697522", "type": "PubMed"}, "ts": "2023-07-13 01:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92561", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:00:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92561"}, "ts": "2023-07-13 01:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 01:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEK3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 01:00:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8TEK3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 01:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10640429", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:01:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10640429", "type": "PubMed"}, "ts": "2023-07-13 01:01:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14859.259.259"}, "ts": "2023-07-13 01:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:01:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26766444", "type": "PubMed"}, "ts": "2023-07-13 01:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26766444", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:01:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N187"}, "ts": "2023-07-13 01:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N187", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:02:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:02:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03999"}, "ts": "2023-07-13 01:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03999", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:02:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGP5"}, "ts": "2023-07-13 01:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:02:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DPH9"}, "ts": "2023-07-13 01:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29301984", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:02:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29301984", "type": "PubMed"}, "ts": "2023-07-13 01:02:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04264"}, "ts": "2023-07-13 01:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11243879", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:02:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11243879", "type": "PubMed"}, "ts": "2023-07-13 01:02:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11243879", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 01:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26245371", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:02:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26245371", "type": "PubMed"}, "ts": "2023-07-13 01:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B9EKR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:03:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B9EKR1"}, "ts": "2023-07-13 01:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:03:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01959.50.50"}, "ts": "2023-07-13 01:03:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IE24", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:03:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IE24"}, "ts": "2023-07-13 01:04:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8G8"}, "ts": "2023-07-13 01:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:04:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32243.220.220"}, "ts": "2023-07-13 01:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32243", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:04:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11497.23.23"}, "ts": "2023-07-13 01:05:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29054545", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:05:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29054545", "type": "PubMed"}, "ts": "2023-07-13 01:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53SF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:05:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53SF7"}, "ts": "2023-07-13 01:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55042", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:05:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55042"}, "ts": "2023-07-13 01:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DCA0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:06:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6DCA0.114.114"}, "ts": "2023-07-13 01:06:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-13 01:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22231912", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:06:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22231912", "type": "PubMed"}, "ts": "2023-07-13 01:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:06:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07205"}, "ts": "2023-07-13 01:06:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15260970", "type": "PubMed"}, "ts": "2023-07-13 01:06:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15260970", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:06:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 01:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20857263", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:07:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20857263", "type": "PubMed"}, "ts": "2023-07-13 01:07:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9516461", "type": "PubMed"}, "ts": "2023-07-13 01:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9516461", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8826984", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:09:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8826984", "type": "PubMed"}, "ts": "2023-07-13 01:09:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34255748", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:09:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34255748", "type": "PubMed"}, "ts": "2023-07-13 01:09:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34255748", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 01:09:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:09:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 01:09:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 01:09:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 01:09:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 01:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93400AK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:09:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93400AK"}, "ts": "2023-07-13 01:09:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93400AK"}, "ts": "2023-07-13 01:09:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66961AE"}, "ts": "2023-07-13 01:09:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-13 01:09:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-13 01:09:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67615UY"}, "ts": "2023-07-13 01:09:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31277KS"}, "ts": "2023-07-13 01:09:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-13 01:09:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97321-1"}, "ts": "2023-07-13 01:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97321-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:10:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19415658", "type": "PubMed"}, "ts": "2023-07-13 01:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19415658", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:10:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:10:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DPF3"}, "ts": "2023-07-13 01:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:10:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQJ9"}, "ts": "2023-07-13 01:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQJ9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:10:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2454582", "type": "PubMed"}, "ts": "2023-07-13 01:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2454582", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:10:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15911"}, "ts": "2023-07-13 01:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15911", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:10:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98168", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:10:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98168.29.29"}, "ts": "2023-07-13 01:10:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-13 01:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:11:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2454154", "type": "PubMed"}, "ts": "2023-07-13 01:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2454154", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54198", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:11:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54198.161.161"}, "ts": "2023-07-13 01:11:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26000482", "type": "PubMed"}, "ts": "2023-07-13 01:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26000482", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:11:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49174JP"}, "ts": "2023-07-13 01:11:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30873.48.48"}, "ts": "2023-07-13 01:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30873", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:12:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NXL6.84.84"}, "ts": "2023-07-13 01:12:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NS65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:12:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NS65"}, "ts": "2023-07-13 01:12:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10321", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:12:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10321"}, "ts": "2023-07-13 01:12:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXW3"}, "ts": "2023-07-13 01:12:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGF4"}, "ts": "2023-07-13 01:12:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGF4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:13:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15195140", "type": "PubMed"}, "ts": "2023-07-13 01:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15195140", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:13:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75027.466.466"}, "ts": "2023-07-13 01:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19812368", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:13:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19812368", "type": "PubMed"}, "ts": "2023-07-13 01:13:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00469.547.547"}, "ts": "2023-07-13 01:14:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00469", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:14:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHX9"}, "ts": "2023-07-13 01:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:14:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-13 01:14:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTR1"}, "ts": "2023-07-13 01:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G0M1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:14:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4G0M1.243.243"}, "ts": "2023-07-13 01:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64010", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:15:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q64010.221.221"}, "ts": "2023-07-13 01:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAY6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:15:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAY6"}, "ts": "2023-07-13 01:15:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIE5"}, "ts": "2023-07-13 01:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:16:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34887361", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:16:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34887361", "type": "PubMed"}, "ts": "2023-07-13 01:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1727547", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:16:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1727547", "type": "PubMed"}, "ts": "2023-07-13 01:16:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRL3.276.276"}, "ts": "2023-07-13 01:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXX0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:17:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXX0.850.850"}, "ts": "2023-07-13 01:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42704", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 01:17:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P42704", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 01:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20033", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20033"}, "ts": "2023-07-13 01:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:17:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27487"}, "ts": "2023-07-13 01:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22893-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:17:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22893-1"}, "ts": "2023-07-13 01:17:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10716"}, "ts": "2023-07-13 01:17:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BN82"}, "ts": "2023-07-13 01:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BN82", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19879271", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:18:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19879271", "type": "PubMed"}, "ts": "2023-07-13 01:18:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:18:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14842", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:18:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14842"}, "ts": "2023-07-13 01:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09106", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:18:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09106"}, "ts": "2023-07-13 01:18:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10944187", "type": "PubMed"}, "ts": "2023-07-13 01:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10944187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70333", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:18:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70333"}, "ts": "2023-07-13 01:19:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13740"}, "ts": "2023-07-13 01:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13740", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H943"}, "ts": "2023-07-13 01:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:19:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62484"}, "ts": "2023-07-13 01:19:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12023"}, "ts": "2023-07-13 01:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:20:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55186"}, "ts": "2023-07-13 01:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZT9"}, "ts": "2023-07-13 01:20:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24534"}, "ts": "2023-07-13 01:21:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:21:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24534", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:21:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24534", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:21:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24534"}, "ts": "2023-07-13 01:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG87-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG87-1"}, "ts": "2023-07-13 01:21:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30573454", "type": "PubMed"}, "ts": "2023-07-13 01:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30573454", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:22:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14047MI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:22:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047MI"}, "ts": "2023-07-13 01:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:23:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-13 01:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NHG9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:23:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NHG9.17.17"}, "ts": "2023-07-13 01:23:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7F0"}, "ts": "2023-07-13 01:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7F0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:23:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ8-1"}, "ts": "2023-07-13 01:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63068", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:24:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63068.14.14"}, "ts": "2023-07-13 01:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 01:24:23 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 01:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 01:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Tsc2", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-13 01:24:28 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Tsc2"}, "ts": "2023-07-13 01:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Tsc2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Tsc2"}, "ts": "2023-07-13 01:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:24:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "bb4f565800de82eba702fad2dc5f1a69", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:24:33 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "bb4f565800de82eba702fad2dc5f1a69", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61037-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61037-1"}, "ts": "2023-07-13 01:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49815-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:24:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49815-1"}, "ts": "2023-07-13 01:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:24:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23819.370.370"}, "ts": "2023-07-13 01:24:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 01:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:24:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMR3"}, "ts": "2023-07-13 01:25:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JHX3.104.104"}, "ts": "2023-07-13 01:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHX3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:25:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14439.448.448"}, "ts": "2023-07-13 01:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV13", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:25:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV13"}, "ts": "2023-07-13 01:25:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPF4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:25:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPF4"}, "ts": "2023-07-13 01:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29965", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:26:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29965"}, "ts": "2023-07-13 01:26:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-13 01:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:26:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYQ6"}, "ts": "2023-07-13 01:26:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:26:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 01:27:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 01:27:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-13 01:27:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70822IO"}, "ts": "2023-07-13 01:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KN2"}, "ts": "2023-07-13 01:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tsc1", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-13 01:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:27:19 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "tsc1"}, "ts": "2023-07-13 01:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tsc1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=tsc1"}, "ts": "2023-07-13 01:27:19 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30988f546ffe0d4335ec4165db0cf16e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:27:22 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "30988f546ffe0d4335ec4165db0cf16e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:27:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92574-1"}, "ts": "2023-07-13 01:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92574-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP53-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EP53-1"}, "ts": "2023-07-13 01:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:27:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTY9.305.305"}, "ts": "2023-07-13 01:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BPM0-1"}, "ts": "2023-07-13 01:27:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTY9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BPM0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:27:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 01:27:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07288-1.69.69"}, "ts": "2023-07-13 01:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07288-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:27:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68D06.642.642"}, "ts": "2023-07-13 01:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68D06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:27:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:27:54 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "tsc1"}, "ts": "2023-07-13 01:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tsc1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=tsc1"}, "ts": "2023-07-13 01:27:55 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30988f546ffe0d4335ec4165db0cf16e", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:27:56 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "30988f546ffe0d4335ec4165db0cf16e", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP53-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:28:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EP53-1"}, "ts": "2023-07-13 01:28:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92574-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:28:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92574-1"}, "ts": "2023-07-13 01:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tsc2", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-13 01:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:28:15 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "tsc2"}, "ts": "2023-07-13 01:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "tsc2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=tsc2"}, "ts": "2023-07-13 01:28:15 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "682426ea52caf1c0b688400965172994", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:28:16 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "682426ea52caf1c0b688400965172994", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22645316", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22645316", "type": "PubMed"}, "ts": "2023-07-13 01:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22645316", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22645316", "type": "PubMed"}, "ts": "2023-07-13 01:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22517741", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22517741", "type": "PubMed"}, "ts": "2023-07-13 01:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32848054", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:28:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32848054", "type": "PubMed"}, "ts": "2023-07-13 01:28:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:29:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4A3"}, "ts": "2023-07-13 01:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987-1"}, "ts": "2023-07-13 01:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:30:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34321562", "type": "PubMed"}, "ts": "2023-07-13 01:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34321562", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:30:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:30:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29122.259.259"}, "ts": "2023-07-13 01:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A286YDK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:31:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A286YDK0"}, "ts": "2023-07-13 01:31:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIG8-1"}, "ts": "2023-07-13 01:31:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIG8-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 01:31:50 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 01:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 01:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:31:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16082"}, "ts": "2023-07-13 01:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Tbc1d7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-13 01:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:32:37 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Tbc1d7"}, "ts": "2023-07-13 01:32:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:32:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Tbc1d7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Tbc1d7"}, "ts": "2023-07-13 01:32:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HZK1-1"}, "ts": "2023-07-13 01:32:38 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f752d9a3a41c388a605105ffb58a2024", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:32:42 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "f752d9a3a41c388a605105ffb58a2024", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:32:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-13 01:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HZK1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:32:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0N9-1"}, "ts": "2023-07-13 01:32:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0N9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:32:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0K0-1"}, "ts": "2023-07-13 01:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0K0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:32:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:32:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Pdk1", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-13 01:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:33:12 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Pdk1"}, "ts": "2023-07-13 01:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Pdk1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Pdk1"}, "ts": "2023-07-13 01:33:13 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:33:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "356c8bf74bd469bce8234e4123e2f54c", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:33:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "356c8bf74bd469bce8234e4123e2f54c", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:33:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15118-1"}, "ts": "2023-07-13 01:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFP9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:33:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFP9-1"}, "ts": "2023-07-13 01:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:33:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:33:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-13 01:33:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07814", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:33:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07814.647.647"}, "ts": "2023-07-13 01:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34418053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:33:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34418053", "type": "PubMed"}, "ts": "2023-07-13 01:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55318", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:33:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55318.244.244"}, "ts": "2023-07-13 01:33:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Irs1", "user": "Undecided", "type": "user", "page": "publication", "message": "Performing Global Search"}, "ts": "2023-07-13 01:34:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:34:16 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Irs1"}, "ts": "2023-07-13 01:34:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:34:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Irs1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Irs1"}, "ts": "2023-07-13 01:34:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10a60dc155b96f8841ace5665a00e5c3", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:34:18 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "10a60dc155b96f8841ace5665a00e5c3", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:34:18 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:34:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:34:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35569-1"}, "ts": "2023-07-13 01:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:34:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35568-1"}, "ts": "2023-07-13 01:34:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35568-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35569-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DA81", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:34:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DA81"}, "ts": "2023-07-13 01:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:34:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZI7"}, "ts": "2023-07-13 01:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Irs2", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 01:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:34:53 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Irs2"}, "ts": "2023-07-13 01:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Irs2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Irs2"}, "ts": "2023-07-13 01:34:54 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "41e0b3453bf6a5e10e067710433233f9", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:34:56 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "41e0b3453bf6a5e10e067710433233f9", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4H2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4H2-1"}, "ts": "2023-07-13 01:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81122-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81122-1"}, "ts": "2023-07-13 01:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Il4r", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 01:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:35:21 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Il4r"}, "ts": "2023-07-13 01:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 01:35:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Il4r", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Il4r"}, "ts": "2023-07-13 01:35:21 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 01:35:23 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3b0d87557cb2b484cf4c91307cc081c4", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 01:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b0d87557cb2b484cf4c91307cc081c4", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 01:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394-1"}, "ts": "2023-07-13 01:35:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63257-1"}, "ts": "2023-07-13 01:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63257-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 01:35:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-13 01:35:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62484", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7EWE4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7EWE4-1"}, "ts": "2023-07-13 01:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1V9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:36:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U1V9"}, "ts": "2023-07-13 01:36:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z218-1.113.113"}, "ts": "2023-07-13 01:37:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z218-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:37:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14943"}, "ts": "2023-07-13 01:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:39:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21757.250.250"}, "ts": "2023-07-13 01:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21757", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2D1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:39:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2D1"}, "ts": "2023-07-13 01:39:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-13 01:40:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:40:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11500363", "type": "PubMed"}, "ts": "2023-07-13 01:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11500363", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:40:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49257"}, "ts": "2023-07-13 01:40:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49257", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:40:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11074001", "type": "PubMed"}, "ts": "2023-07-13 01:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11074001", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29599122", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:41:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29599122", "type": "PubMed"}, "ts": "2023-07-13 01:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49281"}, "ts": "2023-07-13 01:41:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FU4-1"}, "ts": "2023-07-13 01:42:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FU4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:42:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21060763", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:42:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21060763", "type": "PubMed"}, "ts": "2023-07-13 01:42:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R482", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:42:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R482"}, "ts": "2023-07-13 01:42:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-13 01:42:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85767HW"}, "ts": "2023-07-13 01:42:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20742.1125.1125"}, "ts": "2023-07-13 01:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20742", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:43:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N7Z5.350.350"}, "ts": "2023-07-13 01:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7Z5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:43:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55199"}, "ts": "2023-07-13 01:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55199", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:43:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22304.477.477"}, "ts": "2023-07-13 01:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22304", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05CL8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:43:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05CL8-1"}, "ts": "2023-07-13 01:43:38 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9D8T2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 01:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D8T2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 01:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:43:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51610.893.893"}, "ts": "2023-07-13 01:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 01:43:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5JWF2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 01:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80235JY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:43:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80235JY"}, "ts": "2023-07-13 01:43:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PVX1-1"}, "ts": "2023-07-13 01:43:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17344FG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:43:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:43:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2001547", "type": "PubMed"}, "ts": "2023-07-13 01:43:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2001547", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:43:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17344FG"}, "ts": "2023-07-13 01:44:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99K90-1"}, "ts": "2023-07-13 01:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99K90-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:44:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-13 01:44:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34418053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:44:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34418053", "type": "PubMed"}, "ts": "2023-07-13 01:44:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-13 01:44:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93084"}, "ts": "2023-07-13 01:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93084", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:44:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15379"}, "ts": "2023-07-13 01:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75712", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:44:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75712"}, "ts": "2023-07-13 01:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 01:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12489179", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:45:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12489179", "type": "PubMed"}, "ts": "2023-07-13 01:45:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02545.19.19"}, "ts": "2023-07-13 01:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02545", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:45:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TE60.29.29"}, "ts": "2023-07-13 01:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE60", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16650084", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0JPN4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:46:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0JPN4"}, "ts": "2023-07-13 01:46:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:46:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8812419", "type": "PubMed"}, "ts": "2023-07-13 01:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8812419", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:47:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16135813", "type": "PubMed"}, "ts": "2023-07-13 01:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16135813", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75717", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:47:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75717.824.824"}, "ts": "2023-07-13 01:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55769", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:47:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55769.122.122"}, "ts": "2023-07-13 01:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:48:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13188.117.117"}, "ts": "2023-07-13 01:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13188", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:49:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G54406UD"}, "ts": "2023-07-13 01:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G54406UD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:49:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULV1-1"}, "ts": "2023-07-13 01:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULV1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15277698", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:50:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15277698", "type": "PubMed"}, "ts": "2023-07-13 01:50:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVL0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:51:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVL0.872.872"}, "ts": "2023-07-13 01:51:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JMC2"}, "ts": "2023-07-13 01:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JMC2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:51:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ65"}, "ts": "2023-07-13 01:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:52:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A58"}, "ts": "2023-07-13 01:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TEA8-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:52:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3TEA8-1.157.157"}, "ts": "2023-07-13 01:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50427EN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:52:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50427EN"}, "ts": "2023-07-13 01:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:52:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50990-1"}, "ts": "2023-07-13 01:52:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:52:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-13 01:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY67", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:53:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY67.137.137"}, "ts": "2023-07-13 01:53:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5PR69.409.409"}, "ts": "2023-07-13 01:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PR69", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:54:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX04"}, "ts": "2023-07-13 01:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX04", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:54:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60264"}, "ts": "2023-07-13 01:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 01:54:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5JWF2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 01:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 01:54:57 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 01:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 01:54:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A274"}, "ts": "2023-07-13 01:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A274", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 01:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13852-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13852-1"}, "ts": "2023-07-13 01:55:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:55:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYG6"}, "ts": "2023-07-13 01:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7691235", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:55:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7691235", "type": "PubMed"}, "ts": "2023-07-13 01:55:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12866", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:56:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12866.204.204"}, "ts": "2023-07-13 01:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49281", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:57:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67410LQ"}, "ts": "2023-07-13 01:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67410LQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:57:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-13 01:57:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-13 01:57:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCR0"}, "ts": "2023-07-13 01:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 01:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10075675", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 01:58:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10075675", "type": "PubMed"}, "ts": "2023-07-13 01:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85767HW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 01:59:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12879.445.445"}, "ts": "2023-07-13 01:59:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12879", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 01:59:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 01:59:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 01:59:35 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 02:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 02:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 02:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 02:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 02:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 02:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:00:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A5YKK6.1070.1070"}, "ts": "2023-07-13 02:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A5YKK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00148", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:00:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00148"}, "ts": "2023-07-13 02:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:00:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZS23"}, "ts": "2023-07-13 02:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZS23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY27", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:00:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY27"}, "ts": "2023-07-13 02:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P6B7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:01:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P6B7"}, "ts": "2023-07-13 02:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:01:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZS7"}, "ts": "2023-07-13 02:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:01:10 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-13 02:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000034", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 02:01:21 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000034", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-13 02:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RSF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:02:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RSF9"}, "ts": "2023-07-13 02:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08635-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:02:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08635-1"}, "ts": "2023-07-13 02:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19327-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 02:02:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P19327-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 02:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T6X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X5"}, "ts": "2023-07-13 02:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12830"}, "ts": "2023-07-13 02:04:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23434"}, "ts": "2023-07-13 02:05:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31863777", "type": "PubMed"}, "ts": "2023-07-13 02:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31863777", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:06:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-13 02:06:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:06:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41233.1042.1042"}, "ts": "2023-07-13 02:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41233", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:06:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15438"}, "ts": "2023-07-13 02:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15438", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-13 02:06:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25597754", "type": "PubMed"}, "ts": "2023-07-13 02:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25597754", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48357", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:07:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48357.672.672"}, "ts": "2023-07-13 02:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MS0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:07:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96MS0.257.257"}, "ts": "2023-07-13 02:07:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QZQ1.424.424"}, "ts": "2023-07-13 02:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:07:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50990-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:08:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88454"}, "ts": "2023-07-13 02:08:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHI7"}, "ts": "2023-07-13 02:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license.html", "message": "page access"}, "ts": "2023-07-13 02:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04891"}, "ts": "2023-07-13 02:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04891", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925C0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:08:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925C0"}, "ts": "2023-07-13 02:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJG2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:10:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PJG2.722.722"}, "ts": "2023-07-13 02:10:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13823.373.373"}, "ts": "2023-07-13 02:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:11:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHP7"}, "ts": "2023-07-13 02:11:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-13 02:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q674R7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 02:12:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q674R7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 02:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:12:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan_search.html", "message": "page access"}, "ts": "2023-07-13 02:12:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-13 02:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09172-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:13:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09172-1"}, "ts": "2023-07-13 02:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:13:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40926"}, "ts": "2023-07-13 02:13:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40926", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0T7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:13:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P0T7.45.45"}, "ts": "2023-07-13 02:13:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY97", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:14:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY97.365.365"}, "ts": "2023-07-13 02:14:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ2"}, "ts": "2023-07-13 02:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:14:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-13 02:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:15:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DPI2"}, "ts": "2023-07-13 02:15:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 02:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 02:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25520XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKZ4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 02:17:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UKZ4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 02:17:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36269", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:17:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34638548", "type": "PubMed"}, "ts": "2023-07-13 02:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34638548", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:17:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14600.18.18"}, "ts": "2023-07-13 02:17:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14600", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:17:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:18:36 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 02:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:18:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14567915", "type": "PubMed"}, "ts": "2023-07-13 02:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14567915", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10997", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10997"}, "ts": "2023-07-13 02:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91Y11-1"}, "ts": "2023-07-13 02:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Y11-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:20:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:20:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35375"}, "ts": "2023-07-13 02:20:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35375", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:20:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83461WR"}, "ts": "2023-07-13 02:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:20:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:21:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94875"}, "ts": "2023-07-13 02:21:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53597"}, "ts": "2023-07-13 02:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:21:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:22:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPC2"}, "ts": "2023-07-13 02:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:22:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:23:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AVT0"}, "ts": "2023-07-13 02:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AVT0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:23:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VBE8"}, "ts": "2023-07-13 02:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VBE8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64632MT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:23:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64632MT"}, "ts": "2023-07-13 02:23:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86906SW"}, "ts": "2023-07-13 02:23:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64632MT"}, "ts": "2023-07-13 02:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM62", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:23:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4KM62.163.163"}, "ts": "2023-07-13 02:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:25:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K5"}, "ts": "2023-07-13 02:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:25:31 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 02:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:25:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-13 02:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22140GZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51174"}, "ts": "2023-07-13 02:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 02:25:39 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G84880LA", "term_category": "glycan"}, "ts": "2023-07-13 02:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1849072963ea6f98ffc46fe032d16e13", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G84880LA\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-13 02:25:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1849072963ea6f98ffc46fe032d16e13", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 02:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1849072963ea6f98ffc46fe032d16e13", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 02:25:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84880LA"}, "ts": "2023-07-13 02:25:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84880LA"}, "ts": "2023-07-13 02:25:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25987BV"}, "ts": "2023-07-13 02:25:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28722QH"}, "ts": "2023-07-13 02:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84880LA", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:25:45 EDT-0400"}, {"api": "/glycan/search/", "req": {"composition": [{"residue": "hex", "min": 3, "max": 3}, {"residue": "hexnac", "min": 4, "max": 4}, {"residue": "dhex", "min": 1, "max": 1}]}, "ts": "2023-07-13 02:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84880LA", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan", "message": "Performing Direct Search"}, "ts": "2023-07-13 02:25:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00421"}, "ts": "2023-07-13 02:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00421", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84880LA>e0c22bce7e39fcd70a75159e15e2c76b", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan", "message": "Direct Search query={\"composition\":[{\"residue\":\"hex\",\"min\":3,\"max\":3},{\"residue\":\"hexnac\",\"min\":4,\"max\":4},{\"residue\":\"dhex\",\"min\":1,\"max\":1}]}"}, "ts": "2023-07-13 02:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e0c22bce7e39fcd70a75159e15e2c76b", "user": "ayfd2u7hwc1h33lpisu6kym0bc1r9d3x", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 02:26:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e0c22bce7e39fcd70a75159e15e2c76b", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 02:26:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56903ZB"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82680EC"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65962DP"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20751GZ"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17336WC"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11329LI"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10374FO"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53492UE"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69812OF"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83355KE"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84053BQ"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78961ZT"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65984FE"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78342SP"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78520ZK"}, "ts": "2023-07-13 02:26:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87777GG"}, "ts": "2023-07-13 02:26:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38817ZQ"}, "ts": "2023-07-13 02:26:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14809NR"}, "ts": "2023-07-13 02:26:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23117SI"}, "ts": "2023-07-13 02:26:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75449"}, "ts": "2023-07-13 02:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75449", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:26:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95486-1.1072.1072"}, "ts": "2023-07-13 02:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46976", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:26:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46976"}, "ts": "2023-07-13 02:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33193389", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:26:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33193389", "type": "PubMed"}, "ts": "2023-07-13 02:26:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6J272"}, "ts": "2023-07-13 02:27:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6J272", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:27:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23863VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:27:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42892"}, "ts": "2023-07-13 02:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42892", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:28:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LWE4"}, "ts": "2023-07-13 02:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LWE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:28:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33435"}, "ts": "2023-07-13 02:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:29:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7959762", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:29:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7959762", "type": "PubMed"}, "ts": "2023-07-13 02:29:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60235"}, "ts": "2023-07-13 02:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:29:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-13 02:29:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16650"}, "ts": "2023-07-13 02:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9253601", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:29:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9253601", "type": "PubMed"}, "ts": "2023-07-13 02:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80XQ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:30:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80XQ8-1"}, "ts": "2023-07-13 02:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16204", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:30:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16204.318.318"}, "ts": "2023-07-13 02:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BM72", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:30:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BM72"}, "ts": "2023-07-13 02:30:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 02:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14973", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 02:30:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q14973", "cluster_type": "unselected"}, "ts": "2023-07-13 02:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14973", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 02:30:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30050"}, "ts": "2023-07-13 02:30:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30050", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:30:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924U1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924U1"}, "ts": "2023-07-13 02:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RJN0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:30:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5RJN0-1"}, "ts": "2023-07-13 02:30:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17353907", "type": "PubMed"}, "ts": "2023-07-13 02:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17353907", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:30:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394"}, "ts": "2023-07-13 02:31:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NDD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:31:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NDD5"}, "ts": "2023-07-13 02:31:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TBG4.268.268"}, "ts": "2023-07-13 02:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBG4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35318", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:31:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35318.81.81"}, "ts": "2023-07-13 02:31:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P53347", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 02:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53347", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 02:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53347", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 02:32:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:32:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJ64-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BJ64-1"}, "ts": "2023-07-13 02:32:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99PP2.239.239"}, "ts": "2023-07-13 02:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PP2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41219", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41219"}, "ts": "2023-07-13 02:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:32:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15223"}, "ts": "2023-07-13 02:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:32:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35070-1"}, "ts": "2023-07-13 02:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:33:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V01"}, "ts": "2023-07-13 02:33:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08588"}, "ts": "2023-07-13 02:33:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR28"}, "ts": "2023-07-13 02:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:34:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 02:34:04 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 02:34:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:34:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZJ3.62.62"}, "ts": "2023-07-13 02:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P273", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:34:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P273.789.789"}, "ts": "2023-07-13 02:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-13 02:34:44 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-13 02:34:44 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 02:34:44 EDT-0400"}, {"api": "/usecases/species_to_glycosyltransferases/", "req": {"tax_id": 9606}, "ts": "2023-07-13 02:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-13 02:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDG4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:35:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDG4.208.208"}, "ts": "2023-07-13 02:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6f289f89f8d58fde173e8013496ad36b", "user": "Undecided", "type": "user", "page": "quick-search", "message": "Quick Search Question_8 = /9606"}, "ts": "2023-07-13 02:35:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VWK5.262.262"}, "ts": "2023-07-13 02:35:04 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 02:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 02:35:04 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 02:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWK5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 02:35:26 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_data", "operator": "OR", "selected": ["Disease"]}]}, "ts": "2023-07-13 02:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 02:35:43 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 02:35:44 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 02:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 02:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 02:35:55 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "6f289f89f8d58fde173e8013496ad36b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_data", "operator": "OR", "selected": ["Disease"]}]}, "ts": "2023-07-13 02:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-13 02:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-13 02:36:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDR0.416.416"}, "ts": "2023-07-13 02:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94766-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94766-1"}, "ts": "2023-07-13 02:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83461WR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:36:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 02:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30711"}, "ts": "2023-07-13 02:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHL6"}, "ts": "2023-07-13 02:36:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41242-1"}, "ts": "2023-07-13 02:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41242-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ59", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:37:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ59"}, "ts": "2023-07-13 02:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94875", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60896"}, "ts": "2023-07-13 02:38:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-13 02:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:38:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03164"}, "ts": "2023-07-13 02:38:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16234.103.103"}, "ts": "2023-07-13 02:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16234", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:39:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-13 02:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:40:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80511"}, "ts": "2023-07-13 02:40:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:40:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867"}, "ts": "2023-07-13 02:40:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NYC1"}, "ts": "2023-07-13 02:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NYC1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:41:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY49-1"}, "ts": "2023-07-13 02:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY49-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:42:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16640556", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:42:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16640556", "type": "PubMed"}, "ts": "2023-07-13 02:42:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:42:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-13 02:42:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JZY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:42:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JZY3.291.291"}, "ts": "2023-07-13 02:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPA7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPA7"}, "ts": "2023-07-13 02:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y210"}, "ts": "2023-07-13 02:43:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-13 02:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30548", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30548"}, "ts": "2023-07-13 02:43:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05783.46.46"}, "ts": "2023-07-13 02:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05783", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:43:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02760.307.307"}, "ts": "2023-07-13 02:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02760", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80858MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13002", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:44:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13002"}, "ts": "2023-07-13 02:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01804", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:45:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01804"}, "ts": "2023-07-13 02:45:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33435", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:45:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749"}, "ts": "2023-07-13 02:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 02:45:28 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 02:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 02:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:45:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 02:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 02:45:56 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 02:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-13 02:45:56 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 02:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 02:45:58 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 02:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:46:00 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(2)dHex(1)", "term_category": "any"}, "ts": "2023-07-13 02:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 02:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">49086db05a518a1f306fe9e2a2a23e13", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(2)dHex(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 02:46:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "49086db05a518a1f306fe9e2a2a23e13", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 02:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "49086db05a518a1f306fe9e2a2a23e13", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 02:46:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99858XP"}, "ts": "2023-07-13 02:46:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95575GS"}, "ts": "2023-07-13 02:46:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01304XG"}, "ts": "2023-07-13 02:46:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84155GY"}, "ts": "2023-07-13 02:46:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18410AS"}, "ts": "2023-07-13 02:46:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67307LA"}, "ts": "2023-07-13 02:46:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26629TM"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79165WB"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05744AS"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10449CJ"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25637MV"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50282JC"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16407EV"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98795XC"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51175PR"}, "ts": "2023-07-13 02:46:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24172SG"}, "ts": "2023-07-13 02:46:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88727SH"}, "ts": "2023-07-13 02:46:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45229AI"}, "ts": "2023-07-13 02:46:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92165DB"}, "ts": "2023-07-13 02:46:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96727JJ"}, "ts": "2023-07-13 02:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 02:46:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 02:46:22 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 02:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 02:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9U3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:46:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9U3-1"}, "ts": "2023-07-13 02:46:29 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(2)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-13 02:46:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 02:46:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(2)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 02:46:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M7U5-1"}, "ts": "2023-07-13 02:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M7U5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 02:46:50 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(2)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-13 02:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(2)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 02:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZZ1"}, "ts": "2023-07-13 02:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43166", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:47:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43166"}, "ts": "2023-07-13 02:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35644286", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:47:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35644286", "type": "PubMed"}, "ts": "2023-07-13 02:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:47:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78352"}, "ts": "2023-07-13 02:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AHL1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:48:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AHL1.425.425"}, "ts": "2023-07-13 02:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13994", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:48:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13994"}, "ts": "2023-07-13 02:48:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G28882QV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:48:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G28882QV"}, "ts": "2023-07-13 02:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16519681", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:48:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16519681", "type": "PubMed"}, "ts": "2023-07-13 02:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:48:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15887"}, "ts": "2023-07-13 02:49:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:49:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JM51"}, "ts": "2023-07-13 02:49:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JM51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:49:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z8P8"}, "ts": "2023-07-13 02:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z8P8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:49:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2E2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:51:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N2E2.804.804"}, "ts": "2023-07-13 02:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:51:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63HM9.259.259"}, "ts": "2023-07-13 02:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:52:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95857"}, "ts": "2023-07-13 02:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:52:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKL0.127.127"}, "ts": "2023-07-13 02:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21680743", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:52:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21680743", "type": "PubMed"}, "ts": "2023-07-13 02:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:52:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVX0"}, "ts": "2023-07-13 02:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVS9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVS9"}, "ts": "2023-07-13 02:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-13 02:53:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-13 02:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:54:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54753"}, "ts": "2023-07-13 02:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54753", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:54:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69834CE"}, "ts": "2023-07-13 02:54:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 02:54:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-13 02:54:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78790NZ"}, "ts": "2023-07-13 02:54:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-13 02:54:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-13 02:54:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-13 02:54:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95678HJ"}, "ts": "2023-07-13 02:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:54:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2KAV6"}, "ts": "2023-07-13 02:54:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2KAV6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 02:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2KAV6", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 02:54:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:55:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94822.1011.1011"}, "ts": "2023-07-13 02:55:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2A9"}, "ts": "2023-07-13 02:55:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:55:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-13 02:55:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49445.93.93"}, "ts": "2023-07-13 02:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49445", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2H9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 02:56:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2H9.230.230"}, "ts": "2023-07-13 02:56:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-13 02:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50549", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:56:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:56:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50549"}, "ts": "2023-07-13 02:56:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23142YD"}, "ts": "2023-07-13 02:57:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 02:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16652157", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 02:57:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16652157", "type": "PubMed"}, "ts": "2023-07-13 02:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 02:58:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:59:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13726"}, "ts": "2023-07-13 02:59:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000071"}, "ts": "2023-07-13 02:59:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBH5"}, "ts": "2023-07-13 02:59:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 02:59:46 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 03:00:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRK5"}, "ts": "2023-07-13 03:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 03:00:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 03:00:05 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 03:00:06 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 03:00:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 03:00:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 03:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35580-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35580-1"}, "ts": "2023-07-13 03:00:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01638.257.257"}, "ts": "2023-07-13 03:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01638", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01833-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01833-1"}, "ts": "2023-07-13 03:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59997", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:02:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P59997.444.444"}, "ts": "2023-07-13 03:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08599", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:02:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08599.516.516"}, "ts": "2023-07-13 03:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1N0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:02:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1N0"}, "ts": "2023-07-13 03:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21233214", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:02:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21233214", "type": "PubMed"}, "ts": "2023-07-13 03:02:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZC02"}, "ts": "2023-07-13 03:03:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZC02", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:03:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86U44.43.43"}, "ts": "2023-07-13 03:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11157804", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:03:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11157804", "type": "PubMed"}, "ts": "2023-07-13 03:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18628982", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:03:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18628982", "type": "PubMed"}, "ts": "2023-07-13 03:03:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CI94"}, "ts": "2023-07-13 03:03:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CI94", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:03:48 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-13 03:03:55 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-13 03:03:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-13 03:03:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-13 03:03:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "E9PZQ0-1.4967.4967"}, "ts": "2023-07-13 03:06:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PZQ0-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:06:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEQ6.810.810"}, "ts": "2023-07-13 03:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEQ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:06:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12960"}, "ts": "2023-07-13 03:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12960", "user": "2378clwy2ieipkj2fnkz9yg0ph2k6ge7", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "2378clwy2ieipkj2fnkz9yg0ph2k6ge7", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11310", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:06:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11310"}, "ts": "2023-07-13 03:06:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60145BJ"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66538GV"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94854LT"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-13 03:06:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-13 03:07:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGI2"}, "ts": "2023-07-13 03:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:08:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QZF2.79.79"}, "ts": "2023-07-13 03:08:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZF2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:08:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHD9.3.3"}, "ts": "2023-07-13 03:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHD9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:09:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N983"}, "ts": "2023-07-13 03:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68D85"}, "ts": "2023-07-13 03:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68D85", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:11:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGL2"}, "ts": "2023-07-13 03:11:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15046.534.534"}, "ts": "2023-07-13 03:11:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15046", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:11:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-13 03:11:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZW05.692.692"}, "ts": "2023-07-13 03:11:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95486-1.156.156"}, "ts": "2023-07-13 03:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZW05", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95486-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:12:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00300"}, "ts": "2023-07-13 03:12:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10981"}, "ts": "2023-07-13 03:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4B5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:13:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4B5.263.263"}, "ts": "2023-07-13 03:13:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:14:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTA9"}, "ts": "2023-07-13 03:14:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q53H80-1.18.18"}, "ts": "2023-07-13 03:14:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DT5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 03:14:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96DT5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 03:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15371340", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:14:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15371340", "type": "PubMed"}, "ts": "2023-07-13 03:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15371340", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 03:14:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan_search.html", "message": "page access"}, "ts": "2023-07-13 03:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29508"}, "ts": "2023-07-13 03:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:15:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:15:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZM4.260.260"}, "ts": "2023-07-13 03:15:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17717072", "type": "PubMed"}, "ts": "2023-07-13 03:15:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17717072", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:15:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9DBX1.75.75"}, "ts": "2023-07-13 03:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBX1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:15:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15142957", "type": "PubMed"}, "ts": "2023-07-13 03:16:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15142957", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28908", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:16:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28908.209.209"}, "ts": "2023-07-13 03:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A577"}, "ts": "2023-07-13 03:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84452RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 03:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A577", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:16:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37802"}, "ts": "2023-07-13 03:16:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31129117", "type": "PubMed"}, "ts": "2023-07-13 03:17:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31129117", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:17:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41236", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:17:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41236"}, "ts": "2023-07-13 03:17:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24766575", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:17:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24766575", "type": "PubMed"}, "ts": "2023-07-13 03:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H582", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:17:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H582"}, "ts": "2023-07-13 03:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4Q2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:18:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-13 03:18:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15185", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:18:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15185"}, "ts": "2023-07-13 03:18:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08069"}, "ts": "2023-07-13 03:19:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11580843", "type": "PubMed"}, "ts": "2023-07-13 03:19:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51690"}, "ts": "2023-07-13 03:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11580843", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:19:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ52"}, "ts": "2023-07-13 03:19:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-13 03:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21816349", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:20:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21816349", "type": "PubMed"}, "ts": "2023-07-13 03:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRD8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:22:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRD8.692.692"}, "ts": "2023-07-13 03:22:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16846730", "type": "PubMed"}, "ts": "2023-07-13 03:22:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16846730", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:22:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 03:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:23:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63HQ2.459.459"}, "ts": "2023-07-13 03:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:23:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPH3"}, "ts": "2023-07-13 03:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21597245", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:23:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21597245", "type": "PubMed"}, "ts": "2023-07-13 03:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21700224", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:24:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21700224", "type": "PubMed"}, "ts": "2023-07-13 03:24:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05378UG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 03:25:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05378UG"}, "ts": "2023-07-13 03:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83731", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:25:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P83731.149.149"}, "ts": "2023-07-13 03:25:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53GQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:25:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53GQ0"}, "ts": "2023-07-13 03:25:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQB3.517.517"}, "ts": "2023-07-13 03:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQB3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:25:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-13 03:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:26:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RS33"}, "ts": "2023-07-13 03:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RS33", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DC33", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:26:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DC33"}, "ts": "2023-07-13 03:26:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16112"}, "ts": "2023-07-13 03:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY08", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:27:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY08.189.189"}, "ts": "2023-07-13 03:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15906", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:28:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15906"}, "ts": "2023-07-13 03:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80W65", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:28:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80W65.536.536"}, "ts": "2023-07-13 03:28:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88823", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:29:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88823"}, "ts": "2023-07-13 03:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63074", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:29:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63074"}, "ts": "2023-07-13 03:29:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-13 03:29:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8H0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:30:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8H0"}, "ts": "2023-07-13 03:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12470645", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:30:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12470645", "type": "PubMed"}, "ts": "2023-07-13 03:30:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60663"}, "ts": "2023-07-13 03:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:30:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DTY7"}, "ts": "2023-07-13 03:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DTY7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62371", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:31:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62371"}, "ts": "2023-07-13 03:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMZ3"}, "ts": "2023-07-13 03:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:32:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04426"}, "ts": "2023-07-13 03:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03060", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:32:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03060.274.274"}, "ts": "2023-07-13 03:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P51", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:32:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q32P51.74.74"}, "ts": "2023-07-13 03:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:32:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUI6"}, "ts": "2023-07-13 03:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G77384RA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 03:34:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77384RA"}, "ts": "2023-07-13 03:34:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50135"}, "ts": "2023-07-13 03:34:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27708"}, "ts": "2023-07-13 03:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27708", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:34:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-13 03:34:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16220"}, "ts": "2023-07-13 03:34:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-13 03:34:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-13 03:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-13 03:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:35:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51690", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:35:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50135", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V815-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:35:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V815-1"}, "ts": "2023-07-13 03:35:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16923132", "type": "PubMed"}, "ts": "2023-07-13 03:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16923132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:35:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8JZW4"}, "ts": "2023-07-13 03:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZW4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27918", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:37:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27918"}, "ts": "2023-07-13 03:37:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-13 03:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H444", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:39:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H444.184.184"}, "ts": "2023-07-13 03:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25774", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:40:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25774"}, "ts": "2023-07-13 03:40:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49247"}, "ts": "2023-07-13 03:40:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-13 03:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6260780", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:40:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6260780", "type": "PubMed"}, "ts": "2023-07-13 03:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34944009", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:41:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34944009", "type": "PubMed"}, "ts": "2023-07-13 03:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DM3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:42:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DM3"}, "ts": "2023-07-13 03:42:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY76"}, "ts": "2023-07-13 03:42:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:42:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWA5.536.536"}, "ts": "2023-07-13 03:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 03:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-13 03:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 03:44:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U319", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 03:44:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3U319", "cluster_type": "unselected"}, "ts": "2023-07-13 03:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U319", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 03:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU39", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:44:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU39"}, "ts": "2023-07-13 03:44:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SX3"}, "ts": "2023-07-13 03:45:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:45:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18084", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18084"}, "ts": "2023-07-13 03:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VD72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:45:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VD72"}, "ts": "2023-07-13 03:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:45:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10859164", "type": "PubMed"}, "ts": "2023-07-13 03:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10859164", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:45:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14798"}, "ts": "2023-07-13 03:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N468", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:46:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N468"}, "ts": "2023-07-13 03:46:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02085", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:46:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02085.112.112"}, "ts": "2023-07-13 03:46:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X55"}, "ts": "2023-07-13 03:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:47:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40240"}, "ts": "2023-07-13 03:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:47:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5G9.591.591"}, "ts": "2023-07-13 03:47:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:48:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08100"}, "ts": "2023-07-13 03:48:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15031-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:48:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15031-1.1049.1049"}, "ts": "2023-07-13 03:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34810", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCE3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:48:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34810"}, "ts": "2023-07-13 03:48:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCE3-1"}, "ts": "2023-07-13 03:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IZ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:49:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96IZ6.4.4"}, "ts": "2023-07-13 03:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A597"}, "ts": "2023-07-13 03:49:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:49:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYZ2"}, "ts": "2023-07-13 03:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11773439", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:49:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11773439", "type": "PubMed"}, "ts": "2023-07-13 03:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54760", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:50:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54760.203.203"}, "ts": "2023-07-13 03:50:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-13 03:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9430630", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:51:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9430630", "type": "PubMed"}, "ts": "2023-07-13 03:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-13 03:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRQ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:52:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRQ8"}, "ts": "2023-07-13 03:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92186"}, "ts": "2023-07-13 03:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16885", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:53:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16885.587.587"}, "ts": "2023-07-13 03:53:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2521606", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:53:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2521606", "type": "PubMed"}, "ts": "2023-07-13 03:53:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46379"}, "ts": "2023-07-13 03:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:54:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02793"}, "ts": "2023-07-13 03:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02793", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:54:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C588"}, "ts": "2023-07-13 03:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17574030", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:54:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17574030", "type": "PubMed"}, "ts": "2023-07-13 03:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-13 03:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:55:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBQ9"}, "ts": "2023-07-13 03:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBQ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:55:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61289"}, "ts": "2023-07-13 03:55:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0AVT1-1.530.530"}, "ts": "2023-07-13 03:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0AVT1-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47901", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:56:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47901.274.274"}, "ts": "2023-07-13 03:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7795521", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:56:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7795521", "type": "PubMed"}, "ts": "2023-07-13 03:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10168-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:56:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-13 03:56:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10168-1"}, "ts": "2023-07-13 03:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:56:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15223"}, "ts": "2023-07-13 03:56:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11927537", "type": "PubMed"}, "ts": "2023-07-13 03:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11927537", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 03:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83868", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:57:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:57:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83868"}, "ts": "2023-07-13 03:57:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWV7"}, "ts": "2023-07-13 03:57:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWV7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:57:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95619"}, "ts": "2023-07-13 03:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95619", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:57:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIR0"}, "ts": "2023-07-13 03:57:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53347"}, "ts": "2023-07-13 03:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZ49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:58:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZ49"}, "ts": "2023-07-13 03:58:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62918"}, "ts": "2023-07-13 03:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62918", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JTM9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:58:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JTM9-1"}, "ts": "2023-07-13 03:58:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13751.522.522"}, "ts": "2023-07-13 03:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13751", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:59:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55229"}, "ts": "2023-07-13 03:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30408", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:59:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30408.137.137"}, "ts": "2023-07-13 03:59:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08495.110.110"}, "ts": "2023-07-13 03:59:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08495", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 03:59:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H306"}, "ts": "2023-07-13 03:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H306", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 03:59:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 03:59:42 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 04:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 04:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 04:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 04:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-13 04:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-13 04:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TT23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:00:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TT23"}, "ts": "2023-07-13 04:00:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10.1016/j.celrep.2021.109179", "type": "DOI"}, "ts": "2023-07-13 04:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10.1016/j.celrep.2021.109179", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:01:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23526"}, "ts": "2023-07-13 04:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23526", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C6B1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C6B1"}, "ts": "2023-07-13 04:01:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16407192", "type": "PubMed"}, "ts": "2023-07-13 04:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16407192", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:02:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30414627", "type": "PubMed"}, "ts": "2023-07-13 04:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30414627", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:03:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99999.44.44"}, "ts": "2023-07-13 04:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99999", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:03:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D1E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4D1E1"}, "ts": "2023-07-13 04:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05CL8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:03:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05CL8"}, "ts": "2023-07-13 04:03:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZU79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:04:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZU79"}, "ts": "2023-07-13 04:04:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-13 04:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B23"}, "ts": "2023-07-13 04:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CX98"}, "ts": "2023-07-13 04:05:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX98", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19320", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:05:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19320.224.224"}, "ts": "2023-07-13 04:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-13 04:06:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00797", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:06:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00797"}, "ts": "2023-07-13 04:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:06:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4VC05.12.12"}, "ts": "2023-07-13 04:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC05", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:07:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92823", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 04:07:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92823", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 04:07:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43660"}, "ts": "2023-07-13 04:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0G0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:07:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0G0"}, "ts": "2023-07-13 04:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6L8H4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:07:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6L8H4.116.116"}, "ts": "2023-07-13 04:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:08:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2E6"}, "ts": "2023-07-13 04:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21612406", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:08:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21612406", "type": "PubMed"}, "ts": "2023-07-13 04:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01009-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:08:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01009-1.38.38"}, "ts": "2023-07-13 04:08:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBK5-1"}, "ts": "2023-07-13 04:09:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBK5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:09:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13574"}, "ts": "2023-07-13 04:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K6N9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00418", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:11:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00418.70.70"}, "ts": "2023-07-13 04:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:11:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14727"}, "ts": "2023-07-13 04:11:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9003186", "type": "PubMed"}, "ts": "2023-07-13 04:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9003186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:12:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17344FG"}, "ts": "2023-07-13 04:12:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 04:12:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04062"}, "ts": "2023-07-13 04:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04062", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:12:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19420245", "type": "PubMed"}, "ts": "2023-07-13 04:12:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19420245", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48960", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:12:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48960"}, "ts": "2023-07-13 04:12:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68318VE"}, "ts": "2023-07-13 04:13:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-13 04:13:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-13 04:13:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71142DF"}, "ts": "2023-07-13 04:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25774", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:13:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25774"}, "ts": "2023-07-13 04:13:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U2P1-1"}, "ts": "2023-07-13 04:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U2P1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:14:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:14:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14727"}, "ts": "2023-07-13 04:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18615", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:15:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18615.165.165"}, "ts": "2023-07-13 04:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QF7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:15:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QF7"}, "ts": "2023-07-13 04:15:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:15:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01433", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:15:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01433.190.190"}, "ts": "2023-07-13 04:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:16:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33307028", "type": "PubMed"}, "ts": "2023-07-13 04:17:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33307028", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:17:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33307028", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 04:17:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q969H0.465.465"}, "ts": "2023-07-13 04:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:17:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-13 04:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:18:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-13 04:18:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04791QM"}, "ts": "2023-07-13 04:19:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14676215", "type": "PubMed"}, "ts": "2023-07-13 04:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14676215", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48643-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:19:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48643-1"}, "ts": "2023-07-13 04:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYD4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:19:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYD4"}, "ts": "2023-07-13 04:19:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15118098", "type": "PubMed"}, "ts": "2023-07-13 04:20:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15118098", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWL8"}, "ts": "2023-07-13 04:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWL8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ72", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:20:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQ72.114.114"}, "ts": "2023-07-13 04:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14641107", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:21:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14641107", "type": "PubMed"}, "ts": "2023-07-13 04:21:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22951644", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:21:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22951644", "type": "PubMed"}, "ts": "2023-07-13 04:21:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q0C1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:21:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Q0C1"}, "ts": "2023-07-13 04:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80235JY", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 04:21:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30873.48.48"}, "ts": "2023-07-13 04:22:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30873", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:22:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92574"}, "ts": "2023-07-13 04:22:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80108"}, "ts": "2023-07-13 04:22:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61414", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:23:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61414"}, "ts": "2023-07-13 04:23:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCG1"}, "ts": "2023-07-13 04:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:23:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-13 04:23:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22888"}, "ts": "2023-07-13 04:23:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSK2"}, "ts": "2023-07-13 04:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:24:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54861-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:24:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54861-1"}, "ts": "2023-07-13 04:24:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5T7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:24:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5T7"}, "ts": "2023-07-13 04:24:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1385220", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:24:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1385220", "type": "PubMed"}, "ts": "2023-07-13 04:24:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:25:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVW6.311.311"}, "ts": "2023-07-13 04:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22262902", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:26:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22262902", "type": "PubMed"}, "ts": "2023-07-13 04:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1M3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:26:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1M3"}, "ts": "2023-07-13 04:26:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-13 04:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06728MM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 04:27:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06728MM"}, "ts": "2023-07-13 04:27:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 04:27:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29677490", "type": "PubMed"}, "ts": "2023-07-13 04:27:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29677490", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:27:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23455323", "type": "PubMed"}, "ts": "2023-07-13 04:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23455323", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:27:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75821.129.129"}, "ts": "2023-07-13 04:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75821", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43405", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:27:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43405.145.145"}, "ts": "2023-07-13 04:27:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13195"}, "ts": "2023-07-13 04:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:27:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99715.639.639"}, "ts": "2023-07-13 04:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99715", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:29:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18893-1"}, "ts": "2023-07-13 04:29:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18893-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:29:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 04:29:40 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 04:29:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 04:29:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NXT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:30:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NXT4"}, "ts": "2023-07-13 04:30:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17047.115.115"}, "ts": "2023-07-13 04:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17047", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:31:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925E7"}, "ts": "2023-07-13 04:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925E7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:31:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PP9"}, "ts": "2023-07-13 04:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13296", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:32:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13296.68.68"}, "ts": "2023-07-13 04:32:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:32:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62656"}, "ts": "2023-07-13 04:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:33:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHS9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:33:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NHS9.3.3"}, "ts": "2023-07-13 04:33:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 04:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:33:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14764453", "type": "PubMed"}, "ts": "2023-07-13 04:33:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14764453", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:33:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-13 04:33:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:33:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2F2"}, "ts": "2023-07-13 04:33:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57732TJ"}, "ts": "2023-07-13 04:34:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59942"}, "ts": "2023-07-13 04:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59942", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75015", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:34:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75015"}, "ts": "2023-07-13 04:34:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49767.147.147"}, "ts": "2023-07-13 04:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49767", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:34:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-13 04:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04791QM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 04:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34960"}, "ts": "2023-07-13 04:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34960", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2511201", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:35:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2511201", "type": "PubMed"}, "ts": "2023-07-13 04:35:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q495T6.694.694"}, "ts": "2023-07-13 04:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q495T6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54818", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:36:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54818"}, "ts": "2023-07-13 04:36:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6IMN6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 04:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IMN6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 04:37:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61221"}, "ts": "2023-07-13 04:37:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-13 04:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6K9"}, "ts": "2023-07-13 04:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01591"}, "ts": "2023-07-13 04:37:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-13 04:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10102990", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:37:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10102990", "type": "PubMed"}, "ts": "2023-07-13 04:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92625", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:38:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92625"}, "ts": "2023-07-13 04:38:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11244092", "type": "PubMed"}, "ts": "2023-07-13 04:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11244092", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50502", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:39:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50502.304.304"}, "ts": "2023-07-13 04:39:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-13 04:39:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-13 04:39:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAC1"}, "ts": "2023-07-13 04:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAC1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:39:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14793.141.141"}, "ts": "2023-07-13 04:39:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14793", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q640R3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:39:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q640R3.379.379"}, "ts": "2023-07-13 04:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:39:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LA5.204.204"}, "ts": "2023-07-13 04:39:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:39:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3E0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:40:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3E0-1"}, "ts": "2023-07-13 04:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YV8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:40:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80YV8"}, "ts": "2023-07-13 04:40:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61188"}, "ts": "2023-07-13 04:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61188", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:40:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01236", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:40:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01236"}, "ts": "2023-07-13 04:40:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92481.219.219"}, "ts": "2023-07-13 04:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:40:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-13 04:40:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23593173", "type": "PubMed"}, "ts": "2023-07-13 04:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23593173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23593173", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 04:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02788-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02788-1"}, "ts": "2023-07-13 04:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:41:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DV7"}, "ts": "2023-07-13 04:41:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1281307", "type": "PubMed"}, "ts": "2023-07-13 04:41:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1281307", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:41:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02792", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:41:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02792"}, "ts": "2023-07-13 04:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:42:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q10980.64.64"}, "ts": "2023-07-13 04:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92922", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92922"}, "ts": "2023-07-13 04:42:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95848", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:42:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95848"}, "ts": "2023-07-13 04:42:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18353881", "type": "PubMed"}, "ts": "2023-07-13 04:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18353881", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EY7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 04:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-13 04:43:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96EY7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 04:43:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GD4"}, "ts": "2023-07-13 04:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GD4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:43:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10586"}, "ts": "2023-07-13 04:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10586", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11746045", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:44:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11746045", "type": "PubMed"}, "ts": "2023-07-13 04:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:45:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68871"}, "ts": "2023-07-13 04:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63140", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:45:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63140"}, "ts": "2023-07-13 04:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M947-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M947-1"}, "ts": "2023-07-13 04:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZNU5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZNU5-1"}, "ts": "2023-07-13 04:46:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37275"}, "ts": "2023-07-13 04:46:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:46:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CB8"}, "ts": "2023-07-13 04:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5M9"}, "ts": "2023-07-13 04:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5M9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:47:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7713909", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:47:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7713909", "type": "PubMed"}, "ts": "2023-07-13 04:47:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21984185", "type": "PubMed"}, "ts": "2023-07-13 04:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21984185", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3379044", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:48:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3379044", "type": "PubMed"}, "ts": "2023-07-13 04:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2C6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:48:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2C6"}, "ts": "2023-07-13 04:48:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35739"}, "ts": "2023-07-13 04:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JG2"}, "ts": "2023-07-13 04:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG75", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:49:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG75"}, "ts": "2023-07-13 04:49:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:49:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXN2"}, "ts": "2023-07-13 04:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 04:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43280"}, "ts": "2023-07-13 04:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:50:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22692.125.125"}, "ts": "2023-07-13 04:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22692", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:50:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-13 04:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UG63", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UG63"}, "ts": "2023-07-13 04:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-13 04:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35556", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:51:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35556.513.513"}, "ts": "2023-07-13 04:51:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27321907", "type": "PubMed"}, "ts": "2023-07-13 04:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27321907", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:51:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-13 04:52:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PID6"}, "ts": "2023-07-13 04:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PID6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61221", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 04:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 04:54:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99403QU"}, "ts": "2023-07-13 04:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99403QU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 04:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-13 04:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 04:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV63", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 04:55:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IV63", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 04:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:55:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:55:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z127"}, "ts": "2023-07-13 04:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:55:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13007"}, "ts": "2023-07-13 04:55:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70CQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:55:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q70CQ3"}, "ts": "2023-07-13 04:55:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y657"}, "ts": "2023-07-13 04:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y657", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:55:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22083"}, "ts": "2023-07-13 04:56:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-13 04:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZ26-1"}, "ts": "2023-07-13 04:56:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZ26-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:56:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35932"}, "ts": "2023-07-13 04:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39979VO"}, "ts": "2023-07-13 04:57:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI60"}, "ts": "2023-07-13 04:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI60", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 04:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28994389", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:57:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28994389", "type": "PubMed"}, "ts": "2023-07-13 04:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28994389", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 04:57:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCE1"}, "ts": "2023-07-13 04:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11514619", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:58:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q969F8.216.216"}, "ts": "2023-07-13 04:59:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969F8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 04:59:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11514619", "type": "PubMed"}, "ts": "2023-07-13 04:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:59:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12473183", "type": "PubMed"}, "ts": "2023-07-13 04:59:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12473183", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 04:59:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:59:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C5J1"}, "ts": "2023-07-13 04:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5J1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 04:59:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N461.217.217"}, "ts": "2023-07-13 04:59:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N461", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 05:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 05:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 05:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 05:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 05:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 05:00:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12107178", "type": "PubMed"}, "ts": "2023-07-13 05:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12107178", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:00:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14672"}, "ts": "2023-07-13 05:01:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-13 05:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:01:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZC7"}, "ts": "2023-07-13 05:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:01:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61204", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:02:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61204.45.45"}, "ts": "2023-07-13 05:02:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15866891", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:02:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15866891", "type": "PubMed"}, "ts": "2023-07-13 05:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:02:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-13 05:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:02:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3X8R9"}, "ts": "2023-07-13 05:03:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96Q11"}, "ts": "2023-07-13 05:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:03:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-13 05:03:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:03:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41222"}, "ts": "2023-07-13 05:03:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:03:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZA78", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:03:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZA78"}, "ts": "2023-07-13 05:03:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3X8R9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25480299", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:03:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25480299", "type": "PubMed"}, "ts": "2023-07-13 05:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKS6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:03:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKS6"}, "ts": "2023-07-13 05:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYT1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:03:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYT1"}, "ts": "2023-07-13 05:03:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8F4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:03:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8F4-1"}, "ts": "2023-07-13 05:03:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21976273", "type": "PubMed"}, "ts": "2023-07-13 05:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21976273", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:04:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK54"}, "ts": "2023-07-13 05:04:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFD3"}, "ts": "2023-07-13 05:04:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFD3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:05:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "12975309"}, "ts": "2023-07-13 05:05:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 05:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R062", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R062"}, "ts": "2023-07-13 05:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05981"}, "ts": "2023-07-13 05:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g00052mo", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:05:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00959", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:06:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00959.1062.1062"}, "ts": "2023-07-13 05:06:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EB94", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:06:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EB94"}, "ts": "2023-07-13 05:06:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0S5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:06:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0S5"}, "ts": "2023-07-13 05:06:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18077"}, "ts": "2023-07-13 05:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70211", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:06:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70211.1267.1267"}, "ts": "2023-07-13 05:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:07:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43426"}, "ts": "2023-07-13 05:07:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 05:07:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52209"}, "ts": "2023-07-13 05:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 05:07:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15072", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:07:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15072.942.942"}, "ts": "2023-07-13 05:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01031-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:08:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:09:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43916"}, "ts": "2023-07-13 05:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBC3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:09:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBC3.100.100"}, "ts": "2023-07-13 05:09:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01844.47.47"}, "ts": "2023-07-13 05:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01844", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:09:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RUS2"}, "ts": "2023-07-13 05:09:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RUS2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:10:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXK5"}, "ts": "2023-07-13 05:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:10:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34020140", "type": "PubMed"}, "ts": "2023-07-13 05:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34020140", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10220111", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:11:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10220111", "type": "PubMed"}, "ts": "2023-07-13 05:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:12:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0AV96.123.123"}, "ts": "2023-07-13 05:12:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0AV96", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:12:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AT9"}, "ts": "2023-07-13 05:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95433", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:12:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95433"}, "ts": "2023-07-13 05:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14672", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35932", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:12:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60565", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:12:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60565.66.66"}, "ts": "2023-07-13 05:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7665576", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:13:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7665576", "type": "PubMed"}, "ts": "2023-07-13 05:13:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01160"}, "ts": "2023-07-13 05:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01160", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3B8N2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:13:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3B8N2"}, "ts": "2023-07-13 05:13:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95460.155.155"}, "ts": "2023-07-13 05:13:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95460", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:13:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56516VH"}, "ts": "2023-07-13 05:14:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56516VH"}, "ts": "2023-07-13 05:14:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00629"}, "ts": "2023-07-13 05:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43852", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:15:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43852"}, "ts": "2023-07-13 05:15:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253"}, "ts": "2023-07-13 05:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48356-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:15:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48356-1"}, "ts": "2023-07-13 05:15:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XC8-1"}, "ts": "2023-07-13 05:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XC8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:15:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-13 05:16:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49792-1"}, "ts": "2023-07-13 05:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49792-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:17:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:17:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXQ5"}, "ts": "2023-07-13 05:17:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88643-1"}, "ts": "2023-07-13 05:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88643-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:17:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C028"}, "ts": "2023-07-13 05:18:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C028", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:18:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U649"}, "ts": "2023-07-13 05:18:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56693", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:19:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56693"}, "ts": "2023-07-13 05:19:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:19:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZQ7"}, "ts": "2023-07-13 05:19:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZQ7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:19:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AY40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:19:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1AY40"}, "ts": "2023-07-13 05:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LI77"}, "ts": "2023-07-13 05:19:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H7Z3.323.323"}, "ts": "2023-07-13 05:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7Z3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:19:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVB4"}, "ts": "2023-07-13 05:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:19:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924V1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:20:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924V1"}, "ts": "2023-07-13 05:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15385", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:21:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15385.601.601"}, "ts": "2023-07-13 05:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12710", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:21:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12710.100.100"}, "ts": "2023-07-13 05:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64337-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:22:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64337-1"}, "ts": "2023-07-13 05:22:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33346791", "type": "PubMed"}, "ts": "2023-07-13 05:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33346791", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60847"}, "ts": "2023-07-13 05:22:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33346791", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 05:22:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11754004", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:22:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11754004", "type": "PubMed"}, "ts": "2023-07-13 05:22:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5NBY9-1"}, "ts": "2023-07-13 05:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5NBY9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:23:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:23:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:23:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-13 05:23:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14867"}, "ts": "2023-07-13 05:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14867", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:24:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-13 05:24:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-13 05:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-13 05:25:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-13 05:25:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2H4-1"}, "ts": "2023-07-13 05:25:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2H4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:25:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20023638", "type": "PubMed"}, "ts": "2023-07-13 05:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20023638", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:26:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-13 05:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSN7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:26:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSN7-1"}, "ts": "2023-07-13 05:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13873", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:26:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13873.173.173"}, "ts": "2023-07-13 05:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C5H8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:26:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C5H8"}, "ts": "2023-07-13 05:26:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99835-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:27:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99835-1"}, "ts": "2023-07-13 05:27:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:27:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNA4"}, "ts": "2023-07-13 05:27:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-13 05:27:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17425"}, "ts": "2023-07-13 05:27:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BIL5.727.727"}, "ts": "2023-07-13 05:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BIL5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17425", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PUS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:28:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PUS4"}, "ts": "2023-07-13 05:28:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-13 05:29:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36980"}, "ts": "2023-07-13 05:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56516VH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:30:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q672J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:30:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q672J9-1"}, "ts": "2023-07-13 05:30:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56516VH"}, "ts": "2023-07-13 05:30:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35498QW"}, "ts": "2023-07-13 05:30:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19024QK"}, "ts": "2023-07-13 05:30:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62055US"}, "ts": "2023-07-13 05:30:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R820-1"}, "ts": "2023-07-13 05:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R820-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:30:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:30:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-13 05:31:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FYB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:32:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FYB0"}, "ts": "2023-07-13 05:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50045TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95428", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:33:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95428.555.555"}, "ts": "2023-07-13 05:33:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52292"}, "ts": "2023-07-13 05:34:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5-1"}, "ts": "2023-07-13 05:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:34:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26038"}, "ts": "2023-07-13 05:34:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11717.256.256"}, "ts": "2023-07-13 05:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11717", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:35:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84228-1"}, "ts": "2023-07-13 05:35:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84228-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:35:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3MIT2"}, "ts": "2023-07-13 05:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MIT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:35:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NT68.149.149"}, "ts": "2023-07-13 05:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60886"}, "ts": "2023-07-13 05:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NT68", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63959", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 05:35:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q63959", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 05:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60886", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31169881", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:36:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31169881", "type": "PubMed"}, "ts": "2023-07-13 05:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31169881", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 05:36:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-13 05:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:36:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2"}, "ts": "2023-07-13 05:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14543", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:37:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14543.460.460"}, "ts": "2023-07-13 05:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:38:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBW0.165.165"}, "ts": "2023-07-13 05:38:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08590"}, "ts": "2023-07-13 05:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:38:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTL4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:38:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTL4-1"}, "ts": "2023-07-13 05:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:39:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3SXP7"}, "ts": "2023-07-13 05:39:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3SXP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:39:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3MHS7"}, "ts": "2023-07-13 05:39:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MHS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:39:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:39:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-13 05:40:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99NF1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99NF1"}, "ts": "2023-07-13 05:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42666HT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42666HT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:40:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-13 05:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19234OH"}, "ts": "2023-07-13 05:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54064OC"}, "ts": "2023-07-13 05:40:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-13 05:40:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28288", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28288"}, "ts": "2023-07-13 05:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26206665", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:41:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26206665", "type": "PubMed"}, "ts": "2023-07-13 05:41:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJF9"}, "ts": "2023-07-13 05:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97819", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97819"}, "ts": "2023-07-13 05:41:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 05:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2T1"}, "ts": "2023-07-13 05:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12904"}, "ts": "2023-07-13 05:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12904", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:41:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253-1"}, "ts": "2023-07-13 05:41:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 05:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43493", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:42:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43493.222.222"}, "ts": "2023-07-13 05:42:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:42:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N475", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:42:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N475"}, "ts": "2023-07-13 05:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02489", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:44:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02489"}, "ts": "2023-07-13 05:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2B2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:44:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2B2.728.728"}, "ts": "2023-07-13 05:44:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21730.28.28"}, "ts": "2023-07-13 05:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21730", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1Z9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:44:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1Z9"}, "ts": "2023-07-13 05:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:44:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:45:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A2"}, "ts": "2023-07-13 05:45:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-13 05:45:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16162394", "type": "PubMed"}, "ts": "2023-07-13 05:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16162394", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:45:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96T76.619.619"}, "ts": "2023-07-13 05:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K1G0"}, "ts": "2023-07-13 05:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K1G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:46:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61466"}, "ts": "2023-07-13 05:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61466", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51960", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:46:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51960"}, "ts": "2023-07-13 05:46:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08913"}, "ts": "2023-07-13 05:46:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:46:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12860.521.521"}, "ts": "2023-07-13 05:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:46:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96G97"}, "ts": "2023-07-13 05:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G97", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:46:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK65"}, "ts": "2023-07-13 05:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:46:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12850"}, "ts": "2023-07-13 05:47:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12850", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27050377", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:47:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27050377", "type": "PubMed"}, "ts": "2023-07-13 05:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0M6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 05:47:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Z0M6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 05:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71013KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:47:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16014", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:48:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16014.93.93"}, "ts": "2023-07-13 05:48:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66X93", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:48:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66X93"}, "ts": "2023-07-13 05:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:48:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25705"}, "ts": "2023-07-13 05:48:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25705", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2040623", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:48:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2040623", "type": "PubMed"}, "ts": "2023-07-13 05:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:48:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60391"}, "ts": "2023-07-13 05:48:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05CL8-1"}, "ts": "2023-07-13 05:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05CL8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:48:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06210"}, "ts": "2023-07-13 05:48:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ3"}, "ts": "2023-07-13 05:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:48:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26987903", "type": "PubMed"}, "ts": "2023-07-13 05:49:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26987903", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:49:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XI2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XI2-1"}, "ts": "2023-07-13 05:49:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M3T9"}, "ts": "2023-07-13 05:49:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M3T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:49:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11001926", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:49:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11001926", "type": "PubMed"}, "ts": "2023-07-13 05:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52292", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61762-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:50:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61762-1"}, "ts": "2023-07-13 05:50:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-13 05:50:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00533", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:50:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00533.225.225"}, "ts": "2023-07-13 05:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95427", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 05:50:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O95427", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 05:50:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:50:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14564007", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:51:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14564007", "type": "PubMed"}, "ts": "2023-07-13 05:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06889"}, "ts": "2023-07-13 05:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06889", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:52:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L34"}, "ts": "2023-07-13 05:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L34", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18065"}, "ts": "2023-07-13 05:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07359"}, "ts": "2023-07-13 05:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12879", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:52:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12879.309.309"}, "ts": "2023-07-13 05:52:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:52:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04003"}, "ts": "2023-07-13 05:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60602"}, "ts": "2023-07-13 05:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:54:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T200"}, "ts": "2023-07-13 05:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T200", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:54:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43683", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 05:55:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43683.1070.1070"}, "ts": "2023-07-13 05:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92769"}, "ts": "2023-07-13 05:55:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37868ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 05:56:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41146"}, "ts": "2023-07-13 05:56:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41146", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 05:56:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49225WK"}, "ts": "2023-07-13 05:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:56:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11021"}, "ts": "2023-07-13 05:56:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PJF5"}, "ts": "2023-07-13 05:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:57:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS40"}, "ts": "2023-07-13 05:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10253-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96P63"}, "ts": "2023-07-13 05:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:58:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25086746", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:58:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25086746", "type": "PubMed"}, "ts": "2023-07-13 05:58:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-13 05:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-13 05:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 05:58:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18837007", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 05:59:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18837007", "type": "PubMed"}, "ts": "2023-07-13 05:59:37 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 06:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 06:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 06:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 06:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 06:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 06:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12594516", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:00:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12594516", "type": "PubMed"}, "ts": "2023-07-13 06:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48764", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48764"}, "ts": "2023-07-13 06:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-13 06:00:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42677"}, "ts": "2023-07-13 06:00:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42677", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:02:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D771"}, "ts": "2023-07-13 06:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4LFA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:02:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4LFA9"}, "ts": "2023-07-13 06:02:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24090", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:02:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24090.138.138"}, "ts": "2023-07-13 06:02:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M9Q1"}, "ts": "2023-07-13 06:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M9Q1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:03:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:03:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y666.62.62"}, "ts": "2023-07-13 06:03:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55011"}, "ts": "2023-07-13 06:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJP0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 06:04:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69849"}, "ts": "2023-07-13 06:04:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJP0"}, "ts": "2023-07-13 06:04:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:04:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63261"}, "ts": "2023-07-13 06:04:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P06731", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 06:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:04:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-13 06:04:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2335567", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:05:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2335567", "type": "PubMed"}, "ts": "2023-07-13 06:05:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75351"}, "ts": "2023-07-13 06:05:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P1W9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:05:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P1W9.195.195"}, "ts": "2023-07-13 06:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:06:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00451.1274.1274"}, "ts": "2023-07-13 06:06:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-13 06:06:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-13 06:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:06:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60894"}, "ts": "2023-07-13 06:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD16", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:07:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TD16"}, "ts": "2023-07-13 06:07:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNH5-1"}, "ts": "2023-07-13 06:07:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNH5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:07:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHP7"}, "ts": "2023-07-13 06:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43652"}, "ts": "2023-07-13 06:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JWG6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:08:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JWG6-1"}, "ts": "2023-07-13 06:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41219", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:08:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41219"}, "ts": "2023-07-13 06:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:08:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-13 06:08:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5C9Z4"}, "ts": "2023-07-13 06:09:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5C9Z4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:09:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:09:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49184-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:09:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49184-1"}, "ts": "2023-07-13 06:09:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26402SO"}, "ts": "2023-07-13 06:09:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26402SO"}, "ts": "2023-07-13 06:09:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-13 06:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:10:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:10:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZRK6.208.208"}, "ts": "2023-07-13 06:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBQ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:10:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBQ9"}, "ts": "2023-07-13 06:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60886", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:11:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60886"}, "ts": "2023-07-13 06:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:11:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922R8"}, "ts": "2023-07-13 06:11:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36405"}, "ts": "2023-07-13 06:11:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:11:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06890"}, "ts": "2023-07-13 06:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06890", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-13 06:11:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:11:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCK3"}, "ts": "2023-07-13 06:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49225WK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP73-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:12:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP73-1"}, "ts": "2023-07-13 06:12:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G0M1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:13:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G0M1"}, "ts": "2023-07-13 06:13:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQC9"}, "ts": "2023-07-13 06:14:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50428-1"}, "ts": "2023-07-13 06:14:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50428-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:14:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53621", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:14:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53621"}, "ts": "2023-07-13 06:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90669BC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:15:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90669BC"}, "ts": "2023-07-13 06:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:16:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06986"}, "ts": "2023-07-13 06:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06986", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:17:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16552"}, "ts": "2023-07-13 06:17:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26151.347.347"}, "ts": "2023-07-13 06:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26151", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:17:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-13 06:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22566635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:18:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22566635", "type": "PubMed"}, "ts": "2023-07-13 06:18:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08784", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:18:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08784.154.154"}, "ts": "2023-07-13 06:18:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-13 06:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JG2"}, "ts": "2023-07-13 06:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55011", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:20:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60291"}, "ts": "2023-07-13 06:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6I3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60291", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:20:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6I3"}, "ts": "2023-07-13 06:20:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22310.516.516"}, "ts": "2023-07-13 06:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22310", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:20:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811Q0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811Q0-1"}, "ts": "2023-07-13 06:22:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6XJV4.44.44"}, "ts": "2023-07-13 06:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XJV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:22:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16656.296.296"}, "ts": "2023-07-13 06:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:22:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-13 06:22:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BH52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:22:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BH52"}, "ts": "2023-07-13 06:22:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:22:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C5J1"}, "ts": "2023-07-13 06:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5J1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 06:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10.1007/s00018-021-03863-1", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:23:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10.1007/s00018-021-03863-1", "type": "DOI"}, "ts": "2023-07-13 06:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14578-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:23:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14578-1"}, "ts": "2023-07-13 06:23:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09544.71.71"}, "ts": "2023-07-13 06:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09544", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:24:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61120", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 06:24:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61120"}, "ts": "2023-07-13 06:24:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95573"}, "ts": "2023-07-13 06:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:25:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22352"}, "ts": "2023-07-13 06:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24509911", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:25:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24509911", "type": "PubMed"}, "ts": "2023-07-13 06:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26402SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:25:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26402SO"}, "ts": "2023-07-13 06:25:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15843XU"}, "ts": "2023-07-13 06:25:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35029YA"}, "ts": "2023-07-13 06:25:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O35814-1", "cluster_type": "unselected"}, "ts": "2023-07-13 06:25:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35814-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35814-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 06:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:27:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYU2.625.625"}, "ts": "2023-07-13 06:27:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02686", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:27:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02686.146.146"}, "ts": "2023-07-13 06:27:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:27:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00194"}, "ts": "2023-07-13 06:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00194", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2W9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2W9-1"}, "ts": "2023-07-13 06:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBZ1"}, "ts": "2023-07-13 06:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:27:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-13 06:28:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00151"}, "ts": "2023-07-13 06:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:28:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26010", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:28:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26010"}, "ts": "2023-07-13 06:28:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15111", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:29:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15111.14.14"}, "ts": "2023-07-13 06:29:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:30:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZM1.1461.1461"}, "ts": "2023-07-13 06:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:30:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17242360", "type": "PubMed"}, "ts": "2023-07-13 06:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17242360", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24821-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:32:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24821-1.166.166"}, "ts": "2023-07-13 06:32:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81827"}, "ts": "2023-07-13 06:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXN1"}, "ts": "2023-07-13 06:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35112-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:33:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35112-1.167.167"}, "ts": "2023-07-13 06:33:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N283"}, "ts": "2023-07-13 06:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N283", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:34:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD9"}, "ts": "2023-07-13 06:34:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19958IL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:36:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-13 06:36:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGP4"}, "ts": "2023-07-13 06:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:36:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12644"}, "ts": "2023-07-13 06:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12644", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14964"}, "ts": "2023-07-13 06:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14964", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:36:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26010"}, "ts": "2023-07-13 06:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26010", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D1E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4D1E1"}, "ts": "2023-07-13 06:38:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 06:38:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1G6"}, "ts": "2023-07-13 06:38:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1G6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 06:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5THR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:39:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5THR3"}, "ts": "2023-07-13 06:39:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19443651", "type": "PubMed"}, "ts": "2023-07-13 06:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19443651", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15833"}, "ts": "2023-07-13 06:40:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15833", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75525"}, "ts": "2023-07-13 06:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17720710", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:40:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17720710", "type": "PubMed"}, "ts": "2023-07-13 06:40:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16240070", "type": "PubMed"}, "ts": "2023-07-13 06:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16240070", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:40:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J2D5"}, "ts": "2023-07-13 06:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J2D5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:40:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-13 06:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:41:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXG2"}, "ts": "2023-07-13 06:41:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24071.230.230"}, "ts": "2023-07-13 06:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24071", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46776", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46776"}, "ts": "2023-07-13 06:42:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60330.688.688"}, "ts": "2023-07-13 06:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60330", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:43:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12200473", "type": "PubMed"}, "ts": "2023-07-13 06:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12200473", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:43:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DF62"}, "ts": "2023-07-13 06:43:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43351"}, "ts": "2023-07-13 06:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DF62", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:43:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42677.78.78"}, "ts": "2023-07-13 06:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42677", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:44:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15599"}, "ts": "2023-07-13 06:44:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02655"}, "ts": "2023-07-13 06:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21266449", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:45:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21266449", "type": "PubMed"}, "ts": "2023-07-13 06:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:45:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H871"}, "ts": "2023-07-13 06:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:46:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU56"}, "ts": "2023-07-13 06:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9030741", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:46:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9030741", "type": "PubMed"}, "ts": "2023-07-13 06:46:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:46:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94988"}, "ts": "2023-07-13 06:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76050", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:47:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76050"}, "ts": "2023-07-13 06:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-13 06:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00526", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:47:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00526.127.127"}, "ts": "2023-07-13 06:47:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00441"}, "ts": "2023-07-13 06:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20042"}, "ts": "2023-07-13 06:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20042", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:47:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12235"}, "ts": "2023-07-13 06:47:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35687VS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:47:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35687VS"}, "ts": "2023-07-13 06:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2H5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:47:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R2H5.661.661"}, "ts": "2023-07-13 06:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSZ9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 06:48:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSZ9"}, "ts": "2023-07-13 06:48:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BS35"}, "ts": "2023-07-13 06:48:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08182IE"}, "ts": "2023-07-13 06:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-13 06:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BS35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:48:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-13 06:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:48:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-13 06:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:49:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:49:44 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01236", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 06:49:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01236", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:49:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-13 06:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:50:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6327276", "type": "PubMed"}, "ts": "2023-07-13 06:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6327276", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:50:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25445"}, "ts": "2023-07-13 06:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMX9"}, "ts": "2023-07-13 06:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IY67"}, "ts": "2023-07-13 06:50:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:50:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:51:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZK5"}, "ts": "2023-07-13 06:51:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-13 06:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:52:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49279"}, "ts": "2023-07-13 06:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TEA6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:52:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TEA6.64.64"}, "ts": "2023-07-13 06:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:53:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6Q629.748.748"}, "ts": "2023-07-13 06:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q629", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BX65-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:53:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BX65-1"}, "ts": "2023-07-13 06:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22736", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-13 06:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22736"}, "ts": "2023-07-13 06:53:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32551IQ"}, "ts": "2023-07-13 06:53:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32551IQ"}, "ts": "2023-07-13 06:53:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-13 06:53:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68668TB"}, "ts": "2023-07-13 06:53:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-13 06:53:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 06:53:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-13 06:53:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-13 06:53:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-13 06:53:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-13 06:53:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-13 06:53:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 06:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11067927", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:53:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11067927", "type": "PubMed"}, "ts": "2023-07-13 06:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXK8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 06:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXK8"}, "ts": "2023-07-13 06:54:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-13 06:55:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10036234", "type": "PubMed"}, "ts": "2023-07-13 06:55:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20711NK"}, "ts": "2023-07-13 06:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10036234", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20711NK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23396"}, "ts": "2023-07-13 06:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0W4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-13 06:55:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N0W4.710.710"}, "ts": "2023-07-13 06:55:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:55:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9P6"}, "ts": "2023-07-13 06:55:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05026"}, "ts": "2023-07-13 06:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18825", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:55:49 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P18825", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 06:55:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36405"}, "ts": "2023-07-13 06:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:55:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35112-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:56:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35112-1.167.167"}, "ts": "2023-07-13 06:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:56:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y294-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 06:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y294-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y294-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 06:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z422", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:56:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z422.105.105"}, "ts": "2023-07-13 06:56:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97160DA"}, "ts": "2023-07-13 06:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G97160DA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02468", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:56:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02468.1378.1378"}, "ts": "2023-07-13 06:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:56:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03157"}, "ts": "2023-07-13 06:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25325", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:56:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25325"}, "ts": "2023-07-13 06:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:56:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34010028", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 06:57:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34010028", "type": "PubMed"}, "ts": "2023-07-13 06:57:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60203", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:57:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P60203.116.116"}, "ts": "2023-07-13 06:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:57:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22352"}, "ts": "2023-07-13 06:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP73-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:57:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP73-1"}, "ts": "2023-07-13 06:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PVX1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 06:57:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "E9PVX1-1", "cluster_type": "unselected"}, "ts": "2023-07-13 06:57:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PVX1-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 06:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WBP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:58:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WBP0"}, "ts": "2023-07-13 06:58:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTL9"}, "ts": "2023-07-13 06:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:59:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-13 06:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15611BA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 06:59:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15611BA"}, "ts": "2023-07-13 06:59:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47710-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 06:59:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47710-1.69.69"}, "ts": "2023-07-13 06:59:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14202", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14202"}, "ts": "2023-07-13 06:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZW4"}, "ts": "2023-07-13 06:59:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 06:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 07:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 07:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 07:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 07:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 07:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 07:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LTP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:00:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LTP8"}, "ts": "2023-07-13 07:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:01:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00898-1"}, "ts": "2023-07-13 07:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00898-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 07:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:03:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P45985.261.261"}, "ts": "2023-07-13 07:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45985", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21728"}, "ts": "2023-07-13 07:03:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21728", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:03:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O14523", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14523", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:05:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20023"}, "ts": "2023-07-13 07:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59598", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:05:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-13 07:05:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59598"}, "ts": "2023-07-13 07:05:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4334191", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:05:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "4334191", "type": "PubMed"}, "ts": "2023-07-13 07:05:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921V7"}, "ts": "2023-07-13 07:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZM9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:06:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZM9"}, "ts": "2023-07-13 07:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811B1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811B1"}, "ts": "2023-07-13 07:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61916"}, "ts": "2023-07-13 07:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13473-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:06:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13473-1.257.257"}, "ts": "2023-07-13 07:06:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NZM9-1"}, "ts": "2023-07-13 07:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZM9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:06:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHJ9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:06:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHJ9"}, "ts": "2023-07-13 07:06:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-13 07:07:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:07:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22735"}, "ts": "2023-07-13 07:07:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 07:07:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:07:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHV9"}, "ts": "2023-07-13 07:07:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75695"}, "ts": "2023-07-13 07:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25377891", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:07:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25377891", "type": "PubMed"}, "ts": "2023-07-13 07:07:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95295"}, "ts": "2023-07-13 07:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14498", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:08:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14498.99.99"}, "ts": "2023-07-13 07:08:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9N2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:08:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8N9N2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:08:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8661159", "type": "PubMed"}, "ts": "2023-07-13 07:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8661159", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3477804", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:08:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3477804", "type": "PubMed"}, "ts": "2023-07-13 07:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13790-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:08:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13790-1.139.139"}, "ts": "2023-07-13 07:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32551IQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:09:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59927DK"}, "ts": "2023-07-13 07:09:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32551IQ"}, "ts": "2023-07-13 07:09:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84964XI"}, "ts": "2023-07-13 07:09:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 07:09:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08735ZX"}, "ts": "2023-07-13 07:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32551IQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23396", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68668TB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:09:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMG0-1"}, "ts": "2023-07-13 07:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMG0-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:10:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7851889", "type": "PubMed"}, "ts": "2023-07-13 07:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7851889", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:10:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01844.153.153"}, "ts": "2023-07-13 07:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01844", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:10:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15769474", "type": "PubMed"}, "ts": "2023-07-13 07:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15769474", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UZ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:11:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UZ6.372.372"}, "ts": "2023-07-13 07:11:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:11:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYH5"}, "ts": "2023-07-13 07:11:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63137"}, "ts": "2023-07-13 07:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63137", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:11:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q2VPA4-1", "cluster_type": "unselected"}, "ts": "2023-07-13 07:11:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2VPA4-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:11:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2VPA4-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 07:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:11:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15061"}, "ts": "2023-07-13 07:11:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05026", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:11:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADK7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:11:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADK7-1"}, "ts": "2023-07-13 07:11:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35550"}, "ts": "2023-07-13 07:12:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21387411", "type": "PubMed"}, "ts": "2023-07-13 07:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21387411", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:13:10 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P97321", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97321", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:14:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NW7"}, "ts": "2023-07-13 07:14:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86"}, "ts": "2023-07-13 07:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:14:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q58WW2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:14:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q58WW2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:14:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31391", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:14:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P31391", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31391", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 07:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00053MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11738831", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:15:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11738831", "type": "PubMed"}, "ts": "2023-07-13 07:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y487"}, "ts": "2023-07-13 07:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:15:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJK0.18.18"}, "ts": "2023-07-13 07:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJK0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:15:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QX47", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:16:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QX47.150.150"}, "ts": "2023-07-13 07:16:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13807.8.8"}, "ts": "2023-07-13 07:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13807", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05193", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:16:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05193.822.822"}, "ts": "2023-07-13 07:16:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03518.641.641"}, "ts": "2023-07-13 07:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03518", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQK1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:16:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CQK1.76.76"}, "ts": "2023-07-13 07:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AKI9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:17:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B1AKI9.347.347"}, "ts": "2023-07-13 07:17:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12628182", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:17:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12628182", "type": "PubMed"}, "ts": "2023-07-13 07:17:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30084YQ"}, "ts": "2023-07-13 07:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVK1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:18:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UVK1.453.453"}, "ts": "2023-07-13 07:18:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13219", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:18:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13219", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:18:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13219", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 07:18:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43681"}, "ts": "2023-07-13 07:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43681", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:18:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-13 07:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WBN7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:19:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WBN7"}, "ts": "2023-07-13 07:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14831", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:19:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14831"}, "ts": "2023-07-13 07:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92879"}, "ts": "2023-07-13 07:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92879", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:19:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22079"}, "ts": "2023-07-13 07:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22079", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13241", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:22:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13241"}, "ts": "2023-07-13 07:22:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66377OC"}, "ts": "2023-07-13 07:22:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:23:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11032"}, "ts": "2023-07-13 07:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11032", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95295", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:24:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UGI6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:24:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGI6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:24:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33907827", "type": "PubMed"}, "ts": "2023-07-13 07:24:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33907827", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:24:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O35814-1", "cluster_type": "unselected"}, "ts": "2023-07-13 07:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35814-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35814-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-13 07:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34531375", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:25:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34531375", "type": "PubMed"}, "ts": "2023-07-13 07:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34531375", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 07:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:25:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZCD3"}, "ts": "2023-07-13 07:25:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZCD3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:26:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "19940141"}, "ts": "2023-07-13 07:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 07:26:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-13 07:26:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:26:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UWM9.497.497"}, "ts": "2023-07-13 07:26:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26717", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26717"}, "ts": "2023-07-13 07:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:27:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-13 07:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:27:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95486-1.914.914"}, "ts": "2023-07-13 07:27:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZA1"}, "ts": "2023-07-13 07:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:28:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35550", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41227", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:28:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P41227", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:28:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21359", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:29:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21359.28.28"}, "ts": "2023-07-13 07:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-13 07:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04150", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:30:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04150"}, "ts": "2023-07-13 07:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:30:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LX8"}, "ts": "2023-07-13 07:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "I3L273", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:31:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "I3L273"}, "ts": "2023-07-13 07:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99523", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:31:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99523.274.274"}, "ts": "2023-07-13 07:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6K7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:31:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6K7"}, "ts": "2023-07-13 07:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:32:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13151"}, "ts": "2023-07-13 07:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13158-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:32:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13158-1"}, "ts": "2023-07-13 07:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9013879", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:33:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9013879", "type": "PubMed"}, "ts": "2023-07-13 07:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEH6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:33:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEH6-1"}, "ts": "2023-07-13 07:33:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NCW6.428.428"}, "ts": "2023-07-13 07:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:34:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15735-1"}, "ts": "2023-07-13 07:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15735-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91023GB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:35:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56817-1"}, "ts": "2023-07-13 07:35:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GV17"}, "ts": "2023-07-13 07:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GV17", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:35:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00232.96.96"}, "ts": "2023-07-13 07:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00232", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:36:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPU3.301.301"}, "ts": "2023-07-13 07:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP25-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:37:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DP25-1"}, "ts": "2023-07-13 07:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11257498", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:37:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11257498", "type": "PubMed"}, "ts": "2023-07-13 07:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3456579", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:37:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3456579", "type": "PubMed"}, "ts": "2023-07-13 07:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:38:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21290RB"}, "ts": "2023-07-13 07:38:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UEF7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:38:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UEF7.115.115"}, "ts": "2023-07-13 07:38:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17433EW"}, "ts": "2023-07-13 07:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y217", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:38:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y217"}, "ts": "2023-07-13 07:38:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-13 07:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00429", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:39:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00429.330.330"}, "ts": "2023-07-13 07:39:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RN5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:39:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RN5.198.198"}, "ts": "2023-07-13 07:39:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14343MU"}, "ts": "2023-07-13 07:40:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20929"}, "ts": "2023-07-13 07:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XY7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:40:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XY7-1"}, "ts": "2023-07-13 07:40:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20929"}, "ts": "2023-07-13 07:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00813"}, "ts": "2023-07-13 07:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00813", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:40:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-13 07:40:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZA7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:40:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZA7.568.568"}, "ts": "2023-07-13 07:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14522", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:40:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14522.654.654"}, "ts": "2023-07-13 07:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16305-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:40:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16305-1.141.141"}, "ts": "2023-07-13 07:40:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Gsk3b", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 07:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:41:52 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Gsk3b"}, "ts": "2023-07-13 07:41:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Gsk3b", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Gsk3b"}, "ts": "2023-07-13 07:41:53 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 07:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "552d3bf9f19379853caf03de1dba0306", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 07:41:54 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "552d3bf9f19379853caf03de1dba0306", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 07:41:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49841-1"}, "ts": "2023-07-13 07:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49841-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36544"}, "ts": "2023-07-13 07:42:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV60-1"}, "ts": "2023-07-13 07:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV60-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36544", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20983SP"}, "ts": "2023-07-13 07:42:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:42:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35712", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:42:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35712"}, "ts": "2023-07-13 07:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Mapk1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 07:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:42:35 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Mapk1"}, "ts": "2023-07-13 07:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Mapk1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Mapk1"}, "ts": "2023-07-13 07:42:36 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 07:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a5ff673532bcd1f857ea07508213683f", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 07:42:37 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "a5ff673532bcd1f857ea07508213683f", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 07:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28482-1"}, "ts": "2023-07-13 07:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28482-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63085-1"}, "ts": "2023-07-13 07:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63085-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y294-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:42:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y294-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y294-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-13 07:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Mapk3", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 07:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:43:09 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Mapk3"}, "ts": "2023-07-13 07:43:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Mapk3", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Mapk3"}, "ts": "2023-07-13 07:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d8539e1dce91501cf4ea2049e0db0a31", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 07:43:12 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 07:43:12 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d8539e1dce91501cf4ea2049e0db0a31", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 07:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21708-1"}, "ts": "2023-07-13 07:43:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21708-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-13 07:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27361-1"}, "ts": "2023-07-13 07:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27361-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z553", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z553"}, "ts": "2023-07-13 07:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQ08"}, "ts": "2023-07-13 07:43:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294"}, "ts": "2023-07-13 07:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-13 07:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63844-1"}, "ts": "2023-07-13 07:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63844-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21708-1"}, "ts": "2023-07-13 07:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21708-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Rps6ka1", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 07:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:44:29 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Rps6ka1"}, "ts": "2023-07-13 07:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Rps6ka1", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Rps6ka1"}, "ts": "2023-07-13 07:44:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 07:44:33 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "55e4c38e8e812ed67d3d3589793c5f81", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 07:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "55e4c38e8e812ed67d3d3589793c5f81", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 07:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59536", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59536"}, "ts": "2023-07-13 07:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18653-1"}, "ts": "2023-07-13 07:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UN74"}, "ts": "2023-07-13 07:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15418-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15418-1"}, "ts": "2023-07-13 07:44:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UN74", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:44:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81274"}, "ts": "2023-07-13 07:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81274", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Ikbkb", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 07:45:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:45:11 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Ikbkb"}, "ts": "2023-07-13 07:45:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Ikbkb", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Ikbkb"}, "ts": "2023-07-13 07:45:12 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 07:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "502c13cbb303a4b4a4fa2271b87491a1", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 07:45:13 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "502c13cbb303a4b4a4fa2271b87491a1", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 07:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14920-1"}, "ts": "2023-07-13 07:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14920-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:45:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88351-1"}, "ts": "2023-07-13 07:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88351-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Tlr4", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 07:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:45:45 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Tlr4"}, "ts": "2023-07-13 07:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 07:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Tlr4", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Tlr4"}, "ts": "2023-07-13 07:45:46 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 07:45:49 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "79a9bb6c69363367102210eafdff636b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 07:45:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "79a9bb6c69363367102210eafdff636b", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 07:45:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y490", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:45:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y490.1146.1146"}, "ts": "2023-07-13 07:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZH40-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZH40-1"}, "ts": "2023-07-13 07:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00206-1"}, "ts": "2023-07-13 07:45:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00206-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUK6-1"}, "ts": "2023-07-13 07:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUK6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:46:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43823.221.221"}, "ts": "2023-07-13 07:46:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12346-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12346-1"}, "ts": "2023-07-13 07:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95628", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:46:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95628.301.301"}, "ts": "2023-07-13 07:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2G6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2G6"}, "ts": "2023-07-13 07:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGJ1"}, "ts": "2023-07-13 07:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI37-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI37-1"}, "ts": "2023-07-13 07:46:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-13 07:47:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14202.49.49"}, "ts": "2023-07-13 07:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14202", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-13 07:47:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24524"}, "ts": "2023-07-13 07:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24524", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22188167", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:48:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22188167", "type": "PubMed"}, "ts": "2023-07-13 07:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:48:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-13 07:48:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EQN3.254.254"}, "ts": "2023-07-13 07:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQN3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17909029", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:49:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17909029", "type": "PubMed"}, "ts": "2023-07-13 07:49:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6M7.776.776"}, "ts": "2023-07-13 07:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:49:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17931"}, "ts": "2023-07-13 07:49:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92542.243.243"}, "ts": "2023-07-13 07:49:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92542", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:49:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09874"}, "ts": "2023-07-13 07:49:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26190834", "type": "PubMed"}, "ts": "2023-07-13 07:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26190834", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49745-1"}, "ts": "2023-07-13 07:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49745-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:51:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16606358", "type": "PubMed"}, "ts": "2023-07-13 07:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16606358", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:51:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y287", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:51:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y287"}, "ts": "2023-07-13 07:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13945-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:51:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13945-1"}, "ts": "2023-07-13 07:51:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "12004055"}, "ts": "2023-07-13 07:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613"}, "ts": "2023-07-13 07:52:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16270"}, "ts": "2023-07-13 07:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16270", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPB8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:52:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPB8-1"}, "ts": "2023-07-13 07:52:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-13 07:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12324418", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:53:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12324418", "type": "PubMed"}, "ts": "2023-07-13 07:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35070", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:53:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35070.7.7"}, "ts": "2023-07-13 07:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:54:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-13 07:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17433EW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:54:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10562567", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:55:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10562567", "type": "PubMed"}, "ts": "2023-07-13 07:55:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15118"}, "ts": "2023-07-13 07:55:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 07:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16305-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:55:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16305-1.141.141"}, "ts": "2023-07-13 07:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:56:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13541"}, "ts": "2023-07-13 07:56:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW66-1"}, "ts": "2023-07-13 07:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW66-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:56:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0C4"}, "ts": "2023-07-13 07:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:57:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:57:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMV9"}, "ts": "2023-07-13 07:57:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16614850", "type": "PubMed"}, "ts": "2023-07-13 07:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16614850", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 07:57:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95865.261.261"}, "ts": "2023-07-13 07:57:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95865", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:57:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C013"}, "ts": "2023-07-13 07:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61361", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F8VPJ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:57:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q61361", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:57:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F8VPJ6-1"}, "ts": "2023-07-13 07:57:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2K9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 07:58:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2K9.429.429"}, "ts": "2023-07-13 07:58:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20983SP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 07:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23242-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:58:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23242-1"}, "ts": "2023-07-13 07:58:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15120", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15120"}, "ts": "2023-07-13 07:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZA1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 07:59:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:59:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8WZA1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 07:59:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:59:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE60"}, "ts": "2023-07-13 07:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 07:59:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15633", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 07:59:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15633"}, "ts": "2023-07-13 07:59:54 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 08:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 08:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 08:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 08:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 08:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 08:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:00:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7982951", "type": "PubMed"}, "ts": "2023-07-13 08:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7982951", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36268"}, "ts": "2023-07-13 08:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36268", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TRH8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:00:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TRH8-1"}, "ts": "2023-07-13 08:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80X71-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:00:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80X71-1"}, "ts": "2023-07-13 08:00:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26897XI"}, "ts": "2023-07-13 08:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26897XI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:00:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26897XI"}, "ts": "2023-07-13 08:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85740DB"}, "ts": "2023-07-13 08:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 08:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64730RH"}, "ts": "2023-07-13 08:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33340AE"}, "ts": "2023-07-13 08:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-13 08:01:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25092.212.212"}, "ts": "2023-07-13 08:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25092", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26897XI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:01:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26897XI"}, "ts": "2023-07-13 08:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86T82"}, "ts": "2023-07-13 08:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGJ1"}, "ts": "2023-07-13 08:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35520"}, "ts": "2023-07-13 08:01:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41438"}, "ts": "2023-07-13 08:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59538", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:01:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59538"}, "ts": "2023-07-13 08:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBL3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:02:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UBL3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62993", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:02:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P62993.164.164"}, "ts": "2023-07-13 08:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-13 08:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D518", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D518"}, "ts": "2023-07-13 08:03:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q17RR3.156.156"}, "ts": "2023-07-13 08:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17RR3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 08:04:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21964"}, "ts": "2023-07-13 08:04:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04592-1"}, "ts": "2023-07-13 08:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04592-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35601", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:05:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35601"}, "ts": "2023-07-13 08:05:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94985"}, "ts": "2023-07-13 08:05:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94985", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:05:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JR6"}, "ts": "2023-07-13 08:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JR6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:05:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49913"}, "ts": "2023-07-13 08:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16246722", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:06:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16246722", "type": "PubMed"}, "ts": "2023-07-13 08:06:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-13 08:06:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46459"}, "ts": "2023-07-13 08:07:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14983.292.292"}, "ts": "2023-07-13 08:07:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14983", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:07:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19879874", "type": "PubMed"}, "ts": "2023-07-13 08:07:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19879874", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:07:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:07:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTW9"}, "ts": "2023-07-13 08:07:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28585349", "type": "PubMed"}, "ts": "2023-07-13 08:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28585349", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H208", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:08:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H208.291.291"}, "ts": "2023-07-13 08:08:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35006254", "type": "PubMed"}, "ts": "2023-07-13 08:08:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35006254", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:08:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15056", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:08:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15056"}, "ts": "2023-07-13 08:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17900573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:08:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17900573", "type": "PubMed"}, "ts": "2023-07-13 08:08:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2G6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:08:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2G6"}, "ts": "2023-07-13 08:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99788", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:09:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99788.350.350"}, "ts": "2023-07-13 08:09:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Z80-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:09:31 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q91Z80-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:09:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30487245", "type": "PubMed"}, "ts": "2023-07-13 08:10:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30487245", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAH1"}, "ts": "2023-07-13 08:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96C01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:11:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96C01"}, "ts": "2023-07-13 08:11:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:11:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-13 08:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:11:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-13 08:12:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13541", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6T3U3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:12:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6T3U3", "cluster_type": "unselected"}, "ts": "2023-07-13 08:12:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6T3U3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 08:12:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IBW4"}, "ts": "2023-07-13 08:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IBW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:12:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14727"}, "ts": "2023-07-13 08:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:12:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-13 08:12:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28939558", "type": "PubMed"}, "ts": "2023-07-13 08:12:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28939558", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:12:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-13 08:13:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35024764", "type": "PubMed"}, "ts": "2023-07-13 08:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35024764", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14645126", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:13:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14645126", "type": "PubMed"}, "ts": "2023-07-13 08:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13761", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:13:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13761"}, "ts": "2023-07-13 08:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UK7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42666HT).", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:13:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UK7"}, "ts": "2023-07-13 08:13:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42666HT)."}, "ts": "2023-07-13 08:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N815", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:15:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N815"}, "ts": "2023-07-13 08:15:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPD7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:15:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DPD7"}, "ts": "2023-07-13 08:15:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29460"}, "ts": "2023-07-13 08:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75096", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:15:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75096.1468.1468"}, "ts": "2023-07-13 08:15:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8R1G6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:15:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1G6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92626", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:16:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92626.891.891"}, "ts": "2023-07-13 08:16:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06890"}, "ts": "2023-07-13 08:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:16:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33778"}, "ts": "2023-07-13 08:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06890", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:16:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15121"}, "ts": "2023-07-13 08:16:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60565.66.66"}, "ts": "2023-07-13 08:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60565", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVU1-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:16:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVU1-1.381.381"}, "ts": "2023-07-13 08:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP79"}, "ts": "2023-07-13 08:17:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17478130", "type": "PubMed"}, "ts": "2023-07-13 08:17:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17478130", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:17:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75886-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:17:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75886-1"}, "ts": "2023-07-13 08:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41438", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:17:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3S9.173.173"}, "ts": "2023-07-13 08:17:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3S9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX30-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:17:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CX30-1"}, "ts": "2023-07-13 08:17:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T200.963.963"}, "ts": "2023-07-13 08:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T200", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99624", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:18:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99624"}, "ts": "2023-07-13 08:18:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2420009", "type": "PubMed"}, "ts": "2023-07-13 08:19:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2420009", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-13 08:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00495"}, "ts": "2023-07-13 08:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00495", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:20:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53728DU"}, "ts": "2023-07-13 08:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21964", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03005MJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:21:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03005MJ"}, "ts": "2023-07-13 08:21:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9419374", "type": "PubMed"}, "ts": "2023-07-13 08:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9419374", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:22:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15822.2220.2220"}, "ts": "2023-07-13 08:22:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3B7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:22:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3B7"}, "ts": "2023-07-13 08:22:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:22:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSN2"}, "ts": "2023-07-13 08:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12259", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z5L9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:23:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z5L9"}, "ts": "2023-07-13 08:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1R4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:23:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1R4"}, "ts": "2023-07-13 08:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:24:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40199.197.197"}, "ts": "2023-07-13 08:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40199", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:25:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95573"}, "ts": "2023-07-13 08:25:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14690", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:25:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14690"}, "ts": "2023-07-13 08:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYU4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:25:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYU4"}, "ts": "2023-07-13 08:25:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q63604-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63604-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:25:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-13 08:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:26:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WR49-1"}, "ts": "2023-07-13 08:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WR49-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBZ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:26:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TBZ5.347.347"}, "ts": "2023-07-13 08:26:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACX5-1"}, "ts": "2023-07-13 08:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACX5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:26:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35590.795.795"}, "ts": "2023-07-13 08:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35590", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:27:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13473-1.257.257"}, "ts": "2023-07-13 08:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13473-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:28:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K021"}, "ts": "2023-07-13 08:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92765", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:28:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92765.49.49"}, "ts": "2023-07-13 08:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:28:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00748.66.66"}, "ts": "2023-07-13 08:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00748", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:28:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X27"}, "ts": "2023-07-13 08:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N475", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:28:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N475"}, "ts": "2023-07-13 08:28:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:29:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21581"}, "ts": "2023-07-13 08:29:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:29:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-13 08:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P032-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:29:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P032-1"}, "ts": "2023-07-13 08:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5IJ48", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:29:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5IJ48"}, "ts": "2023-07-13 08:29:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBS5.140.140"}, "ts": "2023-07-13 08:30:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBS5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:30:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96JS3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JS3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JS3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 08:30:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q810A1"}, "ts": "2023-07-13 08:30:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810A1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93063"}, "ts": "2023-07-13 08:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3MIR4"}, "ts": "2023-07-13 08:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MIR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:31:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ42"}, "ts": "2023-07-13 08:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "V9GX81-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:31:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43823.221.221"}, "ts": "2023-07-13 08:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:31:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "V9GX81-1", "cluster_type": "unselected"}, "ts": "2023-07-13 08:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "V9GX81-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 08:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z186", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:31:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z186"}, "ts": "2023-07-13 08:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:31:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-13 08:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:32:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14142", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:32:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14142.392.392"}, "ts": "2023-07-13 08:32:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4B7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:32:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4B7"}, "ts": "2023-07-13 08:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:32:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RI0"}, "ts": "2023-07-13 08:33:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19096"}, "ts": "2023-07-13 08:33:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0U6"}, "ts": "2023-07-13 08:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0U6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:33:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07157.1325.1325"}, "ts": "2023-07-13 08:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07157", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:33:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11137.530.530"}, "ts": "2023-07-13 08:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11137", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:34:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15460"}, "ts": "2023-07-13 08:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:34:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 08:34:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 08:34:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 08:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULW0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:35:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9ULW0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:35:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25122"}, "ts": "2023-07-13 08:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13497"}, "ts": "2023-07-13 08:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:35:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53728DU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92667"}, "ts": "2023-07-13 08:36:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92667", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EP69-1"}, "ts": "2023-07-13 08:36:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP69-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:36:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHJ3.513.513"}, "ts": "2023-07-13 08:36:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHJ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:36:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIG2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:36:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIG2-1"}, "ts": "2023-07-13 08:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6H8Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:36:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6H8Y1"}, "ts": "2023-07-13 08:36:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBJ1"}, "ts": "2023-07-13 08:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBJ1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AQ25"}, "ts": "2023-07-13 08:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AQ25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6N043", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:37:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6N043.722.722"}, "ts": "2023-07-13 08:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-13 08:37:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NCD3.211.211"}, "ts": "2023-07-13 08:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCD3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02810", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:38:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02810"}, "ts": "2023-07-13 08:38:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.151.151"}, "ts": "2023-07-13 08:39:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XJE5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20668652", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:39:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20668652", "type": "PubMed"}, "ts": "2023-07-13 08:39:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:39:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-13 08:39:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.154.154"}, "ts": "2023-07-13 08:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XJE5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:40:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43652.255.255"}, "ts": "2023-07-13 08:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43652", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H553-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:41:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H553-1"}, "ts": "2023-07-13 08:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03895SR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:43:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03895SR"}, "ts": "2023-07-13 08:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:43:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31785.155.155"}, "ts": "2023-07-13 08:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-13 08:43:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6I3"}, "ts": "2023-07-13 08:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:43:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-13 08:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6I3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:43:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:43:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-13 08:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26974035", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:45:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26974035", "type": "PubMed"}, "ts": "2023-07-13 08:45:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4-1"}, "ts": "2023-07-13 08:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K097", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:45:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K097"}, "ts": "2023-07-13 08:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:46:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZQ8.113.113"}, "ts": "2023-07-13 08:46:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94768.113.113"}, "ts": "2023-07-13 08:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94768", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88658", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88658"}, "ts": "2023-07-13 08:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWU7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWU7"}, "ts": "2023-07-13 08:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLH8"}, "ts": "2023-07-13 08:47:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18480409", "type": "PubMed"}, "ts": "2023-07-13 08:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18480409", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:48:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5"}, "ts": "2023-07-13 08:48:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BRG2.325.325"}, "ts": "2023-07-13 08:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRG2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:49:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96G61", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G61", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G61", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 08:49:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11766.351.351"}, "ts": "2023-07-13 08:49:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:49:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5CZA5.7.7"}, "ts": "2023-07-13 08:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5CZA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:50:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23588.355.355"}, "ts": "2023-07-13 08:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23588", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:50:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q7Z388", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 08:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z388", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 08:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04937", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:51:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04937.542.542"}, "ts": "2023-07-13 08:51:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGX1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:51:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGX1.71.71"}, "ts": "2023-07-13 08:51:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43488-1"}, "ts": "2023-07-13 08:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43488-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:51:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5V8"}, "ts": "2023-07-13 08:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5V8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-13 08:51:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-13 08:52:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-13 08:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12314", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:52:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75140"}, "ts": "2023-07-13 08:52:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12314.138.138"}, "ts": "2023-07-13 08:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U44"}, "ts": "2023-07-13 08:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9512493", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:53:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9512493", "type": "PubMed"}, "ts": "2023-07-13 08:53:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:53:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13811NF", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.0.0 Safari/537.36 Edg/114.0.1823.43"}, "ts": "2023-07-13 08:55:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73686WG"}, "ts": "2023-07-13 08:55:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q7M2"}, "ts": "2023-07-13 08:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q7M2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:55:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:55:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6WKZ7.479.479"}, "ts": "2023-07-13 08:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6WKZ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:55:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12755606", "type": "PubMed"}, "ts": "2023-07-13 08:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12755606", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UND0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:55:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UND0.151.151"}, "ts": "2023-07-13 08:55:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22098NU"}, "ts": "2023-07-13 08:55:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22098NU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:56:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCM1"}, "ts": "2023-07-13 08:56:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30700838", "type": "PubMed"}, "ts": "2023-07-13 08:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30700838", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1X3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:56:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1X3.122.122"}, "ts": "2023-07-13 08:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9636146", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:56:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9636146", "type": "PubMed"}, "ts": "2023-07-13 08:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:56:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGI6"}, "ts": "2023-07-13 08:56:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13811NF"}, "ts": "2023-07-13 08:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:56:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13811NF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:56:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-13 08:56:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50502.340.340"}, "ts": "2023-07-13 08:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50502", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41252", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:57:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41252.1234.1234"}, "ts": "2023-07-13 08:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55189-1"}, "ts": "2023-07-13 08:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55189-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:57:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:57:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "17554007"}, "ts": "2023-07-13 08:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 08:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13811NF"}, "ts": "2023-07-13 08:57:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23088YX"}, "ts": "2023-07-13 08:57:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20956ZV"}, "ts": "2023-07-13 08:57:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70663-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:57:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27815BZ"}, "ts": "2023-07-13 08:57:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-13 08:57:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70663-1"}, "ts": "2023-07-13 08:57:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27658GQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 08:58:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:58:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIP2"}, "ts": "2023-07-13 08:58:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27658GQ"}, "ts": "2023-07-13 08:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1333955", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 08:58:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1333955", "type": "PubMed"}, "ts": "2023-07-13 08:58:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09661", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:58:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09661"}, "ts": "2023-07-13 08:58:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 08:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 08:58:18 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 08:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2H8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:58:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2H8"}, "ts": "2023-07-13 08:58:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22455"}, "ts": "2023-07-13 08:58:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86TU7.460.460"}, "ts": "2023-07-13 08:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TU7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61532-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 08:58:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61532-1"}, "ts": "2023-07-13 08:58:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A020"}, "ts": "2023-07-13 08:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A020", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 08:59:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHN6.262.262"}, "ts": "2023-07-13 08:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHN6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 08:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-13 08:59:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-13 08:59:36 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 09:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 09:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 09:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 09:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 09:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 09:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59282"}, "ts": "2023-07-13 09:00:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59282", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:00:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88917"}, "ts": "2023-07-13 09:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10619", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:00:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10619"}, "ts": "2023-07-13 09:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29416-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:00:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29416-1"}, "ts": "2023-07-13 09:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H310", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:01:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H310"}, "ts": "2023-07-13 09:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:01:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZV9.125.125"}, "ts": "2023-07-13 09:01:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-13 09:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 09:01:09 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 09:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:01:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3Y3"}, "ts": "2023-07-13 09:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15907476", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:01:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15907476", "type": "PubMed"}, "ts": "2023-07-13 09:01:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13478"}, "ts": "2023-07-13 09:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13478", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A5P0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:02:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A1A5P0.207.207"}, "ts": "2023-07-13 09:02:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1908096", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:02:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1908096", "type": "PubMed"}, "ts": "2023-07-13 09:02:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGU4"}, "ts": "2023-07-13 09:02:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGU4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:02:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-13 09:03:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKF5.174.174"}, "ts": "2023-07-13 09:03:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKF5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:03:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:04:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18403135", "type": "PubMed"}, "ts": "2023-07-13 09:04:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18403135", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:04:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-13 09:04:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02401-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:04:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02401-1"}, "ts": "2023-07-13 09:04:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08718-1"}, "ts": "2023-07-13 09:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08718-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:05:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NCS4.242.242"}, "ts": "2023-07-13 09:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCS4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:05:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27485778", "type": "PubMed"}, "ts": "2023-07-13 09:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27485778", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZD2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:06:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZD2.230.230"}, "ts": "2023-07-13 09:06:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZB51", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYB5"}, "ts": "2023-07-13 09:06:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "D3ZB51.1207.1207"}, "ts": "2023-07-13 09:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:07:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-13 09:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:07:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15945"}, "ts": "2023-07-13 09:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28255270", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:07:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28255270", "type": "PubMed"}, "ts": "2023-07-13 09:07:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P287.112.112"}, "ts": "2023-07-13 09:07:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:07:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08631.411.411"}, "ts": "2023-07-13 09:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08631", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:08:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15199138", "type": "PubMed"}, "ts": "2023-07-13 09:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15199138", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:08:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62028.1122.1122"}, "ts": "2023-07-13 09:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:08:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PGF5"}, "ts": "2023-07-13 09:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75140", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62028", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9702198", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:09:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9702198", "type": "PubMed"}, "ts": "2023-07-13 09:09:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08529-1"}, "ts": "2023-07-13 09:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08529-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:09:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:09:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMQ1"}, "ts": "2023-07-13 09:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:10:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9425276", "type": "PubMed"}, "ts": "2023-07-13 09:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9425276", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:10:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99832.344.344"}, "ts": "2023-07-13 09:10:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99832", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:10:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:10:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2"}, "ts": "2023-07-13 09:10:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03596YS"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04672QB"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04784US"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09528DL"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10486CT"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11460AB"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12580WI"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02402FF"}, "ts": "2023-07-13 09:11:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12313PD"}, "ts": "2023-07-13 09:11:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12849CJ"}, "ts": "2023-07-13 09:11:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-13 09:11:05 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P81274", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 09:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81274", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:11:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42765"}, "ts": "2023-07-13 09:12:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYM4"}, "ts": "2023-07-13 09:12:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYM4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:12:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8MWY0.754.754"}, "ts": "2023-07-13 09:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MWY0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19493", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:12:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19493"}, "ts": "2023-07-13 09:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3U4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:12:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N3U4.172.172"}, "ts": "2023-07-13 09:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:13:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15822.2220.2220"}, "ts": "2023-07-13 09:13:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01728"}, "ts": "2023-07-13 09:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01728", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:13:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47318KU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:13:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47318KU"}, "ts": "2023-07-13 09:13:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31946", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:13:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31946.232.232"}, "ts": "2023-07-13 09:13:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:13:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26027925", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:14:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26027925", "type": "PubMed"}, "ts": "2023-07-13 09:14:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29966", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:14:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29966"}, "ts": "2023-07-13 09:14:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-13 09:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:15:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63HQ2.216.216"}, "ts": "2023-07-13 09:15:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LC8"}, "ts": "2023-07-13 09:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LC8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLI7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:15:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLI7-1"}, "ts": "2023-07-13 09:15:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UK0"}, "ts": "2023-07-13 09:15:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:15:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40424"}, "ts": "2023-07-13 09:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4U4S6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:16:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4U4S6.815.815"}, "ts": "2023-07-13 09:16:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11344.337.337"}, "ts": "2023-07-13 09:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11344", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:16:15 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y4K1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 09:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4K1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76024", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:16:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O76024.716.716"}, "ts": "2023-07-13 09:16:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-13 09:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31358"}, "ts": "2023-07-13 09:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35914"}, "ts": "2023-07-13 09:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35914", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:17:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JI78"}, "ts": "2023-07-13 09:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI78", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:17:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RK0"}, "ts": "2023-07-13 09:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:18:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00747-1.365.365"}, "ts": "2023-07-13 09:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UV17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:19:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UV17"}, "ts": "2023-07-13 09:19:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27391WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:19:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-13 09:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXY8-1"}, "ts": "2023-07-13 09:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXY8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G61", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:20:05 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96G61", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 09:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G61", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-13 09:20:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275"}, "ts": "2023-07-13 09:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32M45"}, "ts": "2023-07-13 09:20:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32M45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:20:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUR7"}, "ts": "2023-07-13 09:20:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUR7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:20:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA0"}, "ts": "2023-07-13 09:20:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:20:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99733", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:21:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99733"}, "ts": "2023-07-13 09:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PPI1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:21:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5PPI1.204.204"}, "ts": "2023-07-13 09:21:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHC9"}, "ts": "2023-07-13 09:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:22:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9813381", "type": "PubMed"}, "ts": "2023-07-13 09:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9813381", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:22:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48356"}, "ts": "2023-07-13 09:22:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-13 09:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:22:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12860.558.558"}, "ts": "2023-07-13 09:22:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.14.14"}, "ts": "2023-07-13 09:23:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95486-1.914.914"}, "ts": "2023-07-13 09:23:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95486-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23140633", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:23:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23140633", "type": "PubMed"}, "ts": "2023-07-13 09:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V92", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:24:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q91V92", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 09:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "myc", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-13 09:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 09:24:30 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "myc"}, "ts": "2023-07-13 09:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "myc", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=myc"}, "ts": "2023-07-13 09:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c-myc", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-13 09:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 09:24:44 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "c-myc"}, "ts": "2023-07-13 09:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c-myc", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=c-myc"}, "ts": "2023-07-13 09:24:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18680753", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:25:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18680753", "type": "PubMed"}, "ts": "2023-07-13 09:25:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "dd4387d6c6cb3b820e6d27a10f5c6352", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 09:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "dd4387d6c6cb3b820e6d27a10f5c6352", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22823520", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9727070", "type": "PubMed"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22823520", "type": "PubMed"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9727070", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-13 09:25:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63889NK"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-13 09:25:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TWW8"}, "ts": "2023-07-13 09:25:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TWW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:25:52 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "c-myc"}, "ts": "2023-07-13 09:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 09:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c-myc", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=c-myc"}, "ts": "2023-07-13 09:25:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01776"}, "ts": "2023-07-13 09:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01776", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:26:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-13 09:26:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921I1"}, "ts": "2023-07-13 09:26:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VC97"}, "ts": "2023-07-13 09:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VC97", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:27:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22061"}, "ts": "2023-07-13 09:27:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9718306", "type": "PubMed"}, "ts": "2023-07-13 09:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9718306", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PGN1"}, "ts": "2023-07-13 09:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGN1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:27:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DQ2"}, "ts": "2023-07-13 09:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:27:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PAL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:28:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AAY5.25.25"}, "ts": "2023-07-13 09:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AAY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:28:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PAL1"}, "ts": "2023-07-13 09:28:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-13 09:28:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27810909", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:28:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27810909", "type": "PubMed"}, "ts": "2023-07-13 09:28:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V92", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:29:06 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q91V92", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 09:29:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54821"}, "ts": "2023-07-13 09:29:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16279944", "type": "PubMed"}, "ts": "2023-07-13 09:30:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16279944", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10409732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:30:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10409732", "type": "PubMed"}, "ts": "2023-07-13 09:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9X8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:31:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9X8"}, "ts": "2023-07-13 09:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:31:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6N8.256.256"}, "ts": "2023-07-13 09:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-13 09:31:38 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-13 09:31:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y266"}, "ts": "2023-07-13 09:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:31:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TH73-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:32:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TH73-1"}, "ts": "2023-07-13 09:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZX15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:32:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZX15"}, "ts": "2023-07-13 09:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35398", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:32:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35398"}, "ts": "2023-07-13 09:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31358", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C163", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:32:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C163"}, "ts": "2023-07-13 09:33:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15489227", "type": "PubMed"}, "ts": "2023-07-13 09:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15489227", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90669BC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:33:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90669BC"}, "ts": "2023-07-13 09:33:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29568394", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:34:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29568394", "type": "PubMed"}, "ts": "2023-07-13 09:34:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49748"}, "ts": "2023-07-13 09:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48356", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:35:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15407YE"}, "ts": "2023-07-13 09:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PU57-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:35:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PU57-1"}, "ts": "2023-07-13 09:35:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49759"}, "ts": "2023-07-13 09:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49759", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75095"}, "ts": "2023-07-13 09:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:36:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-13 09:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHI3-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:36:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHI3-1"}, "ts": "2023-07-13 09:36:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52799"}, "ts": "2023-07-13 09:36:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52799", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937-1"}, "ts": "2023-07-13 09:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6A5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6A5"}, "ts": "2023-07-13 09:37:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:37:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95376"}, "ts": "2023-07-13 09:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95376", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:37:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14727"}, "ts": "2023-07-13 09:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:37:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-13 09:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8K2U0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:37:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8K2U0"}, "ts": "2023-07-13 09:37:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969T4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:37:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969T4"}, "ts": "2023-07-13 09:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50416", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:37:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50416.744.744"}, "ts": "2023-07-13 09:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35874"}, "ts": "2023-07-13 09:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:38:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:38:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:38:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUM3.100.100"}, "ts": "2023-07-13 09:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94769", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:38:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU68"}, "ts": "2023-07-13 09:38:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94769.378.378"}, "ts": "2023-07-13 09:38:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HK3"}, "ts": "2023-07-13 09:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HK3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:38:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70207"}, "ts": "2023-07-13 09:38:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U284", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:38:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3U284.194.194"}, "ts": "2023-07-13 09:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-13 09:39:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-13 09:39:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32926LW"}, "ts": "2023-07-13 09:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:40:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQZ9"}, "ts": "2023-07-13 09:40:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80X86"}, "ts": "2023-07-13 09:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80X86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:42:31 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5H5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 09:42:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14791", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:43:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14791.39.39"}, "ts": "2023-07-13 09:43:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:43:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0PJZ3"}, "ts": "2023-07-13 09:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0PJZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:43:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UTA9"}, "ts": "2023-07-13 09:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:43:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZF6.1053.1053"}, "ts": "2023-07-13 09:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZF6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFZ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFZ4-1"}, "ts": "2023-07-13 09:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:44:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28660"}, "ts": "2023-07-13 09:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PVX1-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-13 09:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16260", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:45:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16260.206.206"}, "ts": "2023-07-13 09:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T0T0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:45:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T0T0-1"}, "ts": "2023-07-13 09:45:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54821", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:45:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-13 09:45:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VF75"}, "ts": "2023-07-13 09:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VF75", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 09:45:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:45:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXS6.204.204"}, "ts": "2023-07-13 09:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61554", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:46:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32239", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:46:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61554.1705.1705"}, "ts": "2023-07-13 09:46:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32239"}, "ts": "2023-07-13 09:46:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-13 09:46:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13231"}, "ts": "2023-07-13 09:46:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:46:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZY8"}, "ts": "2023-07-13 09:46:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30596474", "type": "PubMed"}, "ts": "2023-07-13 09:47:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30596474", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:47:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92609.44.44"}, "ts": "2023-07-13 09:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92609", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78334", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:48:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78334"}, "ts": "2023-07-13 09:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921Q7"}, "ts": "2023-07-13 09:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921Q7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:48:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19532"}, "ts": "2023-07-13 09:48:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:48:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:48:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-13 09:48:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06733"}, "ts": "2023-07-13 09:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:50:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0E7"}, "ts": "2023-07-13 09:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26022", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:50:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26022"}, "ts": "2023-07-13 09:50:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33609NS"}, "ts": "2023-07-13 09:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15407YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:51:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q640R3-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 09:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q640R3-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 09:51:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9742219", "type": "PubMed"}, "ts": "2023-07-13 09:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9742219", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:52:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29317"}, "ts": "2023-07-13 09:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0W4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:54:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N0W4.603.603"}, "ts": "2023-07-13 09:54:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13237"}, "ts": "2023-07-13 09:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:54:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25116"}, "ts": "2023-07-13 09:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90766ZI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:55:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14112.145.145"}, "ts": "2023-07-13 09:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:55:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90766ZI"}, "ts": "2023-07-13 09:55:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75027"}, "ts": "2023-07-13 09:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:55:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:55:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33890711", "type": "PubMed"}, "ts": "2023-07-13 09:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33890711", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:55:30 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 09:55:36 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "9f800425b27ce2e471e9324216a9a513", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 09:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9f800425b27ce2e471e9324216a9a513", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 09:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:55:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29320.523.523"}, "ts": "2023-07-13 09:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29320", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8380065", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:55:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8380065", "type": "PubMed"}, "ts": "2023-07-13 09:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MYC", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-13 09:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 09:55:54 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "MYC"}, "ts": "2023-07-13 09:55:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "MYC", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=MYC"}, "ts": "2023-07-13 09:55:55 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 09:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3d2554bf95e76fe96fe084932a45d0c1", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 09:55:56 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3d2554bf95e76fe96fe084932a45d0c1", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 09:55:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ53"}, "ts": "2023-07-13 09:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:56:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106-2"}, "ts": "2023-07-13 09:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:56:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11553624", "type": "PubMed"}, "ts": "2023-07-13 09:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11553624", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:56:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 09:56:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JTZ9.722.722"}, "ts": "2023-07-13 09:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTZ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 09:56:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58598BO"}, "ts": "2023-07-13 09:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58598BO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 09:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23658157", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:57:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23658157", "type": "PubMed"}, "ts": "2023-07-13 09:57:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z0K6"}, "ts": "2023-07-13 09:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z0K6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:57:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17095"}, "ts": "2023-07-13 09:57:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26671989", "type": "PubMed"}, "ts": "2023-07-13 09:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26671989", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 09:57:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G0J3"}, "ts": "2023-07-13 09:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G0J3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 09:59:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7-1"}, "ts": "2023-07-13 09:59:13 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 10:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 10:00:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A2Y4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 10:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 10:00:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2A2Y4.422.422"}, "ts": "2023-07-13 10:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 10:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 10:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14667"}, "ts": "2023-07-13 10:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14667", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-13 10:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-13 10:00:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9J9"}, "ts": "2023-07-13 10:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9J9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88839", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88839"}, "ts": "2023-07-13 10:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75237SS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:01:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75237SS"}, "ts": "2023-07-13 10:01:17 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y219", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 10:01:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y219", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:01:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:01:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGJ0.173.173"}, "ts": "2023-07-13 10:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 10:02:38 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 10:02:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 10:02:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02724.22.22"}, "ts": "2023-07-13 10:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02724", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 10:02:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 10:02:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61574-1"}, "ts": "2023-07-13 10:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61574-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:02:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8929361", "type": "PubMed"}, "ts": "2023-07-13 10:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8929361", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:03:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84086-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:03:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84086-1"}, "ts": "2023-07-13 10:03:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-13 10:03:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08727.81.81"}, "ts": "2023-07-13 10:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08727", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:03:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20354224", "type": "PubMed"}, "ts": "2023-07-13 10:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20354224", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:03:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTR8"}, "ts": "2023-07-13 10:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEA6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:06:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NEA6.372.372"}, "ts": "2023-07-13 10:06:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52306"}, "ts": "2023-07-13 10:06:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:06:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60174"}, "ts": "2023-07-13 10:06:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:06:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SY80"}, "ts": "2023-07-13 10:06:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SY80", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35611", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:06:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35611.12.12"}, "ts": "2023-07-13 10:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UYI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:06:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UYI1"}, "ts": "2023-07-13 10:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35304", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:06:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35304"}, "ts": "2023-07-13 10:06:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41105"}, "ts": "2023-07-13 10:07:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03135-1"}, "ts": "2023-07-13 10:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41105", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:07:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515"}, "ts": "2023-07-13 10:07:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-13 10:07:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35926TG"}, "ts": "2023-07-13 10:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XJE5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:08:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.14.14"}, "ts": "2023-07-13 10:08:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02788"}, "ts": "2023-07-13 10:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02788", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:09:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34424299", "type": "PubMed"}, "ts": "2023-07-13 10:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34424299", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:09:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34424299", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 10:09:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:09:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY84"}, "ts": "2023-07-13 10:09:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22159414", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:09:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22159414", "type": "PubMed"}, "ts": "2023-07-13 10:09:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-13 10:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55289", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:09:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55289"}, "ts": "2023-07-13 10:09:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8702752", "type": "PubMed"}, "ts": "2023-07-13 10:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8702752", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0E3"}, "ts": "2023-07-13 10:09:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-13 10:09:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-13 10:09:58 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-13 10:09:59 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-13 10:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:10:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07998"}, "ts": "2023-07-13 10:10:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z5L9"}, "ts": "2023-07-13 10:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8U3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:10:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8U3"}, "ts": "2023-07-13 10:10:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z5L9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:10:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22223"}, "ts": "2023-07-13 10:10:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22223"}, "ts": "2023-07-13 10:10:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14174"}, "ts": "2023-07-13 10:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:11:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19525939", "type": "PubMed"}, "ts": "2023-07-13 10:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19525939", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:11:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46736"}, "ts": "2023-07-13 10:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46736", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:11:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXN2.112.112"}, "ts": "2023-07-13 10:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:12:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H8A4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:12:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5H8A4", "cluster_type": "unselected"}, "ts": "2023-07-13 10:12:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3B8"}, "ts": "2023-07-13 10:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H8A4", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 10:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3B8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:12:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01098"}, "ts": "2023-07-13 10:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51681", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:12:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51681.349.349"}, "ts": "2023-07-13 10:12:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPR4"}, "ts": "2023-07-13 10:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49006", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49006"}, "ts": "2023-07-13 10:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JB7-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:14:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JB7-1"}, "ts": "2023-07-13 10:14:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68363"}, "ts": "2023-07-13 10:14:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-13 10:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63772-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:16:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63772-1"}, "ts": "2023-07-13 10:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80XD8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:16:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80XD8-1"}, "ts": "2023-07-13 10:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:16:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O08532.136.136"}, "ts": "2023-07-13 10:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08532", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:17:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925F2"}, "ts": "2023-07-13 10:17:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-13 10:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25940", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:17:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25940.1034.1034"}, "ts": "2023-07-13 10:17:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-13 10:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2D6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:18:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2D6"}, "ts": "2023-07-13 10:18:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5W0A0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:18:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5W0A0"}, "ts": "2023-07-13 10:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23471", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:19:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23471.59.59"}, "ts": "2023-07-13 10:19:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-13 10:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:19:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42336"}, "ts": "2023-07-13 10:19:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42336", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:19:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-13 10:19:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-13 10:19:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-13 10:19:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXS4"}, "ts": "2023-07-13 10:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:20:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55209-1"}, "ts": "2023-07-13 10:20:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55209-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:20:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 10:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-13 10:21:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63096"}, "ts": "2023-07-13 10:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T5M9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T5M9"}, "ts": "2023-07-13 10:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BH3"}, "ts": "2023-07-13 10:22:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BH3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:22:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:22:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF66"}, "ts": "2023-07-13 10:22:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 10:22:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-13 10:22:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 10:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6X2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:22:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-13 10:22:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 10:22:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05121"}, "ts": "2023-07-13 10:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06356OH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:23:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 10:23:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:23:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15175QG"}, "ts": "2023-07-13 10:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10425SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:23:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24948044", "type": "PubMed"}, "ts": "2023-07-13 10:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24948044", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:23:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L94", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:23:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L94"}, "ts": "2023-07-13 10:23:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35926TG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan_list.html", "message": "page access"}, "ts": "2023-07-13 10:23:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8697101", "type": "PubMed"}, "ts": "2023-07-13 10:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8697101", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan_list.html", "message": "Disabled Logging"}, "ts": "2023-07-13 10:24:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:24:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21625211", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:24:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57679", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:24:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21625211", "type": "PubMed"}, "ts": "2023-07-13 10:24:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P57679.714.714"}, "ts": "2023-07-13 10:24:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54132"}, "ts": "2023-07-13 10:24:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75369"}, "ts": "2023-07-13 10:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:25:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAQ2"}, "ts": "2023-07-13 10:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:25:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF66"}, "ts": "2023-07-13 10:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731-1"}, "ts": "2023-07-13 10:25:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:26:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9727070", "type": "PubMed"}, "ts": "2023-07-13 10:26:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:26:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9727070", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:26:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16880"}, "ts": "2023-07-13 10:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41250-1"}, "ts": "2023-07-13 10:26:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P53347.44.44"}, "ts": "2023-07-13 10:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53347", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:26:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28843.144.144"}, "ts": "2023-07-13 10:26:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28843", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:26:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:26:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:26:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J262"}, "ts": "2023-07-13 10:27:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J262", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22301-1"}, "ts": "2023-07-13 10:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22301-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXM7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:27:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXM7-1"}, "ts": "2023-07-13 10:27:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92828"}, "ts": "2023-07-13 10:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SWA1"}, "ts": "2023-07-13 10:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SWA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:28:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V0F0"}, "ts": "2023-07-13 10:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V0F0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21677-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:29:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21677-1"}, "ts": "2023-07-13 10:29:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16919458", "type": "PubMed"}, "ts": "2023-07-13 10:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16919458", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10936190", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:31:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10936190", "type": "PubMed"}, "ts": "2023-07-13 10:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:31:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQC2.596.596"}, "ts": "2023-07-13 10:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQC2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:31:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSI4"}, "ts": "2023-07-13 10:31:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13191.428.428"}, "ts": "2023-07-13 10:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13191", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:32:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75376.1064.1064"}, "ts": "2023-07-13 10:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75376", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:33:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62417.51.51"}, "ts": "2023-07-13 10:33:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62417", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:33:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-13 10:33:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:33:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02649"}, "ts": "2023-07-13 10:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G77459ND", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:34:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77459ND"}, "ts": "2023-07-13 10:34:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43007"}, "ts": "2023-07-13 10:34:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VE98.104.104"}, "ts": "2023-07-13 10:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VE98", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:34:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61460", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:34:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61460"}, "ts": "2023-07-13 10:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLH5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:34:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q4KLH5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 10:34:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPA5"}, "ts": "2023-07-13 10:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08146BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLH5", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-13 10:35:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-13 10:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVS2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:36:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVS2.201.201"}, "ts": "2023-07-13 10:36:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-13 10:36:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60245", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:36:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60245.79.79"}, "ts": "2023-07-13 10:36:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070"}, "ts": "2023-07-13 10:37:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-13 10:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10359787", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:37:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10359787", "type": "PubMed"}, "ts": "2023-07-13 10:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80U96"}, "ts": "2023-07-13 10:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80U96", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-13 10:38:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50281", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:38:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50281.291.291"}, "ts": "2023-07-13 10:38:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13772", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 10:38:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13772", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:38:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7981201", "type": "PubMed"}, "ts": "2023-07-13 10:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7981201", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:39:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13361"}, "ts": "2023-07-13 10:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:39:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3UWC3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:39:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3UWC3-1"}, "ts": "2023-07-13 10:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:39:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8L6"}, "ts": "2023-07-13 10:39:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:39:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05067"}, "ts": "2023-07-13 10:39:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-13 10:39:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-13 10:39:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-13 10:39:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 10:39:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-13 10:39:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89205CJ"}, "ts": "2023-07-13 10:39:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-13 10:39:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35107SO"}, "ts": "2023-07-13 10:39:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31665QC"}, "ts": "2023-07-13 10:39:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66088HZ"}, "ts": "2023-07-13 10:39:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-13 10:39:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6NZM9-1", "cluster_type": "unselected"}, "ts": "2023-07-13 10:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZM9-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZM9-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 10:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00483", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:39:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00483"}, "ts": "2023-07-13 10:39:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63173"}, "ts": "2023-07-13 10:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:40:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06702"}, "ts": "2023-07-13 10:41:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-13 10:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41250-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:42:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30044"}, "ts": "2023-07-13 10:42:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99KE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:42:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99KE3"}, "ts": "2023-07-13 10:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H999", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:42:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H999.316.316"}, "ts": "2023-07-13 10:42:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VEJ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:42:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VEJ4-1"}, "ts": "2023-07-13 10:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39448BE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:43:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39448BE"}, "ts": "2023-07-13 10:43:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-13 10:43:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-13 10:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:43:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:43:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47900"}, "ts": "2023-07-13 10:43:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60981-1"}, "ts": "2023-07-13 10:43:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:43:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6N8-1"}, "ts": "2023-07-13 10:43:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-13 10:45:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKA4.1144.1144"}, "ts": "2023-07-13 10:45:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKA4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:45:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:45:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92828"}, "ts": "2023-07-13 10:45:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19571574", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:46:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19571574", "type": "PubMed"}, "ts": "2023-07-13 10:46:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12766176", "type": "PubMed"}, "ts": "2023-07-13 10:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12766176", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:46:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQP3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:47:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQP3.783.783"}, "ts": "2023-07-13 10:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19892943", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:47:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19892943", "type": "PubMed"}, "ts": "2023-07-13 10:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:47:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6EMK4.454.454"}, "ts": "2023-07-13 10:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6EMK4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43489"}, "ts": "2023-07-13 10:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43489", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:47:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00586UK"}, "ts": "2023-07-13 10:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00586UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "gm2", "user": "Undecided", "type": "user", "page": "about", "message": "Performing Global Search"}, "ts": "2023-07-13 10:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 10:47:51 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "gm2"}, "ts": "2023-07-13 10:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 10:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "gm2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=gm2"}, "ts": "2023-07-13 10:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56a1fbd40e78d5541845f48086c46ce3", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 10:47:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56a1fbd40e78d5541845f48086c46ce3", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 10:47:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79389NT"}, "ts": "2023-07-13 10:47:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56478LD"}, "ts": "2023-07-13 10:47:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45058HZ"}, "ts": "2023-07-13 10:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:48:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TC93", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:48:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TC93"}, "ts": "2023-07-13 10:48:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45058HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:48:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45058HZ"}, "ts": "2023-07-13 10:48:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6GTX8.139.139"}, "ts": "2023-07-13 10:48:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99968DX"}, "ts": "2023-07-13 10:48:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22312GP"}, "ts": "2023-07-13 10:48:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19671XU"}, "ts": "2023-07-13 10:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GTX8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11983"}, "ts": "2023-07-13 10:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:48:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A799-1"}, "ts": "2023-07-13 10:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A799-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XJE5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:49:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.206.206"}, "ts": "2023-07-13 10:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16897771", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:49:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16897771", "type": "PubMed"}, "ts": "2023-07-13 10:49:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:50:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25694427", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:50:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25694427", "type": "PubMed"}, "ts": "2023-07-13 10:50:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08122.267.267"}, "ts": "2023-07-13 10:50:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08122", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:50:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97718-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97718-1"}, "ts": "2023-07-13 10:50:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13111.855.855"}, "ts": "2023-07-13 10:50:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13111", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:50:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60806"}, "ts": "2023-07-13 10:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60806", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:51:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-13 10:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:51:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-13 10:51:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:51:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF66"}, "ts": "2023-07-13 10:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWM5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:51:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UWM5.121.121"}, "ts": "2023-07-13 10:51:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:51:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12770674", "type": "PubMed"}, "ts": "2023-07-13 10:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12770674", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-13 10:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:52:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7TSH8.520.520"}, "ts": "2023-07-13 10:52:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSH8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30033487", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:53:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30033487", "type": "PubMed"}, "ts": "2023-07-13 10:53:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62838", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:53:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62838"}, "ts": "2023-07-13 10:53:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43679-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:54:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43679-1"}, "ts": "2023-07-13 10:54:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPA5.1560.1560"}, "ts": "2023-07-13 10:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:54:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH02", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:54:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NH02.6.6"}, "ts": "2023-07-13 10:54:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:55:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51654-1.151.151"}, "ts": "2023-07-13 10:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05067", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:55:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05187DJ"}, "ts": "2023-07-13 10:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:55:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05187DJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:55:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05187DJ"}, "ts": "2023-07-13 10:55:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32904GJ"}, "ts": "2023-07-13 10:55:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68914XE"}, "ts": "2023-07-13 10:55:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15530", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:55:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15530.545.545"}, "ts": "2023-07-13 10:55:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 10:55:31 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 10:55:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70372"}, "ts": "2023-07-13 10:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:55:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P08424", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 10:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08424", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:56:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43516.443.443"}, "ts": "2023-07-13 10:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43516", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:56:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122-1"}, "ts": "2023-07-13 10:56:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23450XE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:56:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23450XE"}, "ts": "2023-07-13 10:56:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53680"}, "ts": "2023-07-13 10:56:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23450XE"}, "ts": "2023-07-13 10:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81399MY"}, "ts": "2023-07-13 10:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43523TH"}, "ts": "2023-07-13 10:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42033RV"}, "ts": "2023-07-13 10:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09546QO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:57:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09546QO"}, "ts": "2023-07-13 10:57:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09546QO"}, "ts": "2023-07-13 10:57:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68158BT"}, "ts": "2023-07-13 10:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42666HT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:57:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-13 10:57:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:57:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42666HT"}, "ts": "2023-07-13 10:57:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-13 10:57:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54064OC"}, "ts": "2023-07-13 10:57:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19234OH"}, "ts": "2023-07-13 10:57:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-13 10:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06702", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:57:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13501.59.59"}, "ts": "2023-07-13 10:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:57:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35637.26.26"}, "ts": "2023-07-13 10:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35637", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:57:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30044", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZP80", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 10:58:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6ZP80", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 10:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z478", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:58:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z478"}, "ts": "2023-07-13 10:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 10:59:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00144"}, "ts": "2023-07-13 10:59:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86U44"}, "ts": "2023-07-13 10:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJ96", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 10:59:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJ96"}, "ts": "2023-07-13 10:59:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 10:59:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PK6.451.451"}, "ts": "2023-07-13 10:59:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22713238", "type": "PubMed"}, "ts": "2023-07-13 10:59:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22713238", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 10:59:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 10:59:48 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 11:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 11:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 11:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 11:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 11:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 11:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5KU26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:00:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5KU26.451.451"}, "ts": "2023-07-13 11:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GYQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:00:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56UD9"}, "ts": "2023-07-13 11:00:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6GYQ0.347.347"}, "ts": "2023-07-13 11:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56UD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14047PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80UB0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80UB0"}, "ts": "2023-07-13 11:01:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61954", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:01:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61954"}, "ts": "2023-07-13 11:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5R1X6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:01:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5R1X6"}, "ts": "2023-07-13 11:01:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45209NR"}, "ts": "2023-07-13 11:01:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG85"}, "ts": "2023-07-13 11:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG85", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:01:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCK0"}, "ts": "2023-07-13 11:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R160", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:02:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9R160.318.318"}, "ts": "2023-07-13 11:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDQ1"}, "ts": "2023-07-13 11:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21335234", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:03:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21335234", "type": "PubMed"}, "ts": "2023-07-13 11:03:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32127020", "type": "PubMed"}, "ts": "2023-07-13 11:03:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32127020", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:03:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6G9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:04:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6G9"}, "ts": "2023-07-13 11:04:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BX70", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:04:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BX70.2442.2442"}, "ts": "2023-07-13 11:04:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PIF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:05:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PIF2"}, "ts": "2023-07-13 11:05:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15389.537.537"}, "ts": "2023-07-13 11:05:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15389", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:05:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YD5"}, "ts": "2023-07-13 11:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61764"}, "ts": "2023-07-13 11:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04843", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:05:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04843"}, "ts": "2023-07-13 11:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YD5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61764", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06432", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:06:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06432.79.79"}, "ts": "2023-07-13 11:06:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q64455.317.317"}, "ts": "2023-07-13 11:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-13 11:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73721RY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:07:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73721RY"}, "ts": "2023-07-13 11:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XFV6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:07:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:07:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XFV6"}, "ts": "2023-07-13 11:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20525889", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:08:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20525889", "type": "PubMed"}, "ts": "2023-07-13 11:08:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:08:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97793"}, "ts": "2023-07-13 11:08:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14847", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:08:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14847.113.113"}, "ts": "2023-07-13 11:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 11:08:41 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 11:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 11:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "BMP-2", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-13 11:08:45 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "BMP-2"}, "ts": "2023-07-13 11:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 11:08:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "BMP-2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=BMP-2"}, "ts": "2023-07-13 11:08:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 11:08:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "114fb69106f3670ea018f629fc9e24e7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 11:08:55 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "114fb69106f3670ea018f629fc9e24e7", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 11:08:55 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 11:08:55 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "BMP-2"}, "ts": "2023-07-13 11:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 11:09:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q658P3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:09:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q658P3.121.121"}, "ts": "2023-07-13 11:09:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "BMP-2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=BMP-2"}, "ts": "2023-07-13 11:09:07 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 11:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b06f1894afff626d3994b87f75849fd6", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 11:09:09 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b06f1894afff626d3994b87f75849fd6", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 11:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14354BD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:09:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14354BD"}, "ts": "2023-07-13 11:09:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14354BD"}, "ts": "2023-07-13 11:09:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-13 11:09:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 11:09:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95035CW"}, "ts": "2023-07-13 11:09:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35928BM"}, "ts": "2023-07-13 11:09:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 11:09:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27210743", "type": "PubMed"}, "ts": "2023-07-13 11:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27210743", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:09:15 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000015", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-13 11:09:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 11:09:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000015", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 11:09:18 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000015", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-13 11:09:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00199AH"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00212RH"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00012MO"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14920", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00428HK"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00438EF"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00647RA"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00673KJ"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00706YM"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00741NZ"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00797ZX"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00924FH"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00966RI"}, "ts": "2023-07-13 11:09:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00995HW"}, "ts": "2023-07-13 11:09:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01200BW"}, "ts": "2023-07-13 11:09:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14920"}, "ts": "2023-07-13 11:09:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01295AX"}, "ts": "2023-07-13 11:09:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01323LL"}, "ts": "2023-07-13 11:09:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01338AS"}, "ts": "2023-07-13 11:09:23 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b06f1894afff626d3994b87f75849fd6", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": [{"id": "by_ptm", "operator": "OR", "selected": ["N-Glycosylation reported"]}]}, "ts": "2023-07-13 11:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b06f1894afff626d3994b87f75849fd6", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 11:09:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01359JE"}, "ts": "2023-07-13 11:09:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01406RR"}, "ts": "2023-07-13 11:09:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01454UB"}, "ts": "2023-07-13 11:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12035", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:09:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12035"}, "ts": "2023-07-13 11:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12566275", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:10:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12566275", "type": "PubMed"}, "ts": "2023-07-13 11:10:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9428520", "type": "PubMed"}, "ts": "2023-07-13 11:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9428520", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:11:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09012-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09012-1"}, "ts": "2023-07-13 11:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q573", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:12:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q573"}, "ts": "2023-07-13 11:12:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZH60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:12:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZH60"}, "ts": "2023-07-13 11:12:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGG0.229.229"}, "ts": "2023-07-13 11:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGG0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:13:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55735"}, "ts": "2023-07-13 11:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-13 11:13:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:13:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86W47-1"}, "ts": "2023-07-13 11:13:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86W47-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:13:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:14:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:14:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05121"}, "ts": "2023-07-13 11:14:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14757", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:14:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14757"}, "ts": "2023-07-13 11:14:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN26", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:14:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN26"}, "ts": "2023-07-13 11:14:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64455", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:15:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCD5"}, "ts": "2023-07-13 11:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15269", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:15:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15269.74.74"}, "ts": "2023-07-13 11:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:15:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYN0"}, "ts": "2023-07-13 11:15:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7706461", "type": "PubMed"}, "ts": "2023-07-13 11:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7706461", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:15:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28646"}, "ts": "2023-07-13 11:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28646", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:16:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P06753", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 11:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06753", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 11:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DB9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:16:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DB9"}, "ts": "2023-07-13 11:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LVA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:16:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LVA9"}, "ts": "2023-07-13 11:16:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JW5"}, "ts": "2023-07-13 11:16:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DML3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:16:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DML3"}, "ts": "2023-07-13 11:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47972", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:17:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47972.148.148"}, "ts": "2023-07-13 11:17:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:17:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAP8"}, "ts": "2023-07-13 11:17:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-13 11:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15371"}, "ts": "2023-07-13 11:17:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NAM6"}, "ts": "2023-07-13 11:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULI3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:17:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULI3.349.349"}, "ts": "2023-07-13 11:17:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-13 11:17:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HD33"}, "ts": "2023-07-13 11:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:17:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-13 11:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45209NR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1L167"}, "ts": "2023-07-13 11:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L167", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:17:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15759.323.323"}, "ts": "2023-07-13 11:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15759", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y265-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:18:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y265-1"}, "ts": "2023-07-13 11:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:18:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51153"}, "ts": "2023-07-13 11:18:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:18:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BQ39.41.41"}, "ts": "2023-07-13 11:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ39", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:18:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51153"}, "ts": "2023-07-13 11:18:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MZP7"}, "ts": "2023-07-13 11:19:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MZP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:19:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53TN4-1"}, "ts": "2023-07-13 11:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53TN4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07065", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:19:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07065.348.348"}, "ts": "2023-07-13 11:19:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-13 11:19:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02671"}, "ts": "2023-07-13 11:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8267597", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:20:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8267597", "type": "PubMed"}, "ts": "2023-07-13 11:20:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EB97", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EB97"}, "ts": "2023-07-13 11:21:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-13 11:21:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-13 11:21:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91W89"}, "ts": "2023-07-13 11:22:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91W89", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:22:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 11:22:23 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 11:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 11:22:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71812IK"}, "ts": "2023-07-13 11:22:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71812IK"}, "ts": "2023-07-13 11:22:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01833-1"}, "ts": "2023-07-13 11:22:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-13 11:22:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-13 11:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YBV0"}, "ts": "2023-07-13 11:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YBV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:23:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NBJ5.469.469"}, "ts": "2023-07-13 11:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:23:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14500-1"}, "ts": "2023-07-13 11:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14500-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:23:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225-1"}, "ts": "2023-07-13 11:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:23:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-13 11:23:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00480"}, "ts": "2023-07-13 11:24:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:24:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22732"}, "ts": "2023-07-13 11:24:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:24:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79950YS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:24:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79950YS"}, "ts": "2023-07-13 11:24:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79950YS"}, "ts": "2023-07-13 11:24:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 11:24:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59927DK"}, "ts": "2023-07-13 11:24:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46575CV"}, "ts": "2023-07-13 11:24:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84964XI"}, "ts": "2023-07-13 11:24:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64581RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UI43"}, "ts": "2023-07-13 11:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI43", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:25:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50487YA"}, "ts": "2023-07-13 11:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50487YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:25:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17661.12.12"}, "ts": "2023-07-13 11:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-13 11:26:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24516400", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:26:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24516400", "type": "PubMed"}, "ts": "2023-07-13 11:26:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14643"}, "ts": "2023-07-13 11:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:27:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5GH62-1"}, "ts": "2023-07-13 11:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5GH62-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-13 11:27:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25788"}, "ts": "2023-07-13 11:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5Y2"}, "ts": "2023-07-13 11:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Y2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:27:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-13 11:27:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-13 11:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-13 11:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55735", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14532282", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:29:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14532282", "type": "PubMed"}, "ts": "2023-07-13 11:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UPH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UPH7"}, "ts": "2023-07-13 11:29:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16169419", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:29:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16169419", "type": "PubMed"}, "ts": "2023-07-13 11:29:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25497869", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:30:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25497869", "type": "PubMed"}, "ts": "2023-07-13 11:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25497869", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 11:30:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25067", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:30:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25067.155.155"}, "ts": "2023-07-13 11:30:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33434"}, "ts": "2023-07-13 11:30:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAE3"}, "ts": "2023-07-13 11:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:31:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:31:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14354BD"}, "ts": "2023-07-13 11:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14354BD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:31:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14354BD"}, "ts": "2023-07-13 11:31:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-13 11:31:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95035CW"}, "ts": "2023-07-13 11:31:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35928BM"}, "ts": "2023-07-13 11:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2C8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:31:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2C8"}, "ts": "2023-07-13 11:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GTS8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:31:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6GTS8.403.403"}, "ts": "2023-07-13 11:31:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35132862", "type": "PubMed"}, "ts": "2023-07-13 11:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35132862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43524", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:32:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43524.456.456"}, "ts": "2023-07-13 11:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07949", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:33:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07949.292.292"}, "ts": "2023-07-13 11:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 11:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22760-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:34:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22760-1"}, "ts": "2023-07-13 11:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91WQ5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:34:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91WQ5"}, "ts": "2023-07-13 11:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71812IK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71812IK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:34:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68013XJ"}, "ts": "2023-07-13 11:34:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71812IK"}, "ts": "2023-07-13 11:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59937CP"}, "ts": "2023-07-13 11:34:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67480NQ"}, "ts": "2023-07-13 11:34:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92922", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 11:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92922", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 11:34:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20622853", "type": "PubMed"}, "ts": "2023-07-13 11:34:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20622853", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:34:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106-1"}, "ts": "2023-07-13 11:34:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51178.193.193"}, "ts": "2023-07-13 11:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51178", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKA2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:35:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKA2.583.583"}, "ts": "2023-07-13 11:35:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YWC7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:35:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3YWC7"}, "ts": "2023-07-13 11:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZX41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:35:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZX41"}, "ts": "2023-07-13 11:35:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:35:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43610.159.159"}, "ts": "2023-07-13 11:35:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04792"}, "ts": "2023-07-13 11:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:35:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20814"}, "ts": "2023-07-13 11:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N612", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N612"}, "ts": "2023-07-13 11:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57221JN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:36:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:36:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57221JN"}, "ts": "2023-07-13 11:36:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13934DF"}, "ts": "2023-07-13 11:36:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57221JN"}, "ts": "2023-07-13 11:36:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-13 11:36:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86427WL"}, "ts": "2023-07-13 11:36:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61817"}, "ts": "2023-07-13 11:36:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:36:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK38"}, "ts": "2023-07-13 11:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:36:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43827.58.58"}, "ts": "2023-07-13 11:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43827", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:37:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36414FS"}, "ts": "2023-07-13 11:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070-1"}, "ts": "2023-07-13 11:38:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IV50.33.33"}, "ts": "2023-07-13 11:38:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV50", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:38:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01833-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:38:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:38:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K593-1"}, "ts": "2023-07-13 11:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K593-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:38:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56856"}, "ts": "2023-07-13 11:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16537653", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:38:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16537653", "type": "PubMed"}, "ts": "2023-07-13 11:38:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:39:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QYV8"}, "ts": "2023-07-13 11:39:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PTG1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:39:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PTG1-1"}, "ts": "2023-07-13 11:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13597", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:39:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13597.388.388"}, "ts": "2023-07-13 11:39:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54707"}, "ts": "2023-07-13 11:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00480", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:40:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:40:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXD2"}, "ts": "2023-07-13 11:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01614ZM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:40:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07477"}, "ts": "2023-07-13 11:42:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1S7"}, "ts": "2023-07-13 11:42:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1S7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:42:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969D9-1"}, "ts": "2023-07-13 11:42:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q50E62"}, "ts": "2023-07-13 11:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q50E62", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969D9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:43:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23246"}, "ts": "2023-07-13 11:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:43:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 11:43:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91413ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:43:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96Q04"}, "ts": "2023-07-13 11:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q04", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:44:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15439.1.1"}, "ts": "2023-07-13 11:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RP8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:44:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RP8.27.27"}, "ts": "2023-07-13 11:44:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15262-1"}, "ts": "2023-07-13 11:44:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15262-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95865", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:45:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95865.3.3"}, "ts": "2023-07-13 11:45:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBF8-1"}, "ts": "2023-07-13 11:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBF8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:45:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-13 11:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:46:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:46:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07225"}, "ts": "2023-07-13 11:46:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 11:46:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 11:46:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-13 11:46:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71142DF"}, "ts": "2023-07-13 11:46:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 11:46:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-13 11:46:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:46:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29011JC"}, "ts": "2023-07-13 11:46:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82252-1"}, "ts": "2023-07-13 11:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82252-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:47:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05783.7.7"}, "ts": "2023-07-13 11:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05783", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:47:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7L9-1"}, "ts": "2023-07-13 11:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7L9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:48:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97929"}, "ts": "2023-07-13 11:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97929", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:48:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:48:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15489910", "type": "PubMed"}, "ts": "2023-07-13 11:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15489910", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:48:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NVY1"}, "ts": "2023-07-13 11:49:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:49:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NVY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:49:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99805"}, "ts": "2023-07-13 11:49:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-13 11:49:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08857-1"}, "ts": "2023-07-13 11:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:50:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2A9"}, "ts": "2023-07-13 11:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:50:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQI5-1"}, "ts": "2023-07-13 11:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQI5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:50:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45379"}, "ts": "2023-07-13 11:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27701", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:51:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27701.198.198"}, "ts": "2023-07-13 11:51:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ75", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:51:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BQ75.212.212"}, "ts": "2023-07-13 11:51:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWJ2"}, "ts": "2023-07-13 11:51:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:51:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-13 11:51:52 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 11:52:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 11:52:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 11:52:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g69411g", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-13 11:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 11:52:29 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "g69411g"}, "ts": "2023-07-13 11:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 11:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g69411g", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "Global search term=g69411g"}, "ts": "2023-07-13 11:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05062", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:52:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05062.36.36"}, "ts": "2023-07-13 11:52:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BP01", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:52:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BP01"}, "ts": "2023-07-13 11:52:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10412802", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:52:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10412802", "type": "PubMed"}, "ts": "2023-07-13 11:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g69411IG", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-13 11:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 11:52:46 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "g69411IG"}, "ts": "2023-07-13 11:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 11:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g69411IG", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "global-search-result", "message": "Global search term=g69411IG"}, "ts": "2023-07-13 11:52:46 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 11:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "59094123704eecac0b7e90a377591272", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 11:52:49 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "59094123704eecac0b7e90a377591272", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 11:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95453", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:52:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95453"}, "ts": "2023-07-13 11:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00187-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:52:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00187-1"}, "ts": "2023-07-13 11:52:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86-1"}, "ts": "2023-07-13 11:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86-1", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:53:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 11:53:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60070LT"}, "ts": "2023-07-13 11:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60070LT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:53:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81141KC"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72961RM"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60070LT"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43664YB"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-13 11:53:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-13 11:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-13 11:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07677VL"}, "ts": "2023-07-13 11:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-13 11:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-13 11:53:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-13 11:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U284", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:53:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBI9"}, "ts": "2023-07-13 11:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U284"}, "ts": "2023-07-13 11:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:53:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGC7"}, "ts": "2023-07-13 11:53:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB14"}, "ts": "2023-07-13 11:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:53:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBV8"}, "ts": "2023-07-13 11:53:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59970QL"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-13 11:53:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20425TQ"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23453IV"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52428MJ"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52934AK"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70375MX"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72797UR"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74645FT"}, "ts": "2023-07-13 11:53:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36414FS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:53:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40227"}, "ts": "2023-07-13 11:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:54:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83741"}, "ts": "2023-07-13 11:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83741", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:54:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:54:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0H5"}, "ts": "2023-07-13 11:54:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56856", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18207245", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:55:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18207245", "type": "PubMed"}, "ts": "2023-07-13 11:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06330"}, "ts": "2023-07-13 11:55:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TD26.550.550"}, "ts": "2023-07-13 11:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TD26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:55:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.230.230"}, "ts": "2023-07-13 11:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XJE5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:55:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-13 11:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-13 11:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:56:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21779089", "type": "PubMed"}, "ts": "2023-07-13 11:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21779089", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14165", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:56:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14165"}, "ts": "2023-07-13 11:56:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:56:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXB8.284.284"}, "ts": "2023-07-13 11:56:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXB8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:56:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2121162", "type": "PubMed"}, "ts": "2023-07-13 11:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2121162", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:56:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-13 11:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 11:56:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57776ZU"}, "ts": "2023-07-13 11:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44298KL"}, "ts": "2023-07-13 11:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86288VS"}, "ts": "2023-07-13 11:56:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 11:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17900", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:57:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17900.59.59"}, "ts": "2023-07-13 11:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43883"}, "ts": "2023-07-13 11:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R511-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:57:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R511-1"}, "ts": "2023-07-13 11:57:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11741539", "type": "PubMed"}, "ts": "2023-07-13 11:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11741539", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:57:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4K1.1444.1444"}, "ts": "2023-07-13 11:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4K1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CUU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:57:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CUU3.458.458"}, "ts": "2023-07-13 11:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ01", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 11:58:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ01"}, "ts": "2023-07-13 11:58:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01589", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:58:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01589.268.268"}, "ts": "2023-07-13 11:58:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-13 11:59:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q24JP5.547.547"}, "ts": "2023-07-13 11:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q24JP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 11:59:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FS1-1"}, "ts": "2023-07-13 11:59:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FS1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86-1", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 11:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86-1"}, "ts": "2023-07-13 11:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15836428", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 11:59:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15836428", "type": "PubMed"}, "ts": "2023-07-13 11:59:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20489-1"}, "ts": "2023-07-13 12:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 12:00:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 12:00:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 12:00:06 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 12:00:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DN86-1.33.33"}, "ts": "2023-07-13 12:00:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86-1", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:00:06 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 12:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 12:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3V7"}, "ts": "2023-07-13 12:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:00:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 12:00:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99895.40.40"}, "ts": "2023-07-13 12:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99895", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:01:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21918.15.15"}, "ts": "2023-07-13 12:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21918", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924T7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731-1"}, "ts": "2023-07-13 12:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924T7"}, "ts": "2023-07-13 12:01:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70477"}, "ts": "2023-07-13 12:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29011JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:02:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD1"}, "ts": "2023-07-13 12:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:03:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34380030", "type": "PubMed"}, "ts": "2023-07-13 12:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34380030", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTU4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:03:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTU4-1"}, "ts": "2023-07-13 12:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:03:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-13 12:03:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86-1"}, "ts": "2023-07-13 12:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86-1", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:04:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86-1"}, "ts": "2023-07-13 12:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86-1", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:04:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86-1"}, "ts": "2023-07-13 12:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86-1", "user": "wktnrdvcqgcinfcutu1ml35g21jaya4m", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PYC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:04:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PYC2"}, "ts": "2023-07-13 12:04:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPV8"}, "ts": "2023-07-13 12:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:04:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:04:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHB9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:04:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UHB9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 12:04:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-13 12:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:05:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03001"}, "ts": "2023-07-13 12:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ0"}, "ts": "2023-07-13 12:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:05:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00033MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92698-1"}, "ts": "2023-07-13 12:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92698-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSQ5"}, "ts": "2023-07-13 12:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:06:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G163"}, "ts": "2023-07-13 12:06:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53609", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G163", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:06:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P53609.241.241"}, "ts": "2023-07-13 12:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08857-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:06:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-13 12:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05940", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:07:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q05940", "cluster_type": "unselected"}, "ts": "2023-07-13 12:07:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05940", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 12:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC05", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:07:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4VC05.151.151"}, "ts": "2023-07-13 12:07:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18827-1"}, "ts": "2023-07-13 12:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18827-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90333CG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:08:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90333CG"}, "ts": "2023-07-13 12:08:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07666"}, "ts": "2023-07-13 12:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:09:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42858"}, "ts": "2023-07-13 12:09:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 12:09:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04040"}, "ts": "2023-07-13 12:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49756", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:09:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P49756", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 12:09:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-13 12:10:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYQ8.459.459"}, "ts": "2023-07-13 12:10:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:10:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-13 12:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAU0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAU0"}, "ts": "2023-07-13 12:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83740"}, "ts": "2023-07-13 12:10:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83740", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:10:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TCZ1.644.644"}, "ts": "2023-07-13 12:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TCZ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:11:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPH5.173.173"}, "ts": "2023-07-13 12:11:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24056717", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:11:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24056717", "type": "PubMed"}, "ts": "2023-07-13 12:11:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJS6-1"}, "ts": "2023-07-13 12:11:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJS6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0H2UHR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:12:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0H2UHR2"}, "ts": "2023-07-13 12:12:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75865.35.35"}, "ts": "2023-07-13 12:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75865", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:12:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35219", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:12:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35219.286.286"}, "ts": "2023-07-13 12:13:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:13:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60934"}, "ts": "2023-07-13 12:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60934", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32404352", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:13:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32404352", "type": "PubMed"}, "ts": "2023-07-13 12:13:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0J4"}, "ts": "2023-07-13 12:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0J4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12955", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:14:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63208"}, "ts": "2023-07-13 12:14:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12955.1559.1559"}, "ts": "2023-07-13 12:14:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12153727", "type": "PubMed"}, "ts": "2023-07-13 12:14:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12153727", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:14:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MX3"}, "ts": "2023-07-13 12:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZR2"}, "ts": "2023-07-13 12:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15409", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:15:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15409.617.617"}, "ts": "2023-07-13 12:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-13 12:15:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VG02"}, "ts": "2023-07-13 12:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VG02", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVM6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVM6-1"}, "ts": "2023-07-13 12:15:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPV8"}, "ts": "2023-07-13 12:15:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20489-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:16:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51587"}, "ts": "2023-07-13 12:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:16:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:16:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33434"}, "ts": "2023-07-13 12:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52332", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:16:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52332"}, "ts": "2023-07-13 12:16:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02671.116.116"}, "ts": "2023-07-13 12:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:16:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y228"}, "ts": "2023-07-13 12:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y228", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56479", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56479"}, "ts": "2023-07-13 12:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4ZJN1-1"}, "ts": "2023-07-13 12:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4ZJN1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:17:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12559849", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:17:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12559849", "type": "PubMed"}, "ts": "2023-07-13 12:17:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08133"}, "ts": "2023-07-13 12:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJ14", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:18:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJ14.278.278"}, "ts": "2023-07-13 12:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57775", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:18:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57775"}, "ts": "2023-07-13 12:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14625"}, "ts": "2023-07-13 12:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:19:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51654-1.151.151"}, "ts": "2023-07-13 12:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:20:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43361"}, "ts": "2023-07-13 12:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:20:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPY5-1"}, "ts": "2023-07-13 12:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPY5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:21:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11836260", "type": "PubMed"}, "ts": "2023-07-13 12:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11836260", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:21:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20023-1"}, "ts": "2023-07-13 12:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20023-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZCK6"}, "ts": "2023-07-13 12:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZCK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMP7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:22:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWY9.303.303"}, "ts": "2023-07-13 12:22:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4KMP7.776.776"}, "ts": "2023-07-13 12:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWY9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:22:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-13 12:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6A044"}, "ts": "2023-07-13 12:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6A044", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:22:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:22:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:22:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13231"}, "ts": "2023-07-13 12:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN86-1"}, "ts": "2023-07-13 12:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN86-1", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:23:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14996IQ"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43664YB"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07677VL"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-13 12:23:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDN2"}, "ts": "2023-07-13 12:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92854"}, "ts": "2023-07-13 12:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92854", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493-1"}, "ts": "2023-07-13 12:24:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07350"}, "ts": "2023-07-13 12:24:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-13 12:24:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-13 12:24:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8-1"}, "ts": "2023-07-13 12:24:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-13 12:24:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:24:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-13 12:24:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-13 12:24:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12778-1"}, "ts": "2023-07-13 12:24:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-13 12:24:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23052ZQ"}, "ts": "2023-07-13 12:24:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67200RM"}, "ts": "2023-07-13 12:24:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 12:24:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14247"}, "ts": "2023-07-13 12:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16150-1"}, "ts": "2023-07-13 12:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16150-1"}, "ts": "2023-07-13 12:24:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37231"}, "ts": "2023-07-13 12:24:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07666", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-13 12:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:24:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N806"}, "ts": "2023-07-13 12:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N806", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:25:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91W27-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:25:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91W27-1"}, "ts": "2023-07-13 12:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13473-1", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:25:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13473-1"}, "ts": "2023-07-13 12:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02724-1", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:25:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02724-1"}, "ts": "2023-07-13 12:25:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 12:25:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-13 12:25:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22625SJ"}, "ts": "2023-07-13 12:25:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-13 12:25:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31596VW"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26759AS"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34617SM"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46902YN"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65092SV"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69834CE"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74430RZ"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76915KR"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79286RS"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03461SC"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28681TP"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37818NZ"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41882MT"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45883VE"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50427EO"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-13 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59536GA"}, "ts": "2023-07-13 12:25:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-13 12:25:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62461SM"}, "ts": "2023-07-13 12:25:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16370GQ"}, "ts": "2023-07-13 12:25:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33350UC"}, "ts": "2023-07-13 12:25:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42797SX"}, "ts": "2023-07-13 12:25:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47180UC"}, "ts": "2023-07-13 12:25:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56245IE"}, "ts": "2023-07-13 12:25:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94217FB"}, "ts": "2023-07-13 12:25:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-13 12:25:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33084977", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:25:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33084977", "type": "PubMed"}, "ts": "2023-07-13 12:25:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-13 12:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04040", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:25:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92585-1"}, "ts": "2023-07-13 12:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92585-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00036MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:26:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00036MO"}, "ts": "2023-07-13 12:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMQ2-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:26:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMQ2-1"}, "ts": "2023-07-13 12:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:26:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25490"}, "ts": "2023-07-13 12:26:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16157"}, "ts": "2023-07-13 12:27:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZUU6-1"}, "ts": "2023-07-13 12:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:27:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WTS6.869.869"}, "ts": "2023-07-13 12:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZUU6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38532-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:27:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38532-1"}, "ts": "2023-07-13 12:27:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01628.70.70"}, "ts": "2023-07-13 12:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01628", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01129-1"}, "ts": "2023-07-13 12:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01129-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:27:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14683"}, "ts": "2023-07-13 12:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14683", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:27:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01151"}, "ts": "2023-07-13 12:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:28:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12677454", "type": "PubMed"}, "ts": "2023-07-13 12:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12677454", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:29:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHJ9"}, "ts": "2023-07-13 12:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DEH7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:29:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DEH7-1"}, "ts": "2023-07-13 12:29:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3C6.742.742"}, "ts": "2023-07-13 12:29:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3C6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:29:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14BB9"}, "ts": "2023-07-13 12:29:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14BB9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:29:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "8719416"}, "ts": "2023-07-13 12:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 12:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63208", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:30:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VE01-1"}, "ts": "2023-07-13 12:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VE01-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:30:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49674-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:31:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49674-1"}, "ts": "2023-07-13 12:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34848812", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:31:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34848812", "type": "PubMed"}, "ts": "2023-07-13 12:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34848812", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 12:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:31:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-13 12:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18268355", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:31:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18268355", "type": "PubMed"}, "ts": "2023-07-13 12:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14192"}, "ts": "2023-07-13 12:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14192", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:31:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21588"}, "ts": "2023-07-13 12:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTZ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:31:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTZ0"}, "ts": "2023-07-13 12:31:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618"}, "ts": "2023-07-13 12:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23945"}, "ts": "2023-07-13 12:31:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28906"}, "ts": "2023-07-13 12:32:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96G03.63.63"}, "ts": "2023-07-13 12:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G03", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:32:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q309"}, "ts": "2023-07-13 12:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VXI9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q309", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:33:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VXI9.59.59"}, "ts": "2023-07-13 12:33:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15465"}, "ts": "2023-07-13 12:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15149", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:33:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15149"}, "ts": "2023-07-13 12:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "vgr6y2900p5bvu5go285gk9b5abdc6rg", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:33:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14151"}, "ts": "2023-07-13 12:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14151", "user": "vgr6y2900p5bvu5go285gk9b5abdc6rg", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08133", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:33:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 12:33:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZR35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:34:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZR35"}, "ts": "2023-07-13 12:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:34:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z5L7"}, "ts": "2023-07-13 12:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5L7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:34:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-13 12:34:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-13 12:34:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-13 12:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q499Q5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:34:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VI23-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:34:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q499Q5"}, "ts": "2023-07-13 12:34:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VI23-1"}, "ts": "2023-07-13 12:34:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VWJ9"}, "ts": "2023-07-13 12:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:34:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04075"}, "ts": "2023-07-13 12:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:35:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PK18"}, "ts": "2023-07-13 12:35:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61644.427.427"}, "ts": "2023-07-13 12:35:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61644", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13686"}, "ts": "2023-07-13 12:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5J9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:35:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5J9"}, "ts": "2023-07-13 12:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:35:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4K0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQP3.27.27"}, "ts": "2023-07-13 12:36:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQP3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:36:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1B5"}, "ts": "2023-07-13 12:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1B5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVM6"}, "ts": "2023-07-13 12:36:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:36:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4K0"}, "ts": "2023-07-13 12:36:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14314.119.119"}, "ts": "2023-07-13 12:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14314", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:36:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 12:36:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 12:36:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUN7"}, "ts": "2023-07-13 12:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:36:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "q14314", "user": "Undecided", "type": "user", "page": "Siteview", "message": "Performing Global Search"}, "ts": "2023-07-13 12:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 12:36:41 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "q14314"}, "ts": "2023-07-13 12:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 12:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "q14314", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=q14314"}, "ts": "2023-07-13 12:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "89273606371c914b5c57b0c55ef27a9d", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 12:36:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "89273606371c914b5c57b0c55ef27a9d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 12:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:36:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-13 12:36:48 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "q14314"}, "ts": "2023-07-13 12:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 12:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "q14314", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=q14314"}, "ts": "2023-07-13 12:36:52 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 12:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b861ac0cd160f08b30af99766b752f0d", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 12:36:53 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b861ac0cd160f08b30af99766b752f0d", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 12:36:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34478437", "type": "PubMed"}, "ts": "2023-07-13 12:36:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34478437", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47857", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:36:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P47857", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 12:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1B0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:36:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T1B0"}, "ts": "2023-07-13 12:36:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13698.594.594"}, "ts": "2023-07-13 12:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13698", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92619", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:37:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92619", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 12:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "p62495", "user": "Undecided", "type": "user", "page": "protein-list", "message": "Performing Global Search"}, "ts": "2023-07-13 12:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 12:37:03 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "p62495"}, "ts": "2023-07-13 12:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 12:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "p62495", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=p62495"}, "ts": "2023-07-13 12:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13385-1"}, "ts": "2023-07-13 12:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13385-1", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28887846", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:37:09 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 12:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "854f33f8f85bc0a15b59fa3e4572f7e4", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 12:37:10 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "854f33f8f85bc0a15b59fa3e4572f7e4", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 12:37:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28887846", "type": "PubMed"}, "ts": "2023-07-13 12:37:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62495-1"}, "ts": "2023-07-13 12:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62495-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:37:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V98"}, "ts": "2023-07-13 12:37:30 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 12:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 12:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:37:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13671.278.278"}, "ts": "2023-07-13 12:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:38:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES17-1"}, "ts": "2023-07-13 12:38:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11388-1"}, "ts": "2023-07-13 12:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES17-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:38:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P25063-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 12:38:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34751ZZ"}, "ts": "2023-07-13 12:38:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34751ZZ"}, "ts": "2023-07-13 12:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14119", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:38:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14119.110.110"}, "ts": "2023-07-13 12:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZK73", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:39:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZK73"}, "ts": "2023-07-13 12:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KRA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:39:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KRA6"}, "ts": "2023-07-13 12:39:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12778-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07483YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y261"}, "ts": "2023-07-13 12:40:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:40:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-13 12:40:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKV8.251.251"}, "ts": "2023-07-13 12:41:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKV8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHC3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:41:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHC3"}, "ts": "2023-07-13 12:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96TA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:42:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96TA1"}, "ts": "2023-07-13 12:42:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:43:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1U4.64.64"}, "ts": "2023-07-13 12:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1U4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:43:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21769729", "type": "PubMed"}, "ts": "2023-07-13 12:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21769729", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VI67", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:43:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VI67"}, "ts": "2023-07-13 12:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17434132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:43:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17434132", "type": "PubMed"}, "ts": "2023-07-13 12:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 12:43:51 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 12:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 12:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55268", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:43:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55268.1348.1348"}, "ts": "2023-07-13 12:43:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15927"}, "ts": "2023-07-13 12:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G54685SU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:44:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G54685SU"}, "ts": "2023-07-13 12:44:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-13 12:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48031-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:44:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48031-1"}, "ts": "2023-07-13 12:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35053-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:45:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35053-1"}, "ts": "2023-07-13 12:45:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11678"}, "ts": "2023-07-13 12:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:45:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "E5RIL1.140.140"}, "ts": "2023-07-13 12:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E5RIL1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02786"}, "ts": "2023-07-13 12:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15599", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:47:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15599.303.303"}, "ts": "2023-07-13 12:47:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:47:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07766"}, "ts": "2023-07-13 12:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40616-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:47:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 12:47:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40616-1"}, "ts": "2023-07-13 12:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:48:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07766.55.55"}, "ts": "2023-07-13 12:48:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07766"}, "ts": "2023-07-13 12:48:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28906", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13647-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13647-1"}, "ts": "2023-07-13 12:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19855386", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:48:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19855386", "type": "PubMed"}, "ts": "2023-07-13 12:48:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08727"}, "ts": "2023-07-13 12:48:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:48:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41743"}, "ts": "2023-07-13 12:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41743", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19484", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:48:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P19484", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 12:48:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95319"}, "ts": "2023-07-13 12:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95319", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19484", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 12:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15465", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:49:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61006", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:49:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61006"}, "ts": "2023-07-13 12:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-13 12:49:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AQ07-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:49:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "A2AQ07-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 12:49:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AQ07-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-13 12:49:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49767"}, "ts": "2023-07-13 12:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49767", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C4N4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C4N4"}, "ts": "2023-07-13 12:49:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TB80.474.474"}, "ts": "2023-07-13 12:50:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB80", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16989", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:50:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16989"}, "ts": "2023-07-13 12:50:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 12:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QNW6"}, "ts": "2023-07-13 12:50:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:50:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIB8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:50:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIB8.275.275"}, "ts": "2023-07-13 12:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15642", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:51:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15642.296.296"}, "ts": "2023-07-13 12:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 12:51:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32241", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:51:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32241"}, "ts": "2023-07-13 12:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:51:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75954.180.180"}, "ts": "2023-07-13 12:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15136734", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:52:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15136734", "type": "PubMed"}, "ts": "2023-07-13 12:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35367", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:52:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35367"}, "ts": "2023-07-13 12:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17853904", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:52:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17853904", "type": "PubMed"}, "ts": "2023-07-13 12:52:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09528DL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:52:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09528DL"}, "ts": "2023-07-13 12:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGC7"}, "ts": "2023-07-13 12:53:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M2H8"}, "ts": "2023-07-13 12:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M2H8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:53:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TPL3"}, "ts": "2023-07-13 12:53:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TPL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:53:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231"}, "ts": "2023-07-13 12:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11388-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5ND04", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 12:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5ND04"}, "ts": "2023-07-13 12:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34751ZZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:54:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48712FQ"}, "ts": "2023-07-13 12:54:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34751ZZ"}, "ts": "2023-07-13 12:54:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13771ME"}, "ts": "2023-07-13 12:54:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96349IQ"}, "ts": "2023-07-13 12:54:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60266.476.476"}, "ts": "2023-07-13 12:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60266", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVQ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:55:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:55:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVQ4"}, "ts": "2023-07-13 12:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3J6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3J6"}, "ts": "2023-07-13 12:55:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27540.73.73"}, "ts": "2023-07-13 12:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27540", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:56:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09874-1.426.426"}, "ts": "2023-07-13 12:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12584197", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 12:56:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12584197", "type": "PubMed"}, "ts": "2023-07-13 12:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y345-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:56:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y345-1"}, "ts": "2023-07-13 12:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:56:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T1B0.811.811"}, "ts": "2023-07-13 12:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1B0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09528DL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:56:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09528DL"}, "ts": "2023-07-13 12:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 12:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:58:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82987"}, "ts": "2023-07-13 12:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82987", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04256", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 12:58:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04256.6.6"}, "ts": "2023-07-13 12:58:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UIW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 12:59:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UIW8"}, "ts": "2023-07-13 12:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "V9GX81-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 12:59:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "V9GX81-1", "cluster_type": "unselected"}, "ts": "2023-07-13 12:59:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "V9GX81-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-13 12:59:52 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 13:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 13:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 13:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 13:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 13:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 13:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6Q9"}, "ts": "2023-07-13 13:00:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-13 13:00:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D1I2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:01:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D1I2-1"}, "ts": "2023-07-13 13:01:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6VVB1.3.3"}, "ts": "2023-07-13 13:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6VVB1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48050", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:01:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48050"}, "ts": "2023-07-13 13:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31862898", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:01:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31862898", "type": "PubMed"}, "ts": "2023-07-13 13:01:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43593.1106.1106"}, "ts": "2023-07-13 13:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43593", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:02:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5B9.455.455"}, "ts": "2023-07-13 13:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5B9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:02:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQF0.183.183"}, "ts": "2023-07-13 13:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23438705", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:02:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23438705", "type": "PubMed"}, "ts": "2023-07-13 13:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K1Z4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:02:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K1Z4"}, "ts": "2023-07-13 13:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:02:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95222.298.298"}, "ts": "2023-07-13 13:02:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97817-1"}, "ts": "2023-07-13 13:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22355-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22355-1"}, "ts": "2023-07-13 13:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10635"}, "ts": "2023-07-13 13:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10635", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:03:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00751-1"}, "ts": "2023-07-13 13:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00751-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:03:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BSS9.817.817"}, "ts": "2023-07-13 13:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BSS9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:04:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07359"}, "ts": "2023-07-13 13:04:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:04:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBV8"}, "ts": "2023-07-13 13:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:05:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-13 13:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:05:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-13 13:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:05:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-13 13:05:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-13 13:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-13 13:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87636JF"}, "ts": "2023-07-13 13:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77854OM"}, "ts": "2023-07-13 13:05:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08178PQ"}, "ts": "2023-07-13 13:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:06:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02766"}, "ts": "2023-07-13 13:06:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIG2"}, "ts": "2023-07-13 13:07:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19203586", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:07:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19203586", "type": "PubMed"}, "ts": "2023-07-13 13:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:07:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VYJ5"}, "ts": "2023-07-13 13:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VYJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:08:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JV51-1"}, "ts": "2023-07-13 13:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JV51-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:08:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16552"}, "ts": "2023-07-13 13:08:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82933", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:08:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P82933.49.49"}, "ts": "2023-07-13 13:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIF6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:09:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIF6"}, "ts": "2023-07-13 13:09:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4FU28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4FU28"}, "ts": "2023-07-13 13:09:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:09:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY11"}, "ts": "2023-07-13 13:09:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-13 13:09:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA0"}, "ts": "2023-07-13 13:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCJ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:09:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCJ6"}, "ts": "2023-07-13 13:09:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:10:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-13 13:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:10:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX47"}, "ts": "2023-07-13 13:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:10:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05452"}, "ts": "2023-07-13 13:10:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6XR72"}, "ts": "2023-07-13 13:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XR72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:10:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43300.126.126"}, "ts": "2023-07-13 13:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43300", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08727"}, "ts": "2023-07-13 13:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60423", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:11:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60423"}, "ts": "2023-07-13 13:11:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NY8"}, "ts": "2023-07-13 13:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:11:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGR6"}, "ts": "2023-07-13 13:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGR6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:12:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98033RN"}, "ts": "2023-07-13 13:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98033RN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:12:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27838JR"}, "ts": "2023-07-13 13:12:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39466FU"}, "ts": "2023-07-13 13:12:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X24"}, "ts": "2023-07-13 13:12:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98033RN"}, "ts": "2023-07-13 13:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:13:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZY8"}, "ts": "2023-07-13 13:13:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0R8"}, "ts": "2023-07-13 13:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ5"}, "ts": "2023-07-13 13:13:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q810S6"}, "ts": "2023-07-13 13:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810S6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15289", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:13:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15289.158.158"}, "ts": "2023-07-13 13:13:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "28470624"}, "ts": "2023-07-13 13:13:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33878034", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:13:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33878034", "type": "PubMed"}, "ts": "2023-07-13 13:13:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:13:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A426"}, "ts": "2023-07-13 13:13:56 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 13:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 13:14:28 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "ceacam6", "term_category": "any"}, "ts": "2023-07-13 13:14:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 13:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">31428d44fa3bd4aa4030b495d50bdc16", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"ceacam6\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 13:14:36 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 13:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31428d44fa3bd4aa4030b495d50bdc16", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 13:14:36 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "31428d44fa3bd4aa4030b495d50bdc16", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 13:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IYF8-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:14:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IYF8-1.23.23"}, "ts": "2023-07-13 13:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40199-1", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:14:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40199-1"}, "ts": "2023-07-13 13:14:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63544-1"}, "ts": "2023-07-13 13:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63544-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54793", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54793.386.386"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41247ZX"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92050GC"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 13:14:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08047"}, "ts": "2023-07-13 13:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76094", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 13:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13625", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 13:16:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13625", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 13:16:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570"}, "ts": "2023-07-13 13:16:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O76094.630.630"}, "ts": "2023-07-13 13:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4D6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:16:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4D6"}, "ts": "2023-07-13 13:16:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53762"}, "ts": "2023-07-13 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 13:16:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94988"}, "ts": "2023-07-13 13:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:17:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT67"}, "ts": "2023-07-13 13:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:17:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26880274", "type": "PubMed"}, "ts": "2023-07-13 13:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26880274", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:17:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-13 13:18:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10338089", "type": "PubMed"}, "ts": "2023-07-13 13:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10338089", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40576JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:18:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40576JC"}, "ts": "2023-07-13 13:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01924ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:18:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01924ZE"}, "ts": "2023-07-13 13:18:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8658171", "type": "PubMed"}, "ts": "2023-07-13 13:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8658171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQE1"}, "ts": "2023-07-13 13:20:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88658", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:20:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88658.1057.1057"}, "ts": "2023-07-13 13:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16284", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:20:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16284.713.713"}, "ts": "2023-07-13 13:20:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10629061", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:21:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10629061", "type": "PubMed"}, "ts": "2023-07-13 13:21:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1630491", "type": "PubMed"}, "ts": "2023-07-13 13:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1630491", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:21:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:21:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20700-1"}, "ts": "2023-07-13 13:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:21:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15431"}, "ts": "2023-07-13 13:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "disclaimer", "message": "page access"}, "ts": "2023-07-13 13:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "disclaimer", "message": "page access"}, "ts": "2023-07-13 13:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:21:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAV8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:21:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAV8"}, "ts": "2023-07-13 13:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-13 13:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-13 13:22:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15889144", "type": "PubMed"}, "ts": "2023-07-13 13:22:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15889144", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:22:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54132"}, "ts": "2023-07-13 13:22:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:22:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2000400", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:23:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2000400", "type": "PubMed"}, "ts": "2023-07-13 13:23:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A3KGW5"}, "ts": "2023-07-13 13:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A3KGW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70207"}, "ts": "2023-07-13 13:23:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70207", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:23:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-13 13:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88751", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:23:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88751"}, "ts": "2023-07-13 13:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94832", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:24:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94832.682.682"}, "ts": "2023-07-13 13:24:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8710362", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:24:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8710362", "type": "PubMed"}, "ts": "2023-07-13 13:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00469", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:24:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00469.265.265"}, "ts": "2023-07-13 13:24:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11297621", "type": "PubMed"}, "ts": "2023-07-13 13:24:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11297621", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:24:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2B2.300.300"}, "ts": "2023-07-13 13:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2B2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2108149", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:25:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2108149", "type": "PubMed"}, "ts": "2023-07-13 13:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12960"}, "ts": "2023-07-13 13:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "2378clwy2ieipkj2fnkz9yg0ph2k6ge7", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12960", "user": "2378clwy2ieipkj2fnkz9yg0ph2k6ge7", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:25:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-13 13:25:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 13:25:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1279089", "type": "PubMed"}, "ts": "2023-07-13 13:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1279089", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:26:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03956"}, "ts": "2023-07-13 13:26:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:26:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:26:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGP2"}, "ts": "2023-07-13 13:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:26:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93008"}, "ts": "2023-07-13 13:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04695-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:27:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04695-1"}, "ts": "2023-07-13 13:27:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40688"}, "ts": "2023-07-13 13:28:06 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-13 13:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-13 13:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-13 13:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97698", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:28:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97698"}, "ts": "2023-07-13 13:28:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40688"}, "ts": "2023-07-13 13:28:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N307"}, "ts": "2023-07-13 13:28:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19174-1"}, "ts": "2023-07-13 13:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19174-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:28:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGM3.619.619"}, "ts": "2023-07-13 13:28:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TKA1"}, "ts": "2023-07-13 13:28:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TKA1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61421", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:29:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61421"}, "ts": "2023-07-13 13:29:06 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H553-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 13:29:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H553-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 13:29:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:29:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66676MI"}, "ts": "2023-07-13 13:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66676MI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:29:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17962301", "type": "PubMed"}, "ts": "2023-07-13 13:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17962301", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:29:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z601.270.270"}, "ts": "2023-07-13 13:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z601", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-13 13:30:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES19-1"}, "ts": "2023-07-13 13:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES19-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "No results. CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED - Failed to retrieve valid Protein Sequence."}, "ts": "2023-07-13 13:30:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-13 13:30:44 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-13 13:30:44 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 23}, "ts": "2023-07-13 13:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">23", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=23"}, "ts": "2023-07-13 13:30:47 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 23}, "ts": "2023-07-13 13:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-13 13:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-13 13:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H69-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:31:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H69-1"}, "ts": "2023-07-13 13:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:31:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32814070", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:31:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32814070", "type": "PubMed"}, "ts": "2023-07-13 13:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17962809", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:31:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17962809", "type": "PubMed"}, "ts": "2023-07-13 13:32:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9233623", "type": "PubMed"}, "ts": "2023-07-13 13:32:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9233623", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:32:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:32:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES17"}, "ts": "2023-07-13 13:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:32:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q568Z9"}, "ts": "2023-07-13 13:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q568Z9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:32:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07900"}, "ts": "2023-07-13 13:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43761", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:32:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43761"}, "ts": "2023-07-13 13:32:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2K1-1"}, "ts": "2023-07-13 13:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20700-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31653923", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:32:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31653923", "type": "PubMed"}, "ts": "2023-07-13 13:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:33:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P68363.232.232"}, "ts": "2023-07-13 13:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:33:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03956"}, "ts": "2023-07-13 13:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19835-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:33:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19835-1.629.629"}, "ts": "2023-07-13 13:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:33:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02671.546.546"}, "ts": "2023-07-13 13:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:33:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FF6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:33:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68FF6.373.373"}, "ts": "2023-07-13 13:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BTY2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:34:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BTY2.250.250"}, "ts": "2023-07-13 13:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13395", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:34:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13395"}, "ts": "2023-07-13 13:34:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53007"}, "ts": "2023-07-13 13:35:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFQ9"}, "ts": "2023-07-13 13:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFQ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35000"}, "ts": "2023-07-13 13:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35000", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13264-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:36:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13264-1"}, "ts": "2023-07-13 13:36:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18340"}, "ts": "2023-07-13 13:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18340", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20351177", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:36:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20351177", "type": "PubMed"}, "ts": "2023-07-13 13:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:36:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0C1"}, "ts": "2023-07-13 13:36:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15207.360.360"}, "ts": "2023-07-13 13:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15207", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:36:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19143814", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:36:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19143814", "type": "PubMed"}, "ts": "2023-07-13 13:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:37:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06909-1"}, "ts": "2023-07-13 13:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06909-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:37:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UI26"}, "ts": "2023-07-13 13:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI26", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:37:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78310.106.106"}, "ts": "2023-07-13 13:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78310", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI26", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:37:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UI26"}, "ts": "2023-07-13 13:37:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12972.204.204"}, "ts": "2023-07-13 13:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12972", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IW41"}, "ts": "2023-07-13 13:38:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54868"}, "ts": "2023-07-13 13:38:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07759-1"}, "ts": "2023-07-13 13:38:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFB9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:38:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFB9"}, "ts": "2023-07-13 13:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:39:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-13 13:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TD94", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:39:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TD94.640.640"}, "ts": "2023-07-13 13:39:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29393455", "type": "PubMed"}, "ts": "2023-07-13 13:39:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29393455", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29393455", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 13:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:39:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80235JY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 13:39:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80235JY"}, "ts": "2023-07-13 13:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15125"}, "ts": "2023-07-13 13:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JTW2-1"}, "ts": "2023-07-13 13:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTW2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:40:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29163033", "type": "PubMed"}, "ts": "2023-07-13 13:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29163033", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:40:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51587"}, "ts": "2023-07-13 13:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:41:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2X9"}, "ts": "2023-07-13 13:41:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7Z7"}, "ts": "2023-07-13 13:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7Z7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:41:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q15796", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 13:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15796", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 13:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 13:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61193", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:42:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61193"}, "ts": "2023-07-13 13:42:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75528", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:42:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75528.27.27"}, "ts": "2023-07-13 13:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15550", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:42:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15550.580.580"}, "ts": "2023-07-13 13:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NNL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NNL0"}, "ts": "2023-07-13 13:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01222"}, "ts": "2023-07-13 13:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9524124", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:42:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02462.909.909"}, "ts": "2023-07-13 13:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:42:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9524124", "type": "PubMed"}, "ts": "2023-07-13 13:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSU3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:43:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSU3-1"}, "ts": "2023-07-13 13:43:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08580"}, "ts": "2023-07-13 13:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08580", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3SHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3SHH9"}, "ts": "2023-07-13 13:43:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:44:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:44:12 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-13 13:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-13 13:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-13 13:44:35 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 23}, "ts": "2023-07-13 13:44:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-13 13:44:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12523936", "type": "PubMed"}, "ts": "2023-07-13 13:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12523936", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:44:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DFJ6"}, "ts": "2023-07-13 13:44:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DFJ6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:44:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61006"}, "ts": "2023-07-13 13:44:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61006", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:44:53 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED \n", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-13 13:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED \\n\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-13 13:45:09 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 24}, "ts": "2023-07-13 13:45:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">24", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=24"}, "ts": "2023-07-13 13:45:11 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 24}, "ts": "2023-07-13 13:45:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-13 13:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-13 13:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:45:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L58"}, "ts": "2023-07-13 13:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:45:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-13 13:45:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:46:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14439.419.419"}, "ts": "2023-07-13 13:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01023"}, "ts": "2023-07-13 13:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13117-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:46:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13117-1"}, "ts": "2023-07-13 13:46:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-13 13:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y623", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:46:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y623"}, "ts": "2023-07-13 13:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:47:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAI7"}, "ts": "2023-07-13 13:47:03 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-13 13:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-13 13:47:14 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 24}, "ts": "2023-07-13 13:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-13 13:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-13 13:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11390361", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:47:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11390361", "type": "PubMed"}, "ts": "2023-07-13 13:47:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28565", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:47:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28565"}, "ts": "2023-07-13 13:47:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-13 13:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:48:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08237"}, "ts": "2023-07-13 13:48:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26776516", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:48:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26776516", "type": "PubMed"}, "ts": "2023-07-13 13:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:49:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13362"}, "ts": "2023-07-13 13:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:49:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTX8"}, "ts": "2023-07-13 13:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-13 13:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:50:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D075-1"}, "ts": "2023-07-13 13:50:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D075-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:50:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49238"}, "ts": "2023-07-13 13:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653-1"}, "ts": "2023-07-13 13:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:50:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51610.29.29"}, "ts": "2023-07-13 13:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64240"}, "ts": "2023-07-13 13:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H944-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:50:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H944-1"}, "ts": "2023-07-13 13:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02091-1"}, "ts": "2023-07-13 13:51:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLG1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:51:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLG1-1"}, "ts": "2023-07-13 13:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:51:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21127.384.384"}, "ts": "2023-07-13 13:51:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27166278", "type": "PubMed"}, "ts": "2023-07-13 13:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27166278", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08125", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 13:52:31 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q08125", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 13:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08125", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 13:52:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-13 13:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31492896", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:52:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31492896", "type": "PubMed"}, "ts": "2023-07-13 13:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A32"}, "ts": "2023-07-13 13:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A32", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:53:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZQ2"}, "ts": "2023-07-13 13:53:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34106787", "type": "PubMed"}, "ts": "2023-07-13 13:53:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34106787", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:53:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:53:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4C0.501.501"}, "ts": "2023-07-13 13:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B9A014", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:53:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B9A014"}, "ts": "2023-07-13 13:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18556348", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:53:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18556348", "type": "PubMed"}, "ts": "2023-07-13 13:53:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54868", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07759-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:54:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 13:54:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55008"}, "ts": "2023-07-13 13:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55008", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15399", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:55:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15399.637.637"}, "ts": "2023-07-13 13:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69Z38", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:55:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q69Z38.825.825"}, "ts": "2023-07-13 13:55:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10781616", "type": "PubMed"}, "ts": "2023-07-13 13:55:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10781616", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:55:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15125", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:55:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82450"}, "ts": "2023-07-13 13:56:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36897", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:56:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36897.185.185"}, "ts": "2023-07-13 13:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5BUZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:56:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5BUZ1-1"}, "ts": "2023-07-13 13:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BQM7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:57:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BQM7"}, "ts": "2023-07-13 13:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00577", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 13:57:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00577"}, "ts": "2023-07-13 13:57:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-13 13:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:58:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50153"}, "ts": "2023-07-13 13:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8643544", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 13:59:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8643544", "type": "PubMed"}, "ts": "2023-07-13 13:59:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V27"}, "ts": "2023-07-13 13:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 13:59:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32766"}, "ts": "2023-07-13 13:59:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00966.132.132"}, "ts": "2023-07-13 13:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00966", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 13:59:33 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 14:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 14:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 14:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 14:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 14:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 14:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5F226-1"}, "ts": "2023-07-13 14:01:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5F226-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:01:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N1F7.427.427"}, "ts": "2023-07-13 14:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1F7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:01:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32245784", "type": "PubMed"}, "ts": "2023-07-13 14:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32245784", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPW8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:01:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BPW8.129.129"}, "ts": "2023-07-13 14:01:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25934862", "type": "PubMed"}, "ts": "2023-07-13 14:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25934862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:02:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10848580", "type": "PubMed"}, "ts": "2023-07-13 14:02:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10848580", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:02:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18162553", "type": "PubMed"}, "ts": "2023-07-13 14:02:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18162553", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:02:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1MAG8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:02:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1MAG8-1"}, "ts": "2023-07-13 14:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45495MK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:02:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:02:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95395"}, "ts": "2023-07-13 14:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:03:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2460635"}, "ts": "2023-07-13 14:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 14:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:03:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.101.101"}, "ts": "2023-07-13 14:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43301", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:03:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43301.531.531"}, "ts": "2023-07-13 14:03:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08689-1"}, "ts": "2023-07-13 14:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08689-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:03:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:04:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61739"}, "ts": "2023-07-13 14:04:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1J9-1"}, "ts": "2023-07-13 14:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:05:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Z1R3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1R3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:05:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1R3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 14:05:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2174784", "type": "PubMed"}, "ts": "2023-07-13 14:05:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2174784", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21107136", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:05:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-13 14:05:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21107136", "type": "PubMed"}, "ts": "2023-07-13 14:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26322824", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:05:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26322824", "type": "PubMed"}, "ts": "2023-07-13 14:05:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-13 14:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00846"}, "ts": "2023-07-13 14:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:06:11 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-13 14:06:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-13 14:06:19 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 24}, "ts": "2023-07-13 14:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-13 14:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-13 14:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:06:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15289.184.184"}, "ts": "2023-07-13 14:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:06:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86YD5.57.57"}, "ts": "2023-07-13 14:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5X1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:06:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5X1.56.56"}, "ts": "2023-07-13 14:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:06:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43628"}, "ts": "2023-07-13 14:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43628", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF66"}, "ts": "2023-07-13 14:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08427", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:08:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08427"}, "ts": "2023-07-13 14:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:08:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16384851", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:08:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16384851", "type": "PubMed"}, "ts": "2023-07-13 14:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCS3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:09:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCS3-1"}, "ts": "2023-07-13 14:09:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y661", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y661"}, "ts": "2023-07-13 14:09:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15563506", "type": "PubMed"}, "ts": "2023-07-13 14:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15563506", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:10:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43451.404.404"}, "ts": "2023-07-13 14:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43451", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:10:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29018141", "type": "PubMed"}, "ts": "2023-07-13 14:10:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29018141", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:10:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0K012-1"}, "ts": "2023-07-13 14:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0K012-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34896343", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:10:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34896343", "type": "PubMed"}, "ts": "2023-07-13 14:10:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34896343", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 14:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:11:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPU3.418.418"}, "ts": "2023-07-13 14:11:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A46"}, "ts": "2023-07-13 14:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:11:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10414981", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:11:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10414981", "type": "PubMed"}, "ts": "2023-07-13 14:11:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08962-1"}, "ts": "2023-07-13 14:11:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41240-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:11:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P41240-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08962-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82450", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:12:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32ZG0"}, "ts": "2023-07-13 14:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32ZG0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:12:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-13 14:12:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-13 14:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:12:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0R8"}, "ts": "2023-07-13 14:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3SXY7"}, "ts": "2023-07-13 14:12:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P13647-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:13:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13647-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:13:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3SXY7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64112PJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:13:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64112PJ"}, "ts": "2023-07-13 14:13:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06753"}, "ts": "2023-07-13 14:13:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-13 14:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:14:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43294"}, "ts": "2023-07-13 14:14:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32029686", "type": "PubMed"}, "ts": "2023-07-13 14:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32029686", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:14:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q587J7"}, "ts": "2023-07-13 14:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:15:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43294"}, "ts": "2023-07-13 14:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q587J7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:15:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q969V1.14.14"}, "ts": "2023-07-13 14:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969V1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11171", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:15:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11171.60.60"}, "ts": "2023-07-13 14:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7W2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:16:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7W2"}, "ts": "2023-07-13 14:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D8U8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:16:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D8U8-1"}, "ts": "2023-07-13 14:16:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34884812", "type": "PubMed"}, "ts": "2023-07-13 14:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34884812", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34884812", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 14:16:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CTG6.1022.1022"}, "ts": "2023-07-13 14:17:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CTG6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47811", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:18:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47811.182.182"}, "ts": "2023-07-13 14:18:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02856QE"}, "ts": "2023-07-13 14:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02856QE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:19:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26119091", "type": "PubMed"}, "ts": "2023-07-13 14:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26119091", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29754825", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:19:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29754825", "type": "PubMed"}, "ts": "2023-07-13 14:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L58"}, "ts": "2023-07-13 14:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43837", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:19:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43837"}, "ts": "2023-07-13 14:19:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13497.714.714"}, "ts": "2023-07-13 14:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:19:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60522.1043.1043"}, "ts": "2023-07-13 14:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60522", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:20:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01518.280.280"}, "ts": "2023-07-13 14:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01518", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ90", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:20:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQ90.843.843"}, "ts": "2023-07-13 14:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5B9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:21:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5B9.650.650"}, "ts": "2023-07-13 14:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94911", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:21:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94911"}, "ts": "2023-07-13 14:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70347-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70347-1"}, "ts": "2023-07-13 14:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00846", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:21:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-13 14:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:22:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35474"}, "ts": "2023-07-13 14:22:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60814"}, "ts": "2023-07-13 14:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:23:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-13 14:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7730317", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:24:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7730317", "type": "PubMed"}, "ts": "2023-07-13 14:24:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-13 14:24:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33611"}, "ts": "2023-07-13 14:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33611", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15749018", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:25:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15749018", "type": "PubMed"}, "ts": "2023-07-13 14:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43529", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:25:15 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O43529", "cluster_type": "unselected"}, "ts": "2023-07-13 14:25:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43529", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 14:25:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15399", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:25:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15399.1139.1139"}, "ts": "2023-07-13 14:25:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00187"}, "ts": "2023-07-13 14:25:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00187", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGG3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:25:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGG3.119.119"}, "ts": "2023-07-13 14:25:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54652-1"}, "ts": "2023-07-13 14:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75635", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:26:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75635"}, "ts": "2023-07-13 14:26:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-13 14:26:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VT98", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:26:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VT98"}, "ts": "2023-07-13 14:26:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-13 14:26:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-13 14:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-13 14:26:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:27:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2EG98"}, "ts": "2023-07-13 14:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2EG98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:27:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JSH3-1.5.5"}, "ts": "2023-07-13 14:27:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JSH3-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:27:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9843982", "type": "PubMed"}, "ts": "2023-07-13 14:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9843982", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9843982", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 14:28:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29618633", "type": "PubMed"}, "ts": "2023-07-13 14:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29618633", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:28:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55735", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:28:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P55735", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:28:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39052.597.597"}, "ts": "2023-07-13 14:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06753", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:29:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H9A5"}, "ts": "2023-07-13 14:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9A5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCL4"}, "ts": "2023-07-13 14:29:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:30:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQF2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:30:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQF2.17.17"}, "ts": "2023-07-13 14:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:30:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84467IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:30:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-13 14:31:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VK4"}, "ts": "2023-07-13 14:31:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:31:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24700542", "type": "PubMed"}, "ts": "2023-07-13 14:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24700542", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A1E1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:31:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A1E1-1"}, "ts": "2023-07-13 14:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25233TU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:31:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25233TU"}, "ts": "2023-07-13 14:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14390", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:31:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14390.160.160"}, "ts": "2023-07-13 14:31:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6YAT4.200.200"}, "ts": "2023-07-13 14:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YAT4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20393562", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:32:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20393562", "type": "PubMed"}, "ts": "2023-07-13 14:32:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15661879", "type": "PubMed"}, "ts": "2023-07-13 14:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15661879", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:32:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAM9"}, "ts": "2023-07-13 14:33:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAM9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:33:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XZ0"}, "ts": "2023-07-13 14:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XZ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:33:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19827.285.285"}, "ts": "2023-07-13 14:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19827", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:33:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14814.212.212"}, "ts": "2023-07-13 14:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14814", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:33:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27063109", "type": "PubMed"}, "ts": "2023-07-13 14:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27063109", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:33:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32246SI"}, "ts": "2023-07-13 14:33:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 14:33:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TWL2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:33:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TWL2"}, "ts": "2023-07-13 14:33:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-13 14:33:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34306IB"}, "ts": "2023-07-13 14:33:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-13 14:33:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-13 14:33:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-13 14:33:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79939YZ"}, "ts": "2023-07-13 14:33:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17409FQ"}, "ts": "2023-07-13 14:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42440OJ"}, "ts": "2023-07-13 14:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51941GC"}, "ts": "2023-07-13 14:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61726TP"}, "ts": "2023-07-13 14:34:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08670"}, "ts": "2023-07-13 14:34:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55145-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:34:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O55145-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:34:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:34:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZM9-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:34:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6NZM9-1", "cluster_type": "unselected"}, "ts": "2023-07-13 14:34:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40576JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:34:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40576JC"}, "ts": "2023-07-13 14:34:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZM9-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-13 14:34:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62527ZD"}, "ts": "2023-07-13 14:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62527ZD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13647-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:35:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P13647-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHW6"}, "ts": "2023-07-13 14:35:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40763"}, "ts": "2023-07-13 14:35:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40763"}, "ts": "2023-07-13 14:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07141"}, "ts": "2023-07-13 14:36:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18354201", "type": "PubMed"}, "ts": "2023-07-13 14:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18354201", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULL4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:36:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULL4.270.270"}, "ts": "2023-07-13 14:36:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24807", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:36:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24807"}, "ts": "2023-07-13 14:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17160893", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:37:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17160893", "type": "PubMed"}, "ts": "2023-07-13 14:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8407951", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:37:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8407951", "type": "PubMed"}, "ts": "2023-07-13 14:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19634", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:37:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19634.62.62"}, "ts": "2023-07-13 14:37:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q2Q0I9-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:37:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2Q0I9-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:37:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18985798", "type": "PubMed"}, "ts": "2023-07-13 14:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18985798", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15205"}, "ts": "2023-07-13 14:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU06-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:38:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU06-1"}, "ts": "2023-07-13 14:38:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6W3.550.550"}, "ts": "2023-07-13 14:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6W3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZQ5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:38:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8JZQ5"}, "ts": "2023-07-13 14:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX01", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:38:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IX01.929.929"}, "ts": "2023-07-13 14:38:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H344.151.151"}, "ts": "2023-07-13 14:38:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H344", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:39:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:39:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14798"}, "ts": "2023-07-13 14:39:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15185", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:39:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15185.44.44"}, "ts": "2023-07-13 14:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-13 14:40:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:40:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15762.198.198"}, "ts": "2023-07-13 14:40:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11762-1.30.30"}, "ts": "2023-07-13 14:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11762-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15762", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:40:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9422506", "type": "PubMed"}, "ts": "2023-07-13 14:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9422506", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:40:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618-1"}, "ts": "2023-07-13 14:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ST3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:40:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96ST3.601.601"}, "ts": "2023-07-13 14:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15488CF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:40:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15488CF"}, "ts": "2023-07-13 14:40:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "8432527"}, "ts": "2023-07-13 14:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBQ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:41:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBQ6.17.17"}, "ts": "2023-07-13 14:41:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VGV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:41:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VGV0"}, "ts": "2023-07-13 14:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54652-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00367", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:42:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00367.79.79"}, "ts": "2023-07-13 14:42:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X59"}, "ts": "2023-07-13 14:42:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHI5"}, "ts": "2023-07-13 14:42:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:42:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-13 14:42:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07113"}, "ts": "2023-07-13 14:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:43:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090"}, "ts": "2023-07-13 14:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15057", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:43:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15057"}, "ts": "2023-07-13 14:43:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-13 14:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z129-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:43:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z129-1"}, "ts": "2023-07-13 14:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHU8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:43:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHU8-1"}, "ts": "2023-07-13 14:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10671526", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:45:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10671526", "type": "PubMed"}, "ts": "2023-07-13 14:45:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29463719", "type": "PubMed"}, "ts": "2023-07-13 14:45:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-13 14:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29463719", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:45:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-13 14:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20309", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:45:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20309"}, "ts": "2023-07-13 14:45:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33316"}, "ts": "2023-07-13 14:46:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33316", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:46:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q496J9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:46:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q496J9"}, "ts": "2023-07-13 14:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 14:46:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 14:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 14:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93386SF", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-13 14:46:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 14:46:35 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "G93386SF"}, "ts": "2023-07-13 14:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 14:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93386SF", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=G93386SF"}, "ts": "2023-07-13 14:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "84f2dd527656b82238a7559e1a184bec", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 14:46:37 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "84f2dd527656b82238a7559e1a184bec", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 14:46:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16224PF"}, "ts": "2023-07-13 14:46:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93386SF"}, "ts": "2023-07-13 14:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H790", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:46:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H790"}, "ts": "2023-07-13 14:46:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:46:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ADF7-1"}, "ts": "2023-07-13 14:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ADF7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78310", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:47:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78310.106.106"}, "ts": "2023-07-13 14:47:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18575747", "type": "PubMed"}, "ts": "2023-07-13 14:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18575747", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11962-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:47:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11962-1"}, "ts": "2023-07-13 14:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76071", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:48:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76071"}, "ts": "2023-07-13 14:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25799580", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:48:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25799580", "type": "PubMed"}, "ts": "2023-07-13 14:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:49:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU1"}, "ts": "2023-07-13 14:49:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:49:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESX2"}, "ts": "2023-07-13 14:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A075B6Q5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:49:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A075B6Q5-1.36.36"}, "ts": "2023-07-13 14:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08670", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:50:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9JIP7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 14:50:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72828HZ"}, "ts": "2023-07-13 14:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72828HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:50:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CQ4"}, "ts": "2023-07-13 14:50:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05279MG"}, "ts": "2023-07-13 14:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16157702", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:51:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16157702", "type": "PubMed"}, "ts": "2023-07-13 14:51:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:51:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16284", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:52:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16284.344.344"}, "ts": "2023-07-13 14:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45379"}, "ts": "2023-07-13 14:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:53:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAW3"}, "ts": "2023-07-13 14:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6JQN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:53:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6JQN1"}, "ts": "2023-07-13 14:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37802", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:53:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37802"}, "ts": "2023-07-13 14:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:53:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11440-1"}, "ts": "2023-07-13 14:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11440-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16235", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:53:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16235.199.199"}, "ts": "2023-07-13 14:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:53:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJ57-1"}, "ts": "2023-07-13 14:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MTZ0"}, "ts": "2023-07-13 14:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MTZ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJ57-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:54:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY5"}, "ts": "2023-07-13 14:54:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-13 14:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:54:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D98"}, "ts": "2023-07-13 14:54:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25016021", "type": "PubMed"}, "ts": "2023-07-13 14:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25016021", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BT60", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:55:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BT60.197.197"}, "ts": "2023-07-13 14:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15758"}, "ts": "2023-07-13 14:55:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-13 14:55:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14618"}, "ts": "2023-07-13 14:56:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2281186", "type": "PubMed"}, "ts": "2023-07-13 14:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2281186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:56:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "F1LW30.115.115"}, "ts": "2023-07-13 14:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LW30", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:56:14 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P55735", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55735", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:56:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12174PW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:56:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12174PW"}, "ts": "2023-07-13 14:56:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O96013.181.181"}, "ts": "2023-07-13 14:56:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96013", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:56:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28931551", "type": "PubMed"}, "ts": "2023-07-13 14:56:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28931551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11844", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:56:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11844"}, "ts": "2023-07-13 14:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R5N8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:56:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6R5N8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R5N8", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 14:56:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03953"}, "ts": "2023-07-13 14:57:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03953", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969R8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 14:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969R8"}, "ts": "2023-07-13 14:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY64", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:57:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY64.386.386"}, "ts": "2023-07-13 14:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28842709", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 14:57:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28842709", "type": "PubMed"}, "ts": "2023-07-13 14:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28842709", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 14:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99471", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 14:57:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99471", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 14:57:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36955", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:57:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36955.114.114"}, "ts": "2023-07-13 14:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56749GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07113", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 14:59:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72828HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 14:59:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72828HZ"}, "ts": "2023-07-13 14:59:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31151"}, "ts": "2023-07-13 14:59:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62433.330.330"}, "ts": "2023-07-13 14:59:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62433", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 14:59:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 14:59:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCS6"}, "ts": "2023-07-13 14:59:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23528-1"}, "ts": "2023-07-13 15:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 15:00:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 15:00:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 15:00:05 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 15:00:06 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 15:00:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 15:00:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10069337", "type": "PubMed"}, "ts": "2023-07-13 15:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10069337", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCU6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCU6"}, "ts": "2023-07-13 15:00:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76136FD"}, "ts": "2023-07-13 15:01:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G76136FD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:01:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-13 15:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30153-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5N1"}, "ts": "2023-07-13 15:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5N1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TY3"}, "ts": "2023-07-13 15:01:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84448IT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:02:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84448IT"}, "ts": "2023-07-13 15:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQK5-1"}, "ts": "2023-07-13 15:02:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQK5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:02:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5XJE5-1.247.247"}, "ts": "2023-07-13 15:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:03:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70342"}, "ts": "2023-07-13 15:03:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43252"}, "ts": "2023-07-13 15:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25311", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:03:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25311"}, "ts": "2023-07-13 15:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZN17", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:03:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZN17"}, "ts": "2023-07-13 15:03:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7673224", "type": "PubMed"}, "ts": "2023-07-13 15:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7673224", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:04:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16442"}, "ts": "2023-07-13 15:04:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15539-1"}, "ts": "2023-07-13 15:04:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15539-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q587K3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:04:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q587K3-1"}, "ts": "2023-07-13 15:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:04:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VY80.179.179"}, "ts": "2023-07-13 15:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VY80", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:04:36 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-13 15:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-13 15:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-13 15:05:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17812"}, "ts": "2023-07-13 15:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-13 15:05:20 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-13 15:05:20 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 25}, "ts": "2023-07-13 15:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">25", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=25"}, "ts": "2023-07-13 15:05:22 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 25}, "ts": "2023-07-13 15:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-13 15:05:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-13 15:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15822"}, "ts": "2023-07-13 15:05:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15822", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75545SZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:05:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75545SZ"}, "ts": "2023-07-13 15:05:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPJ0"}, "ts": "2023-07-13 15:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01042-1"}, "ts": "2023-07-13 15:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI22", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:06:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI22"}, "ts": "2023-07-13 15:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05279MG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:07:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-13 15:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:08:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15262.496.496"}, "ts": "2023-07-13 15:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15262", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:08:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34619148", "type": "PubMed"}, "ts": "2023-07-13 15:08:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34619148", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:08:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-13 15:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10758-1"}, "ts": "2023-07-13 15:08:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-13 15:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10758-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:08:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01024"}, "ts": "2023-07-13 15:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:09:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:09:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A49"}, "ts": "2023-07-13 15:09:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-13 15:09:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17050-1"}, "ts": "2023-07-13 15:09:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXE1"}, "ts": "2023-07-13 15:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30308012", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:09:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30308012", "type": "PubMed"}, "ts": "2023-07-13 15:09:23 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 15:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 15:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:10:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00739"}, "ts": "2023-07-13 15:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M729", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:10:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M729"}, "ts": "2023-07-13 15:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:10:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-13 15:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95872", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:10:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95872"}, "ts": "2023-07-13 15:10:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19493963", "type": "PubMed"}, "ts": "2023-07-13 15:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19493963", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:10:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QA5"}, "ts": "2023-07-13 15:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:11:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 15:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22355-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:11:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3T4-1"}, "ts": "2023-07-13 15:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15758", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3T4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:11:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22355-1"}, "ts": "2023-07-13 15:12:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20888800", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:12:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20888800", "type": "PubMed"}, "ts": "2023-07-13 15:12:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HC35.16.16"}, "ts": "2023-07-13 15:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC35", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:12:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40394"}, "ts": "2023-07-13 15:12:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:13:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:13:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6K9"}, "ts": "2023-07-13 15:13:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 15:13:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WBY5"}, "ts": "2023-07-13 15:13:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WBY5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:13:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:13:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKL3.668.668"}, "ts": "2023-07-13 15:13:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:15:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGJ1"}, "ts": "2023-07-13 15:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDM6"}, "ts": "2023-07-13 15:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:15:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23528-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:15:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13497"}, "ts": "2023-07-13 15:16:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-13 15:17:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05156"}, "ts": "2023-07-13 15:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05156", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 15:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00688XN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:18:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00688XN"}, "ts": "2023-07-13 15:18:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07108-1"}, "ts": "2023-07-13 15:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07108-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:18:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00387", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:18:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00387"}, "ts": "2023-07-13 15:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68400", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:18:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68400"}, "ts": "2023-07-13 15:18:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY89.87.87"}, "ts": "2023-07-13 15:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY89", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33678755", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:18:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33678755", "type": "PubMed"}, "ts": "2023-07-13 15:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33678755", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 15:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48356", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:19:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48356"}, "ts": "2023-07-13 15:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53539", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:19:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53539"}, "ts": "2023-07-13 15:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:20:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y82", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:20:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86Y82"}, "ts": "2023-07-13 15:20:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z330-1"}, "ts": "2023-07-13 15:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z330-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:20:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23919"}, "ts": "2023-07-13 15:20:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15066"}, "ts": "2023-07-13 15:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15066", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46531", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:21:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46531.310.310"}, "ts": "2023-07-13 15:21:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPH5.394.394"}, "ts": "2023-07-13 15:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:21:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19493-1"}, "ts": "2023-07-13 15:22:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19493-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:22:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23104988", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:22:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23104988", "type": "PubMed"}, "ts": "2023-07-13 15:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225"}, "ts": "2023-07-13 15:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01042-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:22:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61818", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:22:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61818.666.666"}, "ts": "2023-07-13 15:22:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28178529", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:23:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28178529", "type": "PubMed"}, "ts": "2023-07-13 15:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37840-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18938DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01024", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:24:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95817"}, "ts": "2023-07-13 15:24:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EXX3"}, "ts": "2023-07-13 15:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EXX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NY8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:25:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96NY8.144.144"}, "ts": "2023-07-13 15:25:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17050-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16546ZZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:25:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16546ZZ"}, "ts": "2023-07-13 15:25:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-13 15:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95935", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:25:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95935"}, "ts": "2023-07-13 15:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_detail.html", "message": "page access"}, "ts": "2023-07-13 15:26:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2J0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:26:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2J0"}, "ts": "2023-07-13 15:26:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 15:27:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96BT7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 15:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BT7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 15:27:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LYI0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:27:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LYI0-1"}, "ts": "2023-07-13 15:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:27:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P53992.646.646"}, "ts": "2023-07-13 15:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05023", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:27:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05023"}, "ts": "2023-07-13 15:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06110VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:27:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2GUY4-1"}, "ts": "2023-07-13 15:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2GUY4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:28:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXA5"}, "ts": "2023-07-13 15:28:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZY6.44.44"}, "ts": "2023-07-13 15:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:30:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60502.399.399"}, "ts": "2023-07-13 15:30:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:30:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-13 15:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8626379", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:30:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8626379", "type": "PubMed"}, "ts": "2023-07-13 15:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI27", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:30:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NI27.150.150"}, "ts": "2023-07-13 15:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:30:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXF5"}, "ts": "2023-07-13 15:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:30:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.3663.3663"}, "ts": "2023-07-13 15:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94986", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:31:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94986"}, "ts": "2023-07-13 15:31:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93386SF"}, "ts": "2023-07-13 15:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93386SF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:31:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60923RB"}, "ts": "2023-07-13 15:31:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81910EG"}, "ts": "2023-07-13 15:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54983-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:31:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54983-1"}, "ts": "2023-07-13 15:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09486", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:32:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09486"}, "ts": "2023-07-13 15:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:32:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34635350", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:32:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34635350", "type": "PubMed"}, "ts": "2023-07-13 15:32:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6J4-1"}, "ts": "2023-07-13 15:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6J4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:33:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880"}, "ts": "2023-07-13 15:33:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39032", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:33:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39032"}, "ts": "2023-07-13 15:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFP4"}, "ts": "2023-07-13 15:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:33:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0Q5-1"}, "ts": "2023-07-13 15:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0Q5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZM1"}, "ts": "2023-07-13 15:33:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12109.814.814"}, "ts": "2023-07-13 15:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12109", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:33:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6R6"}, "ts": "2023-07-13 15:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1N1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:33:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T1N1"}, "ts": "2023-07-13 15:33:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:34:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHX3"}, "ts": "2023-07-13 15:34:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:34:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9E0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:34:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99798"}, "ts": "2023-07-13 15:34:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N9E0.177.177"}, "ts": "2023-07-13 15:34:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00966"}, "ts": "2023-07-13 15:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24530", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:35:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24530.270.270"}, "ts": "2023-07-13 15:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MRT5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:35:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8MRT5.178.178"}, "ts": "2023-07-13 15:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7824266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:36:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7824266", "type": "PubMed"}, "ts": "2023-07-13 15:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RA16", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RA16"}, "ts": "2023-07-13 15:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 15:36:30 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 15:36:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 15:36:36 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 15:36:47 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "neuregulin", "term_category": "any"}, "ts": "2023-07-13 15:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">1a8205f0b99394d87daeb5c89f018b8d", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"neuregulin\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 15:36:48 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1a8205f0b99394d87daeb5c89f018b8d", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 15:36:48 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1a8205f0b99394d87daeb5c89f018b8d", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 15:37:07 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:37:07 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "1a8205f0b99394d87daeb5c89f018b8d", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1a8205f0b99394d87daeb5c89f018b8d", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Search modification initiated"}, "ts": "2023-07-13 15:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1a8205f0b99394d87daeb5c89f018b8d", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 15:37:14 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "nrg", "term_category": "any"}, "ts": "2023-07-13 15:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1a8205f0b99394d87daeb5c89f018b8d>d89b0aa487bf0a4c162cae8a52264dfd", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"nrg\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 15:37:14 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 15:37:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:37:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20226"}, "ts": "2023-07-13 15:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14511-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:37:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14511-1"}, "ts": "2023-07-13 15:37:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94910", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94910"}, "ts": "2023-07-13 15:37:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25217958", "type": "PubMed"}, "ts": "2023-07-13 15:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4S7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25217958", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:37:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T4S7.2137.2137"}, "ts": "2023-07-13 15:37:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 15:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-13 15:38:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53564"}, "ts": "2023-07-13 15:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53564", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:38:07 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 15:38:25 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:38:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D132"}, "ts": "2023-07-13 15:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:38:36 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "offset": 21, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:38:36 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "offset": 41, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:38:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28842479", "type": "PubMed"}, "ts": "2023-07-13 15:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28842479", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02447", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:39:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02447.34.34"}, "ts": "2023-07-13 15:39:14 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "offset": 61, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:39:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6J6"}, "ts": "2023-07-13 15:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6J6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:39:37 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d89b0aa487bf0a4c162cae8a52264dfd", "offset": 81, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWG1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:39:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWG1-1"}, "ts": "2023-07-13 15:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:40:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULZ9"}, "ts": "2023-07-13 15:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:40:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519-1"}, "ts": "2023-07-13 15:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:40:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33463482", "type": "PubMed"}, "ts": "2023-07-13 15:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33463482", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-13 15:40:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-13 15:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-13 15:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-13 15:40:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71814NS"}, "ts": "2023-07-13 15:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06865", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:41:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06865"}, "ts": "2023-07-13 15:41:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15394-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:41:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15394-1"}, "ts": "2023-07-13 15:41:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14817"}, "ts": "2023-07-13 15:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75489-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:42:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75489-1"}, "ts": "2023-07-13 15:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZX3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02766"}, "ts": "2023-07-13 15:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZX3"}, "ts": "2023-07-13 15:43:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:43:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35504"}, "ts": "2023-07-13 15:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35504", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:43:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16552-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16552-1"}, "ts": "2023-07-13 15:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35579"}, "ts": "2023-07-13 15:43:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11226-1"}, "ts": "2023-07-13 15:43:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGH7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:44:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BGH7.52.52"}, "ts": "2023-07-13 15:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "asgr", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 15:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 15:44:31 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "asgr"}, "ts": "2023-07-13 15:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "asgr", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=asgr"}, "ts": "2023-07-13 15:44:31 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 15:44:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84852GW"}, "ts": "2023-07-13 15:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 15:45:03 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "hl2", "term_category": "any"}, "ts": "2023-07-13 15:45:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">a39b1f9ea062e8a604f58897d171e9cf", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"hl2\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 15:45:03 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:45:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a39b1f9ea062e8a604f58897d171e9cf", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 15:45:04 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "a39b1f9ea062e8a604f58897d171e9cf", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:45:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLF7"}, "ts": "2023-07-13 15:45:14 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 15:45:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWL3"}, "ts": "2023-07-13 15:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWL3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:45:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CX13-1"}, "ts": "2023-07-13 15:45:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX13-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 15:45:25 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "asgr", "term_category": "any"}, "ts": "2023-07-13 15:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">dbbb73caa486828bc4decb336f803d51", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"asgr\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 15:45:25 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "dbbb73caa486828bc4decb336f803d51", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 15:45:26 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "dbbb73caa486828bc4decb336f803d51", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24721-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:45:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24721-1"}, "ts": "2023-07-13 15:45:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14543-1"}, "ts": "2023-07-13 15:45:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04756"}, "ts": "2023-07-13 15:45:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052"}, "ts": "2023-07-13 15:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54284", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:45:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54284"}, "ts": "2023-07-13 15:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00450-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:46:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00450-1"}, "ts": "2023-07-13 15:46:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:46:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27405760", "type": "PubMed"}, "ts": "2023-07-13 15:46:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27405760", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:46:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PE2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:46:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PE2.556.556"}, "ts": "2023-07-13 15:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPT6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:46:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPT6.1092.1092"}, "ts": "2023-07-13 15:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:46:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6L6"}, "ts": "2023-07-13 15:46:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11049", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:46:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11049.40.40"}, "ts": "2023-07-13 15:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0G0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0G0-1"}, "ts": "2023-07-13 15:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:47:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H244", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:47:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H244"}, "ts": "2023-07-13 15:47:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-13 15:47:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13811NF"}, "ts": "2023-07-13 15:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13811NF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:47:08 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 15:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "dbbb73caa486828bc4decb336f803d51", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 15:47:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "dbbb73caa486828bc4decb336f803d51", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 15:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42226"}, "ts": "2023-07-13 15:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34927-1"}, "ts": "2023-07-13 15:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34927-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:47:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32747782", "type": "PubMed"}, "ts": "2023-07-13 15:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32747782", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:47:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06587.349.349"}, "ts": "2023-07-13 15:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06587", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93386SF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:47:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93386SF"}, "ts": "2023-07-13 15:47:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60923RB"}, "ts": "2023-07-13 15:47:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81910EG"}, "ts": "2023-07-13 15:47:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93386SF"}, "ts": "2023-07-13 15:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UHU5"}, "ts": "2023-07-13 15:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 15:49:01 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 15:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 15:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11863375", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:49:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11863375", "type": "PubMed"}, "ts": "2023-07-13 15:49:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2P0-1"}, "ts": "2023-07-13 15:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2P0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25750265", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:50:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25750265", "type": "PubMed"}, "ts": "2023-07-13 15:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75976", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75976"}, "ts": "2023-07-13 15:50:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:50:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4G0X9.487.487"}, "ts": "2023-07-13 15:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G0X9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:51:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15328.69.69"}, "ts": "2023-07-13 15:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15328", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16572", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16572"}, "ts": "2023-07-13 15:51:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-13 15:52:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSA2"}, "ts": "2023-07-13 15:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:52:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-13 15:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KQ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:52:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KQ7.1114.1114"}, "ts": "2023-07-13 15:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70885YM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:53:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 15:53:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70885YM"}, "ts": "2023-07-13 15:53:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70885YM"}, "ts": "2023-07-13 15:53:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97803FU"}, "ts": "2023-07-13 15:53:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25347ZR"}, "ts": "2023-07-13 15:53:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94583DZ"}, "ts": "2023-07-13 15:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBG0"}, "ts": "2023-07-13 15:53:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-13 15:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:53:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95630", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:53:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95630"}, "ts": "2023-07-13 15:53:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGM3.322.322"}, "ts": "2023-07-13 15:53:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:53:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JFS9-1"}, "ts": "2023-07-13 15:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JFS9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48547", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:54:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48547.231.231"}, "ts": "2023-07-13 15:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:54:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2KHM9.860.860"}, "ts": "2023-07-13 15:54:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18666", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-13 15:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18666"}, "ts": "2023-07-13 15:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04627", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04627"}, "ts": "2023-07-13 15:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96I15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:55:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96I15"}, "ts": "2023-07-13 15:55:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4D3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:55:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T4D3"}, "ts": "2023-07-13 15:55:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01019"}, "ts": "2023-07-13 15:55:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:55:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LI73"}, "ts": "2023-07-13 15:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:56:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04186"}, "ts": "2023-07-13 15:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A1B0GX68", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:56:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A1B0GX68.95.95"}, "ts": "2023-07-13 15:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2G1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:56:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2G1.884.884"}, "ts": "2023-07-13 15:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58397", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 15:56:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58397"}, "ts": "2023-07-13 15:56:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-13 15:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04035", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 15:57:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04035.424.424"}, "ts": "2023-07-13 15:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5A9"}, "ts": "2023-07-13 15:58:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:58:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 15:58:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20732627", "type": "PubMed"}, "ts": "2023-07-13 15:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20732627", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 15:59:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:59:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33167210", "type": "PubMed"}, "ts": "2023-07-13 15:59:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33167210", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 15:59:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03127AL"}, "ts": "2023-07-13 15:59:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-13 15:59:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04576KS"}, "ts": "2023-07-13 15:59:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 15:59:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06601SQ"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14985NB"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15363AF"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16265MV"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23432EQ"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23453IV"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29078QN"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24835MQ"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51114UP"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80333GO"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47909JD"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87433AX"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54612UD"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74120KH"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-13 15:59:53 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 16:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 16:00:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99466.93.93"}, "ts": "2023-07-13 16:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 16:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99466", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:00:03 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 16:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 16:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 16:00:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UL62.545.545"}, "ts": "2023-07-13 16:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL62", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11226-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q30KQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:00:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q30KQ4"}, "ts": "2023-07-13 16:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33167210", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:00:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33167210", "type": "PubMed"}, "ts": "2023-07-13 16:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03127AL"}, "ts": "2023-07-13 16:00:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04576KS"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06601SQ"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14985NB"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14994KB"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15363AF"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16265MV"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16828VN"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23432EQ"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23453IV"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29078QN"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24835MQ"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51114UP"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80333GO"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87433AX"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-13 16:00:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47909JD"}, "ts": "2023-07-13 16:00:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54612UD"}, "ts": "2023-07-13 16:00:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74120KH"}, "ts": "2023-07-13 16:00:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-13 16:00:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11741334", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:00:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11741334", "type": "PubMed"}, "ts": "2023-07-13 16:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32574671", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:00:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32574671", "type": "PubMed"}, "ts": "2023-07-13 16:00:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12789.1015.1015"}, "ts": "2023-07-13 16:01:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKZ1.396.396"}, "ts": "2023-07-13 16:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKZ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12789", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3M7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3M7"}, "ts": "2023-07-13 16:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ44-1"}, "ts": "2023-07-13 16:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ44-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14543-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:01:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZSR9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:01:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZSR9.221.221"}, "ts": "2023-07-13 16:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23610558", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:01:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23610558", "type": "PubMed"}, "ts": "2023-07-13 16:01:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X60.99.99"}, "ts": "2023-07-13 16:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X60", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:01:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14894", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:01:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14894.104.104"}, "ts": "2023-07-13 16:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:02:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBM8"}, "ts": "2023-07-13 16:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:03:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:03:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22441692", "type": "PubMed"}, "ts": "2023-07-13 16:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22441692", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:03:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-13 16:03:26 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 16:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 16:03:53 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:03:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 16:03:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TSG4"}, "ts": "2023-07-13 16:03:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TSG4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:04:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GW9"}, "ts": "2023-07-13 16:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6FIF0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:04:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6FIF0"}, "ts": "2023-07-13 16:04:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 16:05:05 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "Galnt1", "term_category": "any"}, "ts": "2023-07-13 16:05:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">bb7356775d0cce6b9079b9936f0c2573", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"Galnt1\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 16:05:06 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "bb7356775d0cce6b9079b9936f0c2573", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:05:06 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "bb7356775d0cce6b9079b9936f0c2573", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:05:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12792.173.173"}, "ts": "2023-07-13 16:05:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99N01"}, "ts": "2023-07-13 16:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12792", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99N01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:05:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88619MM"}, "ts": "2023-07-13 16:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88619MM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:05:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10472-1"}, "ts": "2023-07-13 16:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10472-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:05:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 16:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:05:45 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 16:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:05:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00195"}, "ts": "2023-07-13 16:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:05:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 16:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Galnt2", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 16:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:06:45 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "Galnt2"}, "ts": "2023-07-13 16:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Galnt2", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=Galnt2"}, "ts": "2023-07-13 16:06:46 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19d7b6fb3eff1bc98a81ecae3a478efa", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:06:51 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "19d7b6fb3eff1bc98a81ecae3a478efa", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:06:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10471-1"}, "ts": "2023-07-13 16:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10471-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:06:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 16:06:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 16:06:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9QY42", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 16:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY42", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:06:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02311IE"}, "ts": "2023-07-13 16:07:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 16:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:07:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 16:07:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 16:07:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 16:07:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10471-1"}, "ts": "2023-07-13 16:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10471-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:07:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NI03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:07:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NI03"}, "ts": "2023-07-13 16:07:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 16:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01889"}, "ts": "2023-07-13 16:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01889", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22768VO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:08:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-13 16:08:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-13 16:08:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-13 16:08:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10471-1"}, "ts": "2023-07-13 16:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10471-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NC96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:08:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NC96"}, "ts": "2023-07-13 16:08:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-13 16:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:08:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IY45"}, "ts": "2023-07-13 16:08:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-13 16:08:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V096"}, "ts": "2023-07-13 16:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V096", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:08:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y277"}, "ts": "2023-07-13 16:08:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:09:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0S5V8-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:09:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0S5V8-1"}, "ts": "2023-07-13 16:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05724UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:09:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q10471-1.67.67"}, "ts": "2023-07-13 16:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10471-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:09:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48735"}, "ts": "2023-07-13 16:09:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q10471-1.59.59"}, "ts": "2023-07-13 16:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10471-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TIE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:09:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TIE3"}, "ts": "2023-07-13 16:09:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10471-1"}, "ts": "2023-07-13 16:09:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10471-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:10:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23584533", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:10:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23584533", "type": "PubMed"}, "ts": "2023-07-13 16:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35123"}, "ts": "2023-07-13 16:10:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35123", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:10:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23929945", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:11:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23929945", "type": "PubMed"}, "ts": "2023-07-13 16:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:11:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JRM2"}, "ts": "2023-07-13 16:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JRM2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23584533", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:12:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23584533", "type": "PubMed"}, "ts": "2023-07-13 16:12:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M1K9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:12:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2M1K9.207.207"}, "ts": "2023-07-13 16:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78410", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:12:15 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P78410", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 16:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12325022", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:12:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12325022", "type": "PubMed"}, "ts": "2023-07-13 16:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64394MX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LJ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:13:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LJ2"}, "ts": "2023-07-13 16:13:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g29068fm"}, "ts": "2023-07-13 16:13:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97797-1"}, "ts": "2023-07-13 16:13:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10.1038/emboj.2013.79", "type": "DOI"}, "ts": "2023-07-13 16:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:13:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10.1038/emboj.2013.79", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:13:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 16:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:14:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCU5"}, "ts": "2023-07-13 16:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11689443", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:14:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11689443", "type": "PubMed"}, "ts": "2023-07-13 16:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15077", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:15:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15077.7.7"}, "ts": "2023-07-13 16:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AA06", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:15:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AA06"}, "ts": "2023-07-13 16:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15525651", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AA06", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 16:15:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15525651", "type": "PubMed"}, "ts": "2023-07-13 16:15:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13929.263.263"}, "ts": "2023-07-13 16:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13929", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:15:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52948.670.670"}, "ts": "2023-07-13 16:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52948", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:16:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O95047", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 16:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95047", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95047", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 16:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35314", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:16:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35314.93.93"}, "ts": "2023-07-13 16:16:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VBZ3.241.241"}, "ts": "2023-07-13 16:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VBZ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10275", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:16:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10275.775.775"}, "ts": "2023-07-13 16:16:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10471-1"}, "ts": "2023-07-13 16:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10471-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9263035", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:16:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9263035", "type": "PubMed"}, "ts": "2023-07-13 16:16:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16576"}, "ts": "2023-07-13 16:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16576", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:16:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M076", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:17:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M076"}, "ts": "2023-07-13 16:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:17:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q76LL6.921.921"}, "ts": "2023-07-13 16:17:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-13 16:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TXZ1"}, "ts": "2023-07-13 16:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TXZ1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:17:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15907"}, "ts": "2023-07-13 16:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "software", "message": "page access"}, "ts": "2023-07-13 16:18:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-13 16:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:19:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P06731", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 16:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt3", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 16:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:19:33 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "galnt3"}, "ts": "2023-07-13 16:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt3", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=galnt3"}, "ts": "2023-07-13 16:19:33 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "72e066c4f77b5028bfeded810a9d3b25", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:19:35 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "72e066c4f77b5028bfeded810a9d3b25", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14435-1"}, "ts": "2023-07-13 16:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14435-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:19:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-13 16:19:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24084IV"}, "ts": "2023-07-13 16:19:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-13 16:19:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19690332", "type": "PubMed"}, "ts": "2023-07-13 16:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19690332", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:20:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46013"}, "ts": "2023-07-13 16:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:20:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08240.284.284"}, "ts": "2023-07-13 16:20:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08240", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:20:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVE0"}, "ts": "2023-07-13 16:20:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVE0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22105", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:20:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22105.31.31"}, "ts": "2023-07-13 16:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:20:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95180"}, "ts": "2023-07-13 16:20:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95180", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:20:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68G74.17.17"}, "ts": "2023-07-13 16:21:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68G74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D15", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:21:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96D15.88.88"}, "ts": "2023-07-13 16:21:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2J2.980.980"}, "ts": "2023-07-13 16:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2J2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt4", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 16:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:21:35 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "galnt4"}, "ts": "2023-07-13 16:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt4", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=galnt4"}, "ts": "2023-07-13 16:21:35 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b88c04b2f0a283b1b7cc30a8749e226c", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:21:36 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b88c04b2f0a283b1b7cc30a8749e226c", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:21:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4A0-1"}, "ts": "2023-07-13 16:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4A0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:21:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-13 16:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VST9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:21:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VST9.7244.7244"}, "ts": "2023-07-13 16:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt4", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 16:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:21:56 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "galnt4"}, "ts": "2023-07-13 16:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt4", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=galnt4"}, "ts": "2023-07-13 16:21:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZRS2.960.960"}, "ts": "2023-07-13 16:21:57 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3b4cd3c0358a32c23a67cd6a258699df", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRS2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:21:58 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "3b4cd3c0358a32c23a67cd6a258699df", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4A0-1"}, "ts": "2023-07-13 16:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4A0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39688", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:22:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P39688.185.185"}, "ts": "2023-07-13 16:22:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NZ9"}, "ts": "2023-07-13 16:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-13 16:22:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02311IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:22:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZL6"}, "ts": "2023-07-13 16:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZL6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:23:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:23:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13563"}, "ts": "2023-07-13 16:23:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27090"}, "ts": "2023-07-13 16:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27090", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULE3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:23:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULE3.375.375"}, "ts": "2023-07-13 16:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q18PE1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:23:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q18PE1.256.256"}, "ts": "2023-07-13 16:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22736", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:23:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22736.530.530"}, "ts": "2023-07-13 16:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt5", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 16:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:23:46 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "galnt5"}, "ts": "2023-07-13 16:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "galnt5", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=galnt5"}, "ts": "2023-07-13 16:23:46 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7dc1f51066a1e0c6b3ef3c87fd33e202", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:23:47 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7dc1f51066a1e0c6b3ef3c87fd33e202", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:23:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7M9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:23:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7M9-1"}, "ts": "2023-07-13 16:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:23:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20657592", "type": "PubMed"}, "ts": "2023-07-13 16:23:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63027-1"}, "ts": "2023-07-13 16:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20657592", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63027-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:24:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91Y20-1"}, "ts": "2023-07-13 16:24:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556"}, "ts": "2023-07-13 16:24:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Y20-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:24:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g29068fm", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:24:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23511"}, "ts": "2023-07-13 16:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62940", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:25:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62940.212.212"}, "ts": "2023-07-13 16:25:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10574768", "type": "PubMed"}, "ts": "2023-07-13 16:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10574768", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15846", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:25:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15846.412.412"}, "ts": "2023-07-13 16:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60331", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:26:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60331.649.649"}, "ts": "2023-07-13 16:26:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97952"}, "ts": "2023-07-13 16:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97952", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:26:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36268.344.344"}, "ts": "2023-07-13 16:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36268", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:27:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17858"}, "ts": "2023-07-13 16:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:27:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3SXM0.70.70"}, "ts": "2023-07-13 16:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3SXM0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:27:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LJ8"}, "ts": "2023-07-13 16:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LJ8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:28:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N693.348.348"}, "ts": "2023-07-13 16:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N693", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:28:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZU1"}, "ts": "2023-07-13 16:28:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z319.208.208"}, "ts": "2023-07-13 16:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z319", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21589-1"}, "ts": "2023-07-13 16:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21589-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97797-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:29:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF71"}, "ts": "2023-07-13 16:29:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF71", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:29:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02447"}, "ts": "2023-07-13 16:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02447", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJY9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJY9-1"}, "ts": "2023-07-13 16:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:30:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6UXT8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 16:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXT8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:30:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12955-1"}, "ts": "2023-07-13 16:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12955-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47196", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:30:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-13 16:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUT0"}, "ts": "2023-07-13 16:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUT0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:31:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X19.135.135"}, "ts": "2023-07-13 16:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X19", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:31:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V9H8"}, "ts": "2023-07-13 16:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V9H8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:31:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00115"}, "ts": "2023-07-13 16:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:33:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88488"}, "ts": "2023-07-13 16:33:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T2N8"}, "ts": "2023-07-13 16:33:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T2N8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:33:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NNM3.1263.1263"}, "ts": "2023-07-13 16:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NNM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:33:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15104-1"}, "ts": "2023-07-13 16:34:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P31", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:34:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96P31.127.127"}, "ts": "2023-07-13 16:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:34:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99L43", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 16:34:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99L43", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 16:34:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51654"}, "ts": "2023-07-13 16:35:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:35:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15822.3.3"}, "ts": "2023-07-13 16:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:35:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.367.367"}, "ts": "2023-07-13 16:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75427"}, "ts": "2023-07-13 16:36:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LTR3-1"}, "ts": "2023-07-13 16:36:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LTR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:36:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR00", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:36:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:36:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR00"}, "ts": "2023-07-13 16:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:36:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PQ0.133.133"}, "ts": "2023-07-13 16:36:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9812896", "type": "PubMed"}, "ts": "2023-07-13 16:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9812896", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:37:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32418"}, "ts": "2023-07-13 16:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22844456", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:37:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22844456", "type": "PubMed"}, "ts": "2023-07-13 16:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20646", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:38:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20646"}, "ts": "2023-07-13 16:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:38:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40261"}, "ts": "2023-07-13 16:38:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N135", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:38:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N135"}, "ts": "2023-07-13 16:38:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-13 16:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29066855", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:39:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29066855", "type": "PubMed"}, "ts": "2023-07-13 16:39:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:39:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TL1"}, "ts": "2023-07-13 16:39:43 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 16:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "m55g7gpuzx76uks3afjitq5x2cnjygx1", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 16:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58304-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:40:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58304-1"}, "ts": "2023-07-13 16:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:40:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42679.273.273"}, "ts": "2023-07-13 16:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42679", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:40:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D8M7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D8M7"}, "ts": "2023-07-13 16:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:41:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YZ3"}, "ts": "2023-07-13 16:41:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDQ1.136.136"}, "ts": "2023-07-13 16:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:42:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13638-1"}, "ts": "2023-07-13 16:43:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "F1M386.644.644"}, "ts": "2023-07-13 16:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M386", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:43:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09429.97.97"}, "ts": "2023-07-13 16:43:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-13 16:43:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15193700", "type": "PubMed"}, "ts": "2023-07-13 16:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15193700", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8628291", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:46:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8628291", "type": "PubMed"}, "ts": "2023-07-13 16:46:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:46:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10852"}, "ts": "2023-07-13 16:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10852", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:46:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI7"}, "ts": "2023-07-13 16:46:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33727633", "type": "PubMed"}, "ts": "2023-07-13 16:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33727633", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:47:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU9"}, "ts": "2023-07-13 16:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:47:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBL0.1481.1481"}, "ts": "2023-07-13 16:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBL0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11276", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:47:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11276.2198.2198"}, "ts": "2023-07-13 16:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15654", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:47:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15654.298.298"}, "ts": "2023-07-13 16:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00115", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GLANT6", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 16:49:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:49:19 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GLANT6"}, "ts": "2023-07-13 16:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GLANT6", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GLANT6"}, "ts": "2023-07-13 16:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT6", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-13 16:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:49:27 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GALNT6"}, "ts": "2023-07-13 16:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT6", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GALNT6"}, "ts": "2023-07-13 16:49:27 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "52d13264e01852262c4012b583868b2c", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:49:29 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "52d13264e01852262c4012b583868b2c", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:49:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCL4-1"}, "ts": "2023-07-13 16:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCL4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:49:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-13 16:49:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54855.353.353"}, "ts": "2023-07-13 16:49:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54855", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:49:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JQ2.713.713"}, "ts": "2023-07-13 16:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:50:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60568"}, "ts": "2023-07-13 16:50:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15064728", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MZ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:50:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15064728", "type": "PubMed"}, "ts": "2023-07-13 16:50:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99MZ6.1339.1339"}, "ts": "2023-07-13 16:50:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TPK1-1"}, "ts": "2023-07-13 16:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TPK1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75364", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:50:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75364.284.284"}, "ts": "2023-07-13 16:50:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00170-1"}, "ts": "2023-07-13 16:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00170-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCK5"}, "ts": "2023-07-13 16:50:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:51:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13612.1021.1021"}, "ts": "2023-07-13 16:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13612", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:51:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40199.224.224"}, "ts": "2023-07-13 16:51:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40199", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78325"}, "ts": "2023-07-13 16:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78325", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZL6-1"}, "ts": "2023-07-13 16:53:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZL6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:53:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96BD5.324.324"}, "ts": "2023-07-13 16:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:53:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BZ9"}, "ts": "2023-07-13 16:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98174", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:53:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98174.48.48"}, "ts": "2023-07-13 16:53:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-13 16:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNJT7", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 16:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:54:59 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GALNJT7"}, "ts": "2023-07-13 16:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNJT7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GALNJT7"}, "ts": "2023-07-13 16:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWB1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWB1-1"}, "ts": "2023-07-13 16:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Performing Global Search"}, "ts": "2023-07-13 16:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:55:07 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "GALNT7"}, "ts": "2023-07-13 16:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 16:55:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GALNT7", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=GALNT7"}, "ts": "2023-07-13 16:55:07 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 16:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "915e0eb8dcf030a55c41bec730a8c0dd", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 16:55:08 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "915e0eb8dcf030a55c41bec730a8c0dd", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 16:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ82-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:55:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ82-1"}, "ts": "2023-07-13 16:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9473574", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:55:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9473574", "type": "PubMed"}, "ts": "2023-07-13 16:55:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SF2-1"}, "ts": "2023-07-13 16:55:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SF2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K304", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K304"}, "ts": "2023-07-13 16:55:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20220065", "type": "PubMed"}, "ts": "2023-07-13 16:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20220065", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:55:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07195"}, "ts": "2023-07-13 16:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:56:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-13 16:56:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:56:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02656"}, "ts": "2023-07-13 16:56:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:56:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01563"}, "ts": "2023-07-13 16:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:56:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4U0"}, "ts": "2023-07-13 16:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4U0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 16:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21460214", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:57:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21460214", "type": "PubMed"}, "ts": "2023-07-13 16:57:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-13 16:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16873718", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 16:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:57:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16873718", "type": "PubMed"}, "ts": "2023-07-13 16:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PG2"}, "ts": "2023-07-13 16:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01898-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:57:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01898-1"}, "ts": "2023-07-13 16:57:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21399"}, "ts": "2023-07-13 16:57:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21399", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 16:58:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98088.1123.1123"}, "ts": "2023-07-13 16:58:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-13 16:58:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 16:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13638-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 16:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00395TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 16:59:29 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 17:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 17:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 17:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 17:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 17:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 17:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75054.490.490"}, "ts": "2023-07-13 17:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75054", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:00:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P85037"}, "ts": "2023-07-13 17:01:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-13 17:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48552"}, "ts": "2023-07-13 17:01:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P85037"}, "ts": "2023-07-13 17:01:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H720.457.457"}, "ts": "2023-07-13 17:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H720", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:01:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJ11-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:02:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJ11-1"}, "ts": "2023-07-13 17:02:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34228963", "type": "PubMed"}, "ts": "2023-07-13 17:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34228963", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34228963", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 17:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 17:02:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 17:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 17:02:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11748237", "type": "PubMed"}, "ts": "2023-07-13 17:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11748237", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:03:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 17:03:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:03:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:03:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 17:03:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-13 17:03:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 17:03:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-13 17:03:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-13 17:03:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-13 17:03:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15924"}, "ts": "2023-07-13 17:03:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61513"}, "ts": "2023-07-13 17:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A3KN83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:03:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A3KN83.383.383"}, "ts": "2023-07-13 17:03:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75037"}, "ts": "2023-07-13 17:04:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24156551", "type": "PubMed"}, "ts": "2023-07-13 17:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24156551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:04:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07288-1"}, "ts": "2023-07-13 17:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07288-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:05:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00553AN"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00281HB"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03127AL"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03693IY"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04576KS"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06601SQ"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-13 17:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-13 17:05:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-13 17:05:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09528DL"}, "ts": "2023-07-13 17:05:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-13 17:05:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-13 17:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51157", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:05:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51157.145.145"}, "ts": "2023-07-13 17:05:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZB8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:05:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZB8.155.155"}, "ts": "2023-07-13 17:05:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30221707", "type": "PubMed"}, "ts": "2023-07-13 17:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30221707", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30559"}, "ts": "2023-07-13 17:06:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30559"}, "ts": "2023-07-13 17:06:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TA94"}, "ts": "2023-07-13 17:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TA94", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VG37-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:06:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VG37-1"}, "ts": "2023-07-13 17:06:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51679"}, "ts": "2023-07-13 17:06:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33241.221.221"}, "ts": "2023-07-13 17:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33241", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:07:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50221", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:07:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50221.114.114"}, "ts": "2023-07-13 17:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087X1C1-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:07:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087X1C1-1"}, "ts": "2023-07-13 17:07:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 17:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:07:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63959"}, "ts": "2023-07-13 17:07:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJ07"}, "ts": "2023-07-13 17:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJ07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU39", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:08:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WU39.215.215"}, "ts": "2023-07-13 17:08:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DA21"}, "ts": "2023-07-13 17:08:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DA21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D856", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:08:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D856.333.333"}, "ts": "2023-07-13 17:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:09:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78324", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:09:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78324"}, "ts": "2023-07-13 17:09:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82364UA"}, "ts": "2023-07-13 17:09:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G30729YJ", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:09:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G30729YJ"}, "ts": "2023-07-13 17:09:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:09:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75764QI"}, "ts": "2023-07-13 17:09:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30729YJ"}, "ts": "2023-07-13 17:09:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43275VO"}, "ts": "2023-07-13 17:09:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97760FF"}, "ts": "2023-07-13 17:09:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15506"}, "ts": "2023-07-13 17:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15506", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:09:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 17:09:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:10:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22897-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:10:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22897-1"}, "ts": "2023-07-13 17:10:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38663NM"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42962KI"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-13 17:10:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-13 17:10:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 17:10:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86795LJ"}, "ts": "2023-07-13 17:10:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 17:10:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 17:10:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10019LZ"}, "ts": "2023-07-13 17:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:10:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F6VAN0"}, "ts": "2023-07-13 17:10:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F6VAN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:10:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28718376", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:10:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28718376", "type": "PubMed"}, "ts": "2023-07-13 17:10:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGS4.7.7"}, "ts": "2023-07-13 17:11:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGS4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:11:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11466", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:11:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11466"}, "ts": "2023-07-13 17:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9T8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:11:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N9T8.97.97"}, "ts": "2023-07-13 17:11:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D6R2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D6R2"}, "ts": "2023-07-13 17:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10712613", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:12:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10712613", "type": "PubMed"}, "ts": "2023-07-13 17:12:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22897-1"}, "ts": "2023-07-13 17:12:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22897-1"}, "ts": "2023-07-13 17:12:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68CQ4.367.367"}, "ts": "2023-07-13 17:12:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CQ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:12:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B1PRL5.172.172"}, "ts": "2023-07-13 17:13:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1PRL5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76011"}, "ts": "2023-07-13 17:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34146481", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:13:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34146481", "type": "PubMed"}, "ts": "2023-07-13 17:13:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:14:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUN9"}, "ts": "2023-07-13 17:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JXC2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JXC2"}, "ts": "2023-07-13 17:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34645789", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:14:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34645789", "type": "PubMed"}, "ts": "2023-07-13 17:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14843DJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:15:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55196-4"}, "ts": "2023-07-13 17:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:15:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRJ4"}, "ts": "2023-07-13 17:15:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NGB9.269.269"}, "ts": "2023-07-13 17:15:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NGB9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GQX2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:16:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6GQX2-1"}, "ts": "2023-07-13 17:16:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGL3.246.246"}, "ts": "2023-07-13 17:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:16:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:17:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-13 17:17:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 17:17:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:17:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15328"}, "ts": "2023-07-13 17:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15328", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:17:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00292"}, "ts": "2023-07-13 17:17:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98191"}, "ts": "2023-07-13 17:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98191", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23984SE"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92062TF"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59536GA"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66088HZ"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-13 17:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71051TA"}, "ts": "2023-07-13 17:17:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-13 17:17:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-13 17:17:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86795LJ"}, "ts": "2023-07-13 17:17:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95133RI"}, "ts": "2023-07-13 17:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32910505", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:18:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32910505", "type": "PubMed"}, "ts": "2023-07-13 17:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32910505", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 17:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99M87"}, "ts": "2023-07-13 17:18:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99M87", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:18:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2548852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:19:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2548852", "type": "PubMed"}, "ts": "2023-07-13 17:19:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15924", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:19:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:19:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29508"}, "ts": "2023-07-13 17:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43116"}, "ts": "2023-07-13 17:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:20:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45452"}, "ts": "2023-07-13 17:20:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2691339", "type": "PubMed"}, "ts": "2023-07-13 17:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2691339", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:20:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04843", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:20:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04843"}, "ts": "2023-07-13 17:20:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50454"}, "ts": "2023-07-13 17:20:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:21:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPU3"}, "ts": "2023-07-13 17:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:21:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618"}, "ts": "2023-07-13 17:21:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56817-1"}, "ts": "2023-07-13 17:21:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30559", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30559", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34516556", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:21:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34516556", "type": "PubMed"}, "ts": "2023-07-13 17:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34516556", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 17:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15473865", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:22:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15473865", "type": "PubMed"}, "ts": "2023-07-13 17:22:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06280"}, "ts": "2023-07-13 17:22:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95684-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95684-1"}, "ts": "2023-07-13 17:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:22:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WXM9-1"}, "ts": "2023-07-13 17:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WXM9-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:23:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 17:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:23:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 17:23:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 17:23:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11532"}, "ts": "2023-07-13 17:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:24:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAY6"}, "ts": "2023-07-13 17:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:24:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGL1.3.3"}, "ts": "2023-07-13 17:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:25:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575-3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:25:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575-3"}, "ts": "2023-07-13 17:25:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08908.71.71"}, "ts": "2023-07-13 17:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08908", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:25:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-13 17:25:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-13 17:25:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 17:25:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 17:25:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 17:25:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 17:25:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31665QC"}, "ts": "2023-07-13 17:25:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-13 17:25:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-13 17:25:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34617SM"}, "ts": "2023-07-13 17:25:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-13 17:25:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 17:25:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-13 17:25:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62461SM"}, "ts": "2023-07-13 17:25:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74728JK"}, "ts": "2023-07-13 17:25:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-13 17:25:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-13 17:25:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-13 17:25:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 17:25:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29353"}, "ts": "2023-07-13 17:25:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28329758", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:26:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28329758", "type": "PubMed"}, "ts": "2023-07-13 17:26:03 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000122", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-13 17:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 17:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000122", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 17:26:07 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000122", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-13 17:26:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:26:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCK6"}, "ts": "2023-07-13 17:26:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14963047", "type": "PubMed"}, "ts": "2023-07-13 17:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14963047", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64374-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64374-1"}, "ts": "2023-07-13 17:27:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20864041", "type": "PubMed"}, "ts": "2023-07-13 17:28:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20864041", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:28:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81263BG", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:29:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-13 17:29:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17168EK"}, "ts": "2023-07-13 17:29:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-13 17:29:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76011", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q501J7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:29:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q501J7.264.264"}, "ts": "2023-07-13 17:29:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R6M4"}, "ts": "2023-07-13 17:29:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18946081", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R6M4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:29:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18946081", "type": "PubMed"}, "ts": "2023-07-13 17:29:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25440.211.211"}, "ts": "2023-07-13 17:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25440", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C5Y9"}, "ts": "2023-07-13 17:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5Y9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:31:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 17:31:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 17:31:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-13 17:31:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-13 17:31:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-13 17:31:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04264"}, "ts": "2023-07-13 17:31:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TP1"}, "ts": "2023-07-13 17:31:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49792.1399.1399"}, "ts": "2023-07-13 17:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49792", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:31:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17495932", "type": "PubMed"}, "ts": "2023-07-13 17:31:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17495932", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:31:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55196-4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:31:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99983"}, "ts": "2023-07-13 17:32:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00468-1"}, "ts": "2023-07-13 17:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00468-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00339", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:32:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00339.147.147"}, "ts": "2023-07-13 17:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:33:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22830.45.45"}, "ts": "2023-07-13 17:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22830", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:33:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30769VJ"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29063QY"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30190ML"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88713AC"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40740AD"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-13 17:33:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWV6"}, "ts": "2023-07-13 17:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:33:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75947"}, "ts": "2023-07-13 17:33:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75947", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30926", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:33:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30926.253.253"}, "ts": "2023-07-13 17:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21815", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:33:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21815"}, "ts": "2023-07-13 17:33:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7M1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:33:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z7M1.862.862"}, "ts": "2023-07-13 17:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00292", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:33:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575-3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:33:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575-3"}, "ts": "2023-07-13 17:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U0X6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:33:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U0X6"}, "ts": "2023-07-13 17:33:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12906785", "type": "PubMed"}, "ts": "2023-07-13 17:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12906785", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:33:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07498.34.34"}, "ts": "2023-07-13 17:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:33:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876"}, "ts": "2023-07-13 17:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99732", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:34:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99732.123.123"}, "ts": "2023-07-13 17:34:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5W3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:35:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z5W3"}, "ts": "2023-07-13 17:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:35:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZY42"}, "ts": "2023-07-13 17:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZY42", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01581", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:35:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01581"}, "ts": "2023-07-13 17:35:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30034615", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:35:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30034615", "type": "PubMed"}, "ts": "2023-07-13 17:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:35:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6V5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:36:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6V5-1"}, "ts": "2023-07-13 17:36:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G0C7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:36:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G0C7"}, "ts": "2023-07-13 17:36:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:37:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 17:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56817-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:37:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-13 17:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451-1"}, "ts": "2023-07-13 17:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:38:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04070.108.108"}, "ts": "2023-07-13 17:38:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:38:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VTQ0.541.541"}, "ts": "2023-07-13 17:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXD2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:38:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXD2-1"}, "ts": "2023-07-13 17:38:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02786"}, "ts": "2023-07-13 17:39:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14136"}, "ts": "2023-07-13 17:39:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGG7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:39:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGG7"}, "ts": "2023-07-13 17:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TYU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:39:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TYU2"}, "ts": "2023-07-13 17:39:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JVL4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JVL4-1"}, "ts": "2023-07-13 17:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12660"}, "ts": "2023-07-13 17:40:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21127"}, "ts": "2023-07-13 17:40:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q712K3.233.233"}, "ts": "2023-07-13 17:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q712K3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29353", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97412", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:41:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97412.2099.2099"}, "ts": "2023-07-13 17:41:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:41:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRY5"}, "ts": "2023-07-13 17:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJI1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:41:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BJI1.665.665"}, "ts": "2023-07-13 17:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83881", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:41:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83881"}, "ts": "2023-07-13 17:41:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28641926", "type": "PubMed"}, "ts": "2023-07-13 17:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28641926", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18941509", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:42:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18941509", "type": "PubMed"}, "ts": "2023-07-13 17:42:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14765.519.519"}, "ts": "2023-07-13 17:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14765", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:43:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND76-1"}, "ts": "2023-07-13 17:43:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND76-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:43:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVN2.400.400"}, "ts": "2023-07-13 17:43:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVN2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:43:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6T4R5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:44:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6T4R5"}, "ts": "2023-07-13 17:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 17:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 17:44:18 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 17:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 17:44:23 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 17:44:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 17:44:38 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G49108TO", "term_category": "any"}, "ts": "2023-07-13 17:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">18398c342ad9f9819cbe18b3275a2f5d", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G49108TO\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 17:44:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "18398c342ad9f9819cbe18b3275a2f5d", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 17:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18398c342ad9f9819cbe18b3275a2f5d", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 17:44:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 17:44:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-13 17:44:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86089ZC"}, "ts": "2023-07-13 17:44:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 17:44:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82252SA"}, "ts": "2023-07-13 17:44:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 17:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7EY92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:44:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7EY92"}, "ts": "2023-07-13 17:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:45:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5G2.128.128"}, "ts": "2023-07-13 17:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 17:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBK8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 17:45:15 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UBK8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 17:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11751972", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 17:45:17 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 17:45:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11751972", "type": "PubMed"}, "ts": "2023-07-13 17:45:17 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-13 17:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 17:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 17:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 17:45:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 17:45:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81459MV"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93822DY"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626XQ"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29255IL"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64132UH"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24005JZ"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67393WG"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72956NR"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30048DT"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48844XN"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74026TS"}, "ts": "2023-07-13 17:45:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94019IV"}, "ts": "2023-07-13 17:45:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90889KG"}, "ts": "2023-07-13 17:45:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61734US"}, "ts": "2023-07-13 17:45:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180XB"}, "ts": "2023-07-13 17:45:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 17:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:45:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-13 17:45:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 17:45:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-13 17:45:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-13 17:45:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-13 17:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0A3-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:45:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0A3-1"}, "ts": "2023-07-13 17:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92619", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:46:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92619.378.378"}, "ts": "2023-07-13 17:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:46:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IV68"}, "ts": "2023-07-13 17:46:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IV68", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U829", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U829"}, "ts": "2023-07-13 17:46:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGJ0.161.161"}, "ts": "2023-07-13 17:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGJ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39087", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:46:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39087"}, "ts": "2023-07-13 17:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRN5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:47:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRN5.376.376"}, "ts": "2023-07-13 17:47:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P57059.182.182"}, "ts": "2023-07-13 17:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57059", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:48:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 17:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:48:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 17:48:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 17:48:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 17:48:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 17:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19414556", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:49:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19414556", "type": "PubMed"}, "ts": "2023-07-13 17:49:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62655", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62655"}, "ts": "2023-07-13 17:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22724-1"}, "ts": "2023-07-13 17:50:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22724-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32303641", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:50:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32303641", "type": "PubMed"}, "ts": "2023-07-13 17:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:50:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31173246", "type": "PubMed"}, "ts": "2023-07-13 17:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31173246", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3F1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:51:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3F1"}, "ts": "2023-07-13 17:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N307", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:51:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N307.391.391"}, "ts": "2023-07-13 17:51:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56696.412.412"}, "ts": "2023-07-13 17:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56696", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:51:52 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 17:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 17:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 17:52:11 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 17:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:52:14 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G57321FI", "term_category": "any"}, "ts": "2023-07-13 17:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 17:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b8230881db6b1b1b4f603bab57b0fd46", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G57321FI\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 17:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C460"}, "ts": "2023-07-13 17:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b8230881db6b1b1b4f603bab57b0fd46", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 17:52:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b8230881db6b1b1b4f603bab57b0fd46", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 17:52:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49575MY"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56558YT"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53869BW"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81202UN"}, "ts": "2023-07-13 17:52:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 17:52:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:52:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-13 17:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VDF9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:52:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q0VDF9.465.465"}, "ts": "2023-07-13 17:52:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33800128", "type": "PubMed"}, "ts": "2023-07-13 17:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33800128", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:52:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04150-1.211.211"}, "ts": "2023-07-13 17:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04150-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7909431", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:52:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7909431", "type": "PubMed"}, "ts": "2023-07-13 17:53:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20488182", "type": "PubMed"}, "ts": "2023-07-13 17:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20488182", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:53:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QXU8.207.207"}, "ts": "2023-07-13 17:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXU8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:53:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11117.405.405"}, "ts": "2023-07-13 17:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11117", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94925", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:53:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94925"}, "ts": "2023-07-13 17:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDW9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:53:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDW9-1"}, "ts": "2023-07-13 17:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12393603", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:54:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12393603", "type": "PubMed"}, "ts": "2023-07-13 17:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P3W7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 17:54:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6P3W7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 17:54:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63372"}, "ts": "2023-07-13 17:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:54:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2X7-1"}, "ts": "2023-07-13 17:54:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2X7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:54:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:54:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0J2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0J2"}, "ts": "2023-07-13 17:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14136", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:55:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12144777", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 17:55:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12144777", "type": "PubMed"}, "ts": "2023-07-13 17:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5Y0"}, "ts": "2023-07-13 17:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5Y0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 17:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:56:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UX04.201.201"}, "ts": "2023-07-13 17:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX04", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:56:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWI1"}, "ts": "2023-07-13 17:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:57:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:57:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83204BU"}, "ts": "2023-07-13 17:57:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83204BU", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 17:57:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83204BU"}, "ts": "2023-07-13 17:57:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54498TF"}, "ts": "2023-07-13 17:57:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15347NT"}, "ts": "2023-07-13 17:57:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14571"}, "ts": "2023-07-13 17:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:57:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83204BU"}, "ts": "2023-07-13 17:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 17:58:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830"}, "ts": "2023-07-13 17:59:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-13 17:59:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15164"}, "ts": "2023-07-13 17:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y261", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 17:59:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y261.395.395"}, "ts": "2023-07-13 17:59:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16150-1"}, "ts": "2023-07-13 17:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:00:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:00:02 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 18:00:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 18:00:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 18:00:03 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 18:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 18:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 18:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63036", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:00:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63036"}, "ts": "2023-07-13 18:00:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BG22-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 18:00:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8BG22-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 18:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7684739", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:02:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7684739", "type": "PubMed"}, "ts": "2023-07-13 18:02:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13371", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:02:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13371.226.226"}, "ts": "2023-07-13 18:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ20", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:02:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7TQ20.47.47"}, "ts": "2023-07-13 18:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08881", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:03:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08881.149.149"}, "ts": "2023-07-13 18:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08851", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08851"}, "ts": "2023-07-13 18:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14114", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:03:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14114.856.856"}, "ts": "2023-07-13 18:03:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14764.391.391"}, "ts": "2023-07-13 18:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14764", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99504", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:04:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99504.112.112"}, "ts": "2023-07-13 18:04:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 18:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06110VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:04:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01504UZ"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04554QW"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07445YJ"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07617FP"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09609EN"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09986RD"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11052OE"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11568OK"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14153CY"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16404YH"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18559HW"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20640NX"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21477HL"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23450YU"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23799GS"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23874KQ"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24199RH"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25179PZ"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25984CA"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27327VV"}, "ts": "2023-07-13 18:04:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VUD6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:05:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VUD6"}, "ts": "2023-07-13 18:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:05:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY76"}, "ts": "2023-07-13 18:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:05:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14793.344.344"}, "ts": "2023-07-13 18:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14793", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:06:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14264"}, "ts": "2023-07-13 18:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A540"}, "ts": "2023-07-13 18:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A540", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:06:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ05"}, "ts": "2023-07-13 18:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA58"}, "ts": "2023-07-13 18:08:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ05", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:08:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24098481", "type": "PubMed"}, "ts": "2023-07-13 18:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24098481", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14242", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:09:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14242.290.290"}, "ts": "2023-07-13 18:09:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P60174.196.196"}, "ts": "2023-07-13 18:09:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60174", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55186"}, "ts": "2023-07-13 18:09:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09010", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:09:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09010"}, "ts": "2023-07-13 18:09:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29414"}, "ts": "2023-07-13 18:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29414", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:10:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-13 18:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:10:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987-1"}, "ts": "2023-07-13 18:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHB5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:11:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VHB5.427.427"}, "ts": "2023-07-13 18:11:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35618", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:12:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35618.179.179"}, "ts": "2023-07-13 18:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 18:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30038", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:12:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30038"}, "ts": "2023-07-13 18:12:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-13 18:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:12:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DF27"}, "ts": "2023-07-13 18:12:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DF27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:12:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27694", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:13:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27694.382.382"}, "ts": "2023-07-13 18:13:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49281"}, "ts": "2023-07-13 18:13:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D906"}, "ts": "2023-07-13 18:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D906", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 18:14:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 18:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:14:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYV8"}, "ts": "2023-07-13 18:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:15:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PIW4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:15:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PIW4.554.554"}, "ts": "2023-07-13 18:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IBW4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:15:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IBW4.19.19"}, "ts": "2023-07-13 18:15:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00173-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:15:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00173-1"}, "ts": "2023-07-13 18:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:15:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11262391", "type": "PubMed"}, "ts": "2023-07-13 18:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11262391", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12830"}, "ts": "2023-07-13 18:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Y288", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:15:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6Y288.392.392"}, "ts": "2023-07-13 18:16:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:16:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2E6.567.567"}, "ts": "2023-07-13 18:16:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L014.152.152"}, "ts": "2023-07-13 18:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L014", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:18:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27445336", "type": "PubMed"}, "ts": "2023-07-13 18:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27445336", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:18:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0K018-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:18:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0K018-1"}, "ts": "2023-07-13 18:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:19:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-13 18:19:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDQ0.256.256"}, "ts": "2023-07-13 18:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:20:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55317.363.363"}, "ts": "2023-07-13 18:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55317", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:20:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14242.380.380"}, "ts": "2023-07-13 18:21:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQF0.183.183"}, "ts": "2023-07-13 18:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:21:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R414-1"}, "ts": "2023-07-13 18:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R414-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:21:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBH5"}, "ts": "2023-07-13 18:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24037184", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:21:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24037184", "type": "PubMed"}, "ts": "2023-07-13 18:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IEE7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:21:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IEE7.532.532"}, "ts": "2023-07-13 18:21:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-13 18:22:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11035810", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:22:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11035810", "type": "PubMed"}, "ts": "2023-07-13 18:22:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZW8"}, "ts": "2023-07-13 18:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BH15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:23:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BH15"}, "ts": "2023-07-13 18:23:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGL2.212.212"}, "ts": "2023-07-13 18:23:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:23:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:24:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40199", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40199"}, "ts": "2023-07-13 18:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32004"}, "ts": "2023-07-13 18:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32004", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:24:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-13 18:24:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-13 18:24:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41247ZX"}, "ts": "2023-07-13 18:24:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92050GC"}, "ts": "2023-07-13 18:24:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-13 18:24:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-13 18:24:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 18:24:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 18:24:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LVL8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:24:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LVL8-1"}, "ts": "2023-07-13 18:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0S8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:24:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0S8"}, "ts": "2023-07-13 18:24:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40749-1"}, "ts": "2023-07-13 18:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24187134", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:24:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24187134", "type": "PubMed"}, "ts": "2023-07-13 18:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-13 18:25:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ4"}, "ts": "2023-07-13 18:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTA9"}, "ts": "2023-07-13 18:25:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30776158", "type": "PubMed"}, "ts": "2023-07-13 18:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30776158", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:25:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49247"}, "ts": "2023-07-13 18:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C1F4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:26:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C1F4-1"}, "ts": "2023-07-13 18:26:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-13 18:27:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFA1"}, "ts": "2023-07-13 18:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFA1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:27:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04791QM"}, "ts": "2023-07-13 18:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:28:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:29:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAF1-1"}, "ts": "2023-07-13 18:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAF1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:29:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15393", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:29:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15393.305.305"}, "ts": "2023-07-13 18:29:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19854139", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:29:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19854139", "type": "PubMed"}, "ts": "2023-07-13 18:29:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DV7"}, "ts": "2023-07-13 18:29:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:30:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75023"}, "ts": "2023-07-13 18:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17742-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:30:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17742-1"}, "ts": "2023-07-13 18:30:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7813420", "type": "PubMed"}, "ts": "2023-07-13 18:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7813420", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:30:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0VEJ0-1"}, "ts": "2023-07-13 18:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VEJ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:31:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32544461", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:31:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32544461", "type": "PubMed"}, "ts": "2023-07-13 18:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54826", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:31:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54826"}, "ts": "2023-07-13 18:31:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM57-1"}, "ts": "2023-07-13 18:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM57-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34244435", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:31:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34244435", "type": "PubMed"}, "ts": "2023-07-13 18:31:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66086EX"}, "ts": "2023-07-13 18:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66086EX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D3J8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:32:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D3J8"}, "ts": "2023-07-13 18:32:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25023281", "type": "PubMed"}, "ts": "2023-07-13 18:32:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25023281", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:32:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H7Z3.335.335"}, "ts": "2023-07-13 18:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7Z3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11914378", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:32:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11914378", "type": "PubMed"}, "ts": "2023-07-13 18:32:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40763"}, "ts": "2023-07-13 18:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N126", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18559669", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:33:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18559669", "type": "PubMed"}, "ts": "2023-07-13 18:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V672", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:33:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V672"}, "ts": "2023-07-13 18:33:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-13 18:34:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZVM7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:34:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZVM7.180.180"}, "ts": "2023-07-13 18:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:35:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXI8.165.165"}, "ts": "2023-07-13 18:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01568", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y210"}, "ts": "2023-07-13 18:36:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:36:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01568"}, "ts": "2023-07-13 18:36:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14694", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:36:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14694"}, "ts": "2023-07-13 18:36:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04264.71.71"}, "ts": "2023-07-13 18:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08246", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:37:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08246"}, "ts": "2023-07-13 18:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16109"}, "ts": "2023-07-13 18:37:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-13 18:37:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C7E9"}, "ts": "2023-07-13 18:37:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C7E9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:37:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62813.136.136"}, "ts": "2023-07-13 18:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62813", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9691087", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:38:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9691087", "type": "PubMed"}, "ts": "2023-07-13 18:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31019306", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:38:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31019306", "type": "PubMed"}, "ts": "2023-07-13 18:38:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12235"}, "ts": "2023-07-13 18:38:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DN72-1"}, "ts": "2023-07-13 18:38:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DN72-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-13 18:38:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14415", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:39:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14415"}, "ts": "2023-07-13 18:39:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05543"}, "ts": "2023-07-13 18:39:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43819.73.73"}, "ts": "2023-07-13 18:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:39:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43603.160.160"}, "ts": "2023-07-13 18:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43603", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:39:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ0-1"}, "ts": "2023-07-13 18:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02549", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:39:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02549.992.992"}, "ts": "2023-07-13 18:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:39:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15386"}, "ts": "2023-07-13 18:39:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61289"}, "ts": "2023-07-13 18:39:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTC0"}, "ts": "2023-07-13 18:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84452RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:40:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM73", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:40:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UM73.411.411"}, "ts": "2023-07-13 18:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51884", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:40:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51884.221.221"}, "ts": "2023-07-13 18:40:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R085"}, "ts": "2023-07-13 18:41:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R085", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:41:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35443.960.960"}, "ts": "2023-07-13 18:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35443", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:41:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11130"}, "ts": "2023-07-13 18:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-13 18:42:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFU7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:42:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFU7"}, "ts": "2023-07-13 18:42:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T9"}, "ts": "2023-07-13 18:42:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:42:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHB7.1064.1064"}, "ts": "2023-07-13 18:42:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHB7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:42:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99MQ1"}, "ts": "2023-07-13 18:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04791QM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:44:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11481438", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:44:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11481438", "type": "PubMed"}, "ts": "2023-07-13 18:44:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29017773", "type": "PubMed"}, "ts": "2023-07-13 18:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29017773", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95125", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95125"}, "ts": "2023-07-13 18:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04004", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:44:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04004"}, "ts": "2023-07-13 18:44:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60953", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:45:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60953"}, "ts": "2023-07-13 18:45:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4U2R8.56.56"}, "ts": "2023-07-13 18:45:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4U2R8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15053880", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62489", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:45:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15053880", "type": "PubMed"}, "ts": "2023-07-13 18:45:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62489"}, "ts": "2023-07-13 18:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5E8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:46:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5E8"}, "ts": "2023-07-13 18:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:47:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14511"}, "ts": "2023-07-13 18:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:47:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-13 18:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06323-1"}, "ts": "2023-07-13 18:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06323-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:47:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11031MS"}, "ts": "2023-07-13 18:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11031MS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 18:47:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11031MS"}, "ts": "2023-07-13 18:47:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90306QO"}, "ts": "2023-07-13 18:47:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31690TW"}, "ts": "2023-07-13 18:47:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30702EQ"}, "ts": "2023-07-13 18:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08514", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:48:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08514.341.341"}, "ts": "2023-07-13 18:48:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14921"}, "ts": "2023-07-13 18:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23071334", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:48:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23071334", "type": "PubMed"}, "ts": "2023-07-13 18:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17462669", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:49:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17462669", "type": "PubMed"}, "ts": "2023-07-13 18:49:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43694-1"}, "ts": "2023-07-13 18:49:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43694-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15529", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:50:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15529"}, "ts": "2023-07-13 18:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:50:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-13 18:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:51:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3R5"}, "ts": "2023-07-13 18:51:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3R5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHN3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 18:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHN3"}, "ts": "2023-07-13 18:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WB0"}, "ts": "2023-07-13 18:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:52:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:52:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09693", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:52:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09693"}, "ts": "2023-07-13 18:52:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WB0"}, "ts": "2023-07-13 18:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:52:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15280901", "type": "PubMed"}, "ts": "2023-07-13 18:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15280901", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:53:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WB0"}, "ts": "2023-07-13 18:53:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53794"}, "ts": "2023-07-13 18:53:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WB0"}, "ts": "2023-07-13 18:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:53:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22792"}, "ts": "2023-07-13 18:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53794", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-13 18:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22455"}, "ts": "2023-07-13 18:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:54:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16150-1.113.113"}, "ts": "2023-07-13 18:54:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:54:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-13 18:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15661", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:55:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15661"}, "ts": "2023-07-13 18:55:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16252006", "type": "PubMed"}, "ts": "2023-07-13 18:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16252006", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:55:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12610629", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:56:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12610629", "type": "PubMed"}, "ts": "2023-07-13 18:56:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25219788", "type": "PubMed"}, "ts": "2023-07-13 18:56:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25219788", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:56:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-13 18:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 18:57:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08581-1.1171.1171"}, "ts": "2023-07-13 18:57:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M389-1"}, "ts": "2023-07-13 18:57:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M389-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:58:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10746715", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:58:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10746715", "type": "PubMed"}, "ts": "2023-07-13 18:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZSF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:58:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZSF0"}, "ts": "2023-07-13 18:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92482", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:58:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92482"}, "ts": "2023-07-13 18:58:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:58:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHK0"}, "ts": "2023-07-13 18:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43251", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 18:59:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43251"}, "ts": "2023-07-13 18:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16618812", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 18:59:40 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 19:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 19:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 19:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 19:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 19:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 19:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14410", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14410"}, "ts": "2023-07-13 19:00:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16618812", "type": "PubMed"}, "ts": "2023-07-13 19:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64522-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:00:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64522-1"}, "ts": "2023-07-13 19:00:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 19:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14343MU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 19:00:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14343MU"}, "ts": "2023-07-13 19:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C8V1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C8V1"}, "ts": "2023-07-13 19:00:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9737771", "type": "PubMed"}, "ts": "2023-07-13 19:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9737771", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:00:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62244"}, "ts": "2023-07-13 19:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:00:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62244", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:00:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3T3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:01:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3T3"}, "ts": "2023-07-13 19:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920C1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:01:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920C1"}, "ts": "2023-07-13 19:01:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15061"}, "ts": "2023-07-13 19:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18252222", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:01:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18252222", "type": "PubMed"}, "ts": "2023-07-13 19:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:02:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63252"}, "ts": "2023-07-13 19:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:02:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMY3.378.378"}, "ts": "2023-07-13 19:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JUK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:03:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JUK3"}, "ts": "2023-07-13 19:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56741", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:03:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56741"}, "ts": "2023-07-13 19:03:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 19:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81315DD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 19:04:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81315DD"}, "ts": "2023-07-13 19:04:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68363"}, "ts": "2023-07-13 19:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:04:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05121"}, "ts": "2023-07-13 19:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:05:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47736", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:05:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47736.490.490"}, "ts": "2023-07-13 19:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04844", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:05:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04844"}, "ts": "2023-07-13 19:05:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41250-1"}, "ts": "2023-07-13 19:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPD6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:06:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DPD6.376.376"}, "ts": "2023-07-13 19:06:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:06:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09874"}, "ts": "2023-07-13 19:06:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-13 19:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:07:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DP29.100.100"}, "ts": "2023-07-13 19:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15335-1"}, "ts": "2023-07-13 19:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15335-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:07:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02671.274.274"}, "ts": "2023-07-13 19:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 19:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R6I7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 19:07:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6R6I7", "cluster_type": "unselected"}, "ts": "2023-07-13 19:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F8VPJ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:07:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F8VPJ6"}, "ts": "2023-07-13 19:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R6I7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 19:07:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI07"}, "ts": "2023-07-13 19:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI07", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34173958", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:07:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34173958", "type": "PubMed"}, "ts": "2023-07-13 19:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24610330", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:08:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24610330", "type": "PubMed"}, "ts": "2023-07-13 19:08:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PB8.192.192"}, "ts": "2023-07-13 19:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PB8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:08:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22455"}, "ts": "2023-07-13 19:08:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22455", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:08:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AJN7.511.511"}, "ts": "2023-07-13 19:08:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AJN7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:08:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9660828", "type": "PubMed"}, "ts": "2023-07-13 19:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9660828", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52020-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52020-1"}, "ts": "2023-07-13 19:09:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10144"}, "ts": "2023-07-13 19:09:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:09:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38606", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:09:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38606"}, "ts": "2023-07-13 19:09:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-13 19:09:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51570.230.230"}, "ts": "2023-07-13 19:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11687627", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:10:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11687627", "type": "PubMed"}, "ts": "2023-07-13 19:10:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7540170", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:10:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7540170", "type": "PubMed"}, "ts": "2023-07-13 19:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:10:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GX9"}, "ts": "2023-07-13 19:10:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13645.209.209"}, "ts": "2023-07-13 19:10:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13645", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SZ6"}, "ts": "2023-07-13 19:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92667-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:11:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92667-1"}, "ts": "2023-07-13 19:11:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07942.1084.1084"}, "ts": "2023-07-13 19:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07942", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17182842", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:11:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17182842", "type": "PubMed"}, "ts": "2023-07-13 19:11:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94886.370.370"}, "ts": "2023-07-13 19:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94886", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:12:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46089"}, "ts": "2023-07-13 19:12:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46089", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:12:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26343583", "type": "PubMed"}, "ts": "2023-07-13 19:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26343583", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33434-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:12:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33434-1"}, "ts": "2023-07-13 19:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:12:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N264.133.133"}, "ts": "2023-07-13 19:12:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-13 19:13:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24569478", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:13:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24569478", "type": "PubMed"}, "ts": "2023-07-13 19:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-13 19:13:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00480"}, "ts": "2023-07-13 19:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CF74-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CF74-1"}, "ts": "2023-07-13 19:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:13:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQL6"}, "ts": "2023-07-13 19:13:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q710E6"}, "ts": "2023-07-13 19:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q710E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:13:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92484.238.238"}, "ts": "2023-07-13 19:13:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92484", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:13:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106-1"}, "ts": "2023-07-13 19:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00584"}, "ts": "2023-07-13 19:14:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00584"}, "ts": "2023-07-13 19:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 19:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G46677TE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 19:14:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46677TE"}, "ts": "2023-07-13 19:14:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46677TE"}, "ts": "2023-07-13 19:14:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-13 19:14:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77976VJ"}, "ts": "2023-07-13 19:14:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94660EY"}, "ts": "2023-07-13 19:14:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37815LJ"}, "ts": "2023-07-13 19:14:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29377-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:14:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29377-1"}, "ts": "2023-07-13 19:14:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6431896", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:15:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6431896", "type": "PubMed"}, "ts": "2023-07-13 19:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6431896", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 19:15:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12110.110.110"}, "ts": "2023-07-13 19:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12110", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35503", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:15:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35503"}, "ts": "2023-07-13 19:15:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3USY0"}, "ts": "2023-07-13 19:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3USY0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18799160", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:16:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18799160", "type": "PubMed"}, "ts": "2023-07-13 19:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23547261", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:16:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23547261", "type": "PubMed"}, "ts": "2023-07-13 19:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:17:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96N19"}, "ts": "2023-07-13 19:17:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96N19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:17:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N584.438.438"}, "ts": "2023-07-13 19:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N584", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16854", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:17:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16854"}, "ts": "2023-07-13 19:17:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7Q9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7Q9"}, "ts": "2023-07-13 19:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1ATY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:17:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1ATY8"}, "ts": "2023-07-13 19:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00341", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:18:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00341"}, "ts": "2023-07-13 19:18:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33392634", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:18:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33392634", "type": "PubMed"}, "ts": "2023-07-13 19:18:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMZ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:19:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UMZ3.1038.1038"}, "ts": "2023-07-13 19:19:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:19:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30511"}, "ts": "2023-07-13 19:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:19:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08133"}, "ts": "2023-07-13 19:19:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H714-5"}, "ts": "2023-07-13 19:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H714-5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12767", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:20:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12767.1043.1043"}, "ts": "2023-07-13 19:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:20:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75427"}, "ts": "2023-07-13 19:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQP2-1"}, "ts": "2023-07-13 19:20:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQP2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:21:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30561-1"}, "ts": "2023-07-13 19:22:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30561-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14695167", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:22:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14695167", "type": "PubMed"}, "ts": "2023-07-13 19:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GW9"}, "ts": "2023-07-13 19:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:23:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12923.1522.1522"}, "ts": "2023-07-13 19:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VEL5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:24:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0VEL5"}, "ts": "2023-07-13 19:24:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969P0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:24:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969P0"}, "ts": "2023-07-13 19:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXT6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:24:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXT6.55.55"}, "ts": "2023-07-13 19:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:24:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-13 19:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:25:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3V5"}, "ts": "2023-07-13 19:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3V5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:25:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08397", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:25:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08397.283.283"}, "ts": "2023-07-13 19:25:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19296537", "type": "PubMed"}, "ts": "2023-07-13 19:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19296537", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15031", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:26:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-13 19:26:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2N4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:26:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D2N4.666.666"}, "ts": "2023-07-13 19:26:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14CN2.679.679"}, "ts": "2023-07-13 19:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14CN2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:26:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-13 19:26:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-13 19:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AG4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:27:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96AG4.306.306"}, "ts": "2023-07-13 19:27:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19291308", "type": "PubMed"}, "ts": "2023-07-13 19:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19291308", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:27:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00468"}, "ts": "2023-07-13 19:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00468", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:27:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05067"}, "ts": "2023-07-13 19:27:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 19:27:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 19:27:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 19:27:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-13 19:27:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30769VJ"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30190ML"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29063QY"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88713AC"}, "ts": "2023-07-13 19:27:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-13 19:27:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40740AD"}, "ts": "2023-07-13 19:27:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-13 19:27:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-13 19:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KM6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:28:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KM6.774.774"}, "ts": "2023-07-13 19:28:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7953292", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:28:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7953292", "type": "PubMed"}, "ts": "2023-07-13 19:28:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1N4-1"}, "ts": "2023-07-13 19:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1N4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:29:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92748"}, "ts": "2023-07-13 19:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:29:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R327"}, "ts": "2023-07-13 19:29:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:29:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40925"}, "ts": "2023-07-13 19:29:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40925", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00480", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0W2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:29:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P0W2.89.89"}, "ts": "2023-07-13 19:29:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122-1"}, "ts": "2023-07-13 19:29:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-13 19:29:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54821.129.129"}, "ts": "2023-07-13 19:29:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54821", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:30:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-13 19:30:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99572.390.390"}, "ts": "2023-07-13 19:30:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99572", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:30:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-13 19:30:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-13 19:30:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-13 19:30:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-13 19:30:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-13 19:30:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87051GH"}, "ts": "2023-07-13 19:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:31:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-13 19:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC84", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:31:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HC84.5046.5046"}, "ts": "2023-07-13 19:31:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27369082", "type": "PubMed"}, "ts": "2023-07-13 19:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27369082", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:31:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FV7"}, "ts": "2023-07-13 19:31:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13595.929.929"}, "ts": "2023-07-13 19:31:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13595", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:31:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63064", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:32:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63064"}, "ts": "2023-07-13 19:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CD43", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-13 19:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWV2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:32:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWV2.673.673"}, "ts": "2023-07-13 19:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 19:32:45 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "CD43"}, "ts": "2023-07-13 19:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 19:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "CD43", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=CD43"}, "ts": "2023-07-13 19:32:45 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 19:32:52 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "0822fb025e72fcf0f53ec17ef090aecc", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 19:32:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0822fb025e72fcf0f53ec17ef090aecc", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 19:32:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:32:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16150-1"}, "ts": "2023-07-13 19:32:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-13 19:33:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-13 19:33:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-13 19:33:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-13 19:33:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-13 19:33:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-13 19:33:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-13 19:33:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M715"}, "ts": "2023-07-13 19:33:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M715", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:33:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNS1"}, "ts": "2023-07-13 19:34:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:34:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3F6-1"}, "ts": "2023-07-13 19:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3F6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61820", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:36:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61820"}, "ts": "2023-07-13 19:36:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12923531", "type": "PubMed"}, "ts": "2023-07-13 19:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12923531", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:36:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RV3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:37:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RV3.786.786"}, "ts": "2023-07-13 19:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-13 19:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00889", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:39:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00889"}, "ts": "2023-07-13 19:39:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2P5"}, "ts": "2023-07-13 19:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2P5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:39:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-13 19:40:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28310-1"}, "ts": "2023-07-13 19:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28310-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:40:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-13 19:41:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:41:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618"}, "ts": "2023-07-13 19:41:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RUB6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:41:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2RUB6.607.607"}, "ts": "2023-07-13 19:41:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14517.1920.1920"}, "ts": "2023-07-13 19:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14517", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:42:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29371"}, "ts": "2023-07-13 19:42:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12750SG"}, "ts": "2023-07-13 19:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:42:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XM0"}, "ts": "2023-07-13 19:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:42:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:42:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PUZ9-1"}, "ts": "2023-07-13 19:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PUZ9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05067", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2P5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:43:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2P5.356.356"}, "ts": "2023-07-13 19:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y490"}, "ts": "2023-07-13 19:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C570"}, "ts": "2023-07-13 19:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95049-1"}, "ts": "2023-07-13 19:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95049-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY95", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:45:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IY95"}, "ts": "2023-07-13 19:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13601", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:45:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13601.231.231"}, "ts": "2023-07-13 19:45:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45209NR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 19:45:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10275.225.225"}, "ts": "2023-07-13 19:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10275", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:46:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZI9"}, "ts": "2023-07-13 19:46:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A1A5D9.118.118"}, "ts": "2023-07-13 19:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A5D9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02461"}, "ts": "2023-07-13 19:46:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02461"}, "ts": "2023-07-13 19:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWF5"}, "ts": "2023-07-13 19:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:48:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LI5.324.324"}, "ts": "2023-07-13 19:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LI5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:48:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43660"}, "ts": "2023-07-13 19:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80YR7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:48:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80YR7"}, "ts": "2023-07-13 19:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAR2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:48:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HAR2.440.440"}, "ts": "2023-07-13 19:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N307", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:49:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N307.3.3"}, "ts": "2023-07-13 19:49:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13576"}, "ts": "2023-07-13 19:49:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13576", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70167", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:50:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70167"}, "ts": "2023-07-13 19:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:50:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PW3"}, "ts": "2023-07-13 19:50:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13200.250.250"}, "ts": "2023-07-13 19:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13200", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:50:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07195"}, "ts": "2023-07-13 19:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:51:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZUT3"}, "ts": "2023-07-13 19:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZUT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63257", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63257"}, "ts": "2023-07-13 19:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2107528", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:52:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2107528", "type": "PubMed"}, "ts": "2023-07-13 19:52:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QJ38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:52:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QJ38"}, "ts": "2023-07-13 19:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:53:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPG3.427.427"}, "ts": "2023-07-13 19:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3P5"}, "ts": "2023-07-13 19:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3P5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 19:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35250", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:54:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35250"}, "ts": "2023-07-13 19:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15367658", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:54:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15367658", "type": "PubMed"}, "ts": "2023-07-13 19:54:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25916"}, "ts": "2023-07-13 19:55:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:55:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-13 19:55:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8710491", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:56:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8710491", "type": "PubMed"}, "ts": "2023-07-13 19:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00491", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:56:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00491"}, "ts": "2023-07-13 19:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10381378", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:57:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10381378", "type": "PubMed"}, "ts": "2023-07-13 19:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61245", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:57:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61245"}, "ts": "2023-07-13 19:57:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KK3.130.130"}, "ts": "2023-07-13 19:57:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KK3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:57:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54290-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:58:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54290-1.323.323"}, "ts": "2023-07-13 19:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10935549", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 19:58:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10935549", "type": "PubMed"}, "ts": "2023-07-13 19:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13201", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 19:58:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13201.296.296"}, "ts": "2023-07-13 19:58:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15517", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:58:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15517"}, "ts": "2023-07-13 19:58:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:59:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96R69"}, "ts": "2023-07-13 19:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R69", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:59:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1S0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 19:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1S0-1"}, "ts": "2023-07-13 19:59:46 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 20:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 20:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 20:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 20:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 20:00:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2350580", "type": "PubMed"}, "ts": "2023-07-13 20:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2350580", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-13 20:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:00:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80T03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:00:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80T03"}, "ts": "2023-07-13 20:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "416441", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:01:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "416441", "type": "PubMed"}, "ts": "2023-07-13 20:01:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21934712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:02:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21934712", "type": "PubMed"}, "ts": "2023-07-13 20:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:02:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-13 20:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02461", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q89", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:02:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96Q89.1658.1658"}, "ts": "2023-07-13 20:02:59 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 20:03:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 20:03:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 20:03:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13153"}, "ts": "2023-07-13 20:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14119", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:06:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14119.108.108"}, "ts": "2023-07-13 20:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34231239", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:07:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34231239", "type": "PubMed"}, "ts": "2023-07-13 20:07:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34618865", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:07:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34618865", "type": "PubMed"}, "ts": "2023-07-13 20:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:07:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75056.410.410"}, "ts": "2023-07-13 20:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75056", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:07:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14719"}, "ts": "2023-07-13 20:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14719", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:09:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:09:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSH4"}, "ts": "2023-07-13 20:09:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:09:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37173"}, "ts": "2023-07-13 20:09:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYQ6"}, "ts": "2023-07-13 20:10:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:10:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16885.400.400"}, "ts": "2023-07-13 20:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16885", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22006928", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:10:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22006928", "type": "PubMed"}, "ts": "2023-07-13 20:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XT9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:10:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86XT9.101.101"}, "ts": "2023-07-13 20:10:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:11:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86T29"}, "ts": "2023-07-13 20:11:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13725"}, "ts": "2023-07-13 20:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13725", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:12:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12860.790.790"}, "ts": "2023-07-13 20:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15375"}, "ts": "2023-07-13 20:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15375", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29322"}, "ts": "2023-07-13 20:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29322", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:14:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23813"}, "ts": "2023-07-13 20:14:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922Q9"}, "ts": "2023-07-13 20:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922Q9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:14:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K1C9"}, "ts": "2023-07-13 20:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K1C9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNB4"}, "ts": "2023-07-13 20:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21762696", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:15:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21762696", "type": "PubMed"}, "ts": "2023-07-13 20:15:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 20:15:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46677TE"}, "ts": "2023-07-13 20:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G46677TE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 20:15:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46677TE"}, "ts": "2023-07-13 20:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-13 20:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77976VJ"}, "ts": "2023-07-13 20:15:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94660EY"}, "ts": "2023-07-13 20:15:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37815LJ"}, "ts": "2023-07-13 20:15:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30101", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:16:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30101.319.319"}, "ts": "2023-07-13 20:16:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95807", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95807"}, "ts": "2023-07-13 20:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 20:18:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32152BH"}, "ts": "2023-07-13 20:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32152BH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 20:18:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32152BH"}, "ts": "2023-07-13 20:18:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94583DZ"}, "ts": "2023-07-13 20:18:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97803FU"}, "ts": "2023-07-13 20:18:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25347ZR"}, "ts": "2023-07-13 20:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y694", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:19:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y694.91.91"}, "ts": "2023-07-13 20:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZED6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:19:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZED6"}, "ts": "2023-07-13 20:19:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60673.1030.1030"}, "ts": "2023-07-13 20:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05388", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:20:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05388.304.304"}, "ts": "2023-07-13 20:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810U3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:20:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q810U3.409.409"}, "ts": "2023-07-13 20:20:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTF0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:20:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTF0"}, "ts": "2023-07-13 20:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:21:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01876-1.111.111"}, "ts": "2023-07-13 20:21:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876-1", "user": "Undecided", "type": "error", "page": "Siteview", "message": "Network error. Site Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 20:21:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60759", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60759"}, "ts": "2023-07-13 20:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54577", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:21:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54577"}, "ts": "2023-07-13 20:21:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JY8-1"}, "ts": "2023-07-13 20:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JY8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12382", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:22:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12382"}, "ts": "2023-07-13 20:22:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99665-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:22:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99665-1"}, "ts": "2023-07-13 20:22:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPF5.213.213"}, "ts": "2023-07-13 20:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPF5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXB2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:22:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXB2"}, "ts": "2023-07-13 20:22:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62137"}, "ts": "2023-07-13 20:22:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62137", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:22:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:23:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGB1"}, "ts": "2023-07-13 20:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LGC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:23:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7LGC8.433.433"}, "ts": "2023-07-13 20:23:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBJ8"}, "ts": "2023-07-13 20:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47890", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:23:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47890"}, "ts": "2023-07-13 20:23:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10636.508.508"}, "ts": "2023-07-13 20:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10636", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:24:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAA4"}, "ts": "2023-07-13 20:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAA4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8C6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:25:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8C6"}, "ts": "2023-07-13 20:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:25:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20819778", "type": "PubMed"}, "ts": "2023-07-13 20:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20819778", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:25:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5MIZ7.586.586"}, "ts": "2023-07-13 20:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5MIZ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YL7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:25:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86YL7.102.102"}, "ts": "2023-07-13 20:25:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04837"}, "ts": "2023-07-13 20:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04837", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:26:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82119TF"}, "ts": "2023-07-13 20:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28359", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:26:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28359"}, "ts": "2023-07-13 20:26:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14929", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:27:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14929.343.343"}, "ts": "2023-07-13 20:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:27:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPF2"}, "ts": "2023-07-13 20:27:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24402227", "type": "PubMed"}, "ts": "2023-07-13 20:27:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24402227", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:27:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHP7"}, "ts": "2023-07-13 20:29:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:29:06 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 20:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 20:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 20:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P299", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:30:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P299"}, "ts": "2023-07-13 20:30:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10923041", "type": "PubMed"}, "ts": "2023-07-13 20:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10923041", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:30:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HBM0.95.95"}, "ts": "2023-07-13 20:30:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBM0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:30:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUA8.416.416"}, "ts": "2023-07-13 20:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUA8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04444", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:31:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04444"}, "ts": "2023-07-13 20:31:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27664330", "type": "PubMed"}, "ts": "2023-07-13 20:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27664330", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:33:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:33:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15520"}, "ts": "2023-07-13 20:33:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42768.464.464"}, "ts": "2023-07-13 20:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42768", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:34:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62277"}, "ts": "2023-07-13 20:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:36:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHR4"}, "ts": "2023-07-13 20:36:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BH66"}, "ts": "2023-07-13 20:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BH66", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:36:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPZ6.530.530"}, "ts": "2023-07-13 20:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPZ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:37:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDD1"}, "ts": "2023-07-13 20:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53985", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:37:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53985"}, "ts": "2023-07-13 20:37:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04035-1"}, "ts": "2023-07-13 20:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04035-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:38:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPW5"}, "ts": "2023-07-13 20:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HK5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:38:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63HK5.596.596"}, "ts": "2023-07-13 20:38:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0X2-1"}, "ts": "2023-07-13 20:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0X2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:38:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15733851", "type": "PubMed"}, "ts": "2023-07-13 20:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:38:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15733851", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:38:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:38:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16401"}, "ts": "2023-07-13 20:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16401", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 20:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99KY4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:39:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99KY4.1171.1171"}, "ts": "2023-07-13 20:39:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15112053", "type": "PubMed"}, "ts": "2023-07-13 20:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15112053", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04439"}, "ts": "2023-07-13 20:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04439", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYW7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:40:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYW7.111.111"}, "ts": "2023-07-13 20:40:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D746", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:40:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D746"}, "ts": "2023-07-13 20:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AZA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:40:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B1AZA5.16.16"}, "ts": "2023-07-13 20:40:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8308033", "type": "PubMed"}, "ts": "2023-07-13 20:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8308033", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:41:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99808"}, "ts": "2023-07-13 20:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99808", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:42:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50151-1"}, "ts": "2023-07-13 20:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:42:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NXT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:42:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NXT4"}, "ts": "2023-07-13 20:42:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 20:42:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-13 20:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:43:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15822.187.187"}, "ts": "2023-07-13 20:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01132", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:44:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01132"}, "ts": "2023-07-13 20:44:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5I0L3-1"}, "ts": "2023-07-13 20:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0L3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:44:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WJ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:44:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86WJ1.39.39"}, "ts": "2023-07-13 20:44:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-13 20:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-13 20:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24821-1"}, "ts": "2023-07-13 20:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24821-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:47:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92764.441.441"}, "ts": "2023-07-13 20:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92764", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LGC8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:48:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7LGC8"}, "ts": "2023-07-13 20:48:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5RJT2.671.671"}, "ts": "2023-07-13 20:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RJT2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:49:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8CG34.370.370"}, "ts": "2023-07-13 20:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8CG34", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43829", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:49:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43829"}, "ts": "2023-07-13 20:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:49:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGU2.39.39"}, "ts": "2023-07-13 20:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4T1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:50:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R4T1.116.116"}, "ts": "2023-07-13 20:50:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26657514", "type": "PubMed"}, "ts": "2023-07-13 20:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26657514", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:50:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q924Z6.201.201"}, "ts": "2023-07-13 20:50:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924Z6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:50:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BLJ3"}, "ts": "2023-07-13 20:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:51:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96R48"}, "ts": "2023-07-13 20:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R48", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BLJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8700852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:51:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8700852", "type": "PubMed"}, "ts": "2023-07-13 20:51:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31910261", "type": "PubMed"}, "ts": "2023-07-13 20:52:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31910261", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:52:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:52:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPS6.1335.1335"}, "ts": "2023-07-13 20:52:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60645-1"}, "ts": "2023-07-13 20:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60645-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q672K1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:52:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q672K1"}, "ts": "2023-07-13 20:52:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQR0"}, "ts": "2023-07-13 20:52:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V5L5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V5L5-1"}, "ts": "2023-07-13 20:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U44", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:53:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86U44.48.48"}, "ts": "2023-07-13 20:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 20:54:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38776RF"}, "ts": "2023-07-13 20:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G38776RF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 20:54:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63000"}, "ts": "2023-07-13 20:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63000", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYT7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:55:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QYT7-1"}, "ts": "2023-07-13 20:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14723704", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:56:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14723704", "type": "PubMed"}, "ts": "2023-07-13 20:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15107829", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 20:56:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15107829", "type": "PubMed"}, "ts": "2023-07-13 20:56:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z0J8.269.269"}, "ts": "2023-07-13 20:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0J8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:56:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 20:56:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32969"}, "ts": "2023-07-13 20:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32969", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51810", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51810"}, "ts": "2023-07-13 20:57:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10636.123.123"}, "ts": "2023-07-13 20:57:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:58:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXB3"}, "ts": "2023-07-13 20:58:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:58:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23246"}, "ts": "2023-07-13 20:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:59:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56818", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 20:59:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56818"}, "ts": "2023-07-13 20:59:37 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 21:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 21:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 21:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 21:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 21:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 21:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9S5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H9S5"}, "ts": "2023-07-13 21:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16394-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16394-1"}, "ts": "2023-07-13 21:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "13130130", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:01:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "13130130", "type": "PubMed"}, "ts": "2023-07-13 21:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZV70", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:01:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZV70"}, "ts": "2023-07-13 21:01:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24825904", "type": "PubMed"}, "ts": "2023-07-13 21:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24825904", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04235-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04235-1"}, "ts": "2023-07-13 21:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-13 21:03:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-13 21:03:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31544HA"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41247ZX"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46503DX"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-13 21:03:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59626AS"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-13 21:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-13 21:03:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7LFX5.66.66"}, "ts": "2023-07-13 21:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LFX5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969F0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969F0"}, "ts": "2023-07-13 21:03:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95749"}, "ts": "2023-07-13 21:04:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:04:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43292.299.299"}, "ts": "2023-07-13 21:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43292", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:06:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48048"}, "ts": "2023-07-13 21:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48048", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:06:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10602120", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:07:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10602120", "type": "PubMed"}, "ts": "2023-07-13 21:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:07:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92823.1115.1115"}, "ts": "2023-07-13 21:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:07:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10473", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:07:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q10473.95.95"}, "ts": "2023-07-13 21:07:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50895.453.453"}, "ts": "2023-07-13 21:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50895", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27152329", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:08:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27152329", "type": "PubMed"}, "ts": "2023-07-13 21:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00154"}, "ts": "2023-07-13 21:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00154", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:08:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7862460", "type": "PubMed"}, "ts": "2023-07-13 21:09:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7862460", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:09:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7862460", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:09:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSD7"}, "ts": "2023-07-13 21:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:09:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNI4"}, "ts": "2023-07-13 21:09:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWW6-1"}, "ts": "2023-07-13 21:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWW6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:09:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73578JC"}, "ts": "2023-07-13 21:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:10:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-13 21:10:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73578JC"}, "ts": "2023-07-13 21:10:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "18721477"}, "ts": "2023-07-13 21:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:10:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14731398", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:11:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14731398", "type": "PubMed"}, "ts": "2023-07-13 21:11:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CX86-1"}, "ts": "2023-07-13 21:11:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX86-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23676666", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:11:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23676666", "type": "PubMed"}, "ts": "2023-07-13 21:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29244158", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:12:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29244158", "type": "PubMed"}, "ts": "2023-07-13 21:12:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22760", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:12:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22760.282.282"}, "ts": "2023-07-13 21:12:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14677", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:13:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14677"}, "ts": "2023-07-13 21:13:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20876197", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:13:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20876197", "type": "PubMed"}, "ts": "2023-07-13 21:13:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:14:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00024MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:14:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00024MO"}, "ts": "2023-07-13 21:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q719N3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q719N3-1"}, "ts": "2023-07-13 21:14:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9228031", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:14:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9228031", "type": "PubMed"}, "ts": "2023-07-13 21:14:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07744-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:14:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07744-1"}, "ts": "2023-07-13 21:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZUJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:14:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZUJ4"}, "ts": "2023-07-13 21:14:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43172", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:15:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43172"}, "ts": "2023-07-13 21:15:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92611.628.628"}, "ts": "2023-07-13 21:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92611", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:15:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25325-1"}, "ts": "2023-07-13 21:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25325-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7D7"}, "ts": "2023-07-13 21:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7D7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:16:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99986.342.342"}, "ts": "2023-07-13 21:16:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99986", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:16:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z8A4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:16:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z8A4"}, "ts": "2023-07-13 21:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18289514", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:16:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18289514", "type": "PubMed"}, "ts": "2023-07-13 21:16:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17046-1.71.71"}, "ts": "2023-07-13 21:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17046-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32427867", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:17:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32427867", "type": "PubMed"}, "ts": "2023-07-13 21:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16030164", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:18:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16030164", "type": "PubMed"}, "ts": "2023-07-13 21:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 21:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70288", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 21:18:34 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P70288", "cluster_type": "unselected"}, "ts": "2023-07-13 21:18:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70288", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:18:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96K76.1105.1105"}, "ts": "2023-07-13 21:18:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:18:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46089"}, "ts": "2023-07-13 21:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46089", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:19:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98602UY"}, "ts": "2023-07-13 21:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98602UY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14435", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:19:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14435"}, "ts": "2023-07-13 21:19:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07498"}, "ts": "2023-07-13 21:19:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:20:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92876"}, "ts": "2023-07-13 21:20:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49902", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:20:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49902"}, "ts": "2023-07-13 21:20:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29429960", "type": "PubMed"}, "ts": "2023-07-13 21:21:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29429960", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29429960", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:21:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HZK2"}, "ts": "2023-07-13 21:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HZK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:21:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02730", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:21:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02730.288.288"}, "ts": "2023-07-13 21:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27507172", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:22:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27507172", "type": "PubMed"}, "ts": "2023-07-13 21:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00468", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:22:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00468.1095.1095"}, "ts": "2023-07-13 21:22:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:22:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRX3"}, "ts": "2023-07-13 21:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33727640", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:22:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33727640", "type": "PubMed"}, "ts": "2023-07-13 21:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01861"}, "ts": "2023-07-13 21:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01861", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:24:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08842", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:24:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01282-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 21:24:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01282-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 21:24:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08842"}, "ts": "2023-07-13 21:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y215", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:25:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y215"}, "ts": "2023-07-13 21:25:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07817"}, "ts": "2023-07-13 21:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43491"}, "ts": "2023-07-13 21:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43491", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73578JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G73578JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:26:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 21:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73578JC"}, "ts": "2023-07-13 21:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22312GP"}, "ts": "2023-07-13 21:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37772BP"}, "ts": "2023-07-13 21:26:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90852NI"}, "ts": "2023-07-13 21:26:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2TB54-1"}, "ts": "2023-07-13 21:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2TB54-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:27:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35443"}, "ts": "2023-07-13 21:27:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35443", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48036-1"}, "ts": "2023-07-13 21:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48036-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACK0-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:28:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACK0-1"}, "ts": "2023-07-13 21:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57789"}, "ts": "2023-07-13 21:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G38999IM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:30:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38999IM"}, "ts": "2023-07-13 21:30:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2J7-1"}, "ts": "2023-07-13 21:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2J7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R262-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:30:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R262-1"}, "ts": "2023-07-13 21:30:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18825.33.33"}, "ts": "2023-07-13 21:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18825", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:30:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGJ5"}, "ts": "2023-07-13 21:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15170388", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:31:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15170388", "type": "PubMed"}, "ts": "2023-07-13 21:31:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15257-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:31:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15257-1"}, "ts": "2023-07-13 21:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1X4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:32:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1X4-1"}, "ts": "2023-07-13 21:32:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8856068", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:32:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8856068", "type": "PubMed"}, "ts": "2023-07-13 21:32:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMG9"}, "ts": "2023-07-13 21:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:32:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1684952", "type": "PubMed"}, "ts": "2023-07-13 21:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1684952", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1684952", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56962", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 21:32:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P56962", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 21:32:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZPM7-1"}, "ts": "2023-07-13 21:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZPM7-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:32:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G063"}, "ts": "2023-07-13 21:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G063", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:32:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7L8"}, "ts": "2023-07-13 21:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7L8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:33:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-13 21:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:33:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52594.167.167"}, "ts": "2023-07-13 21:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52594", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:33:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCC0"}, "ts": "2023-07-13 21:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:34:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2363690"}, "ts": "2023-07-13 21:34:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33369194", "type": "PubMed"}, "ts": "2023-07-13 21:35:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33369194", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:35:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33369194", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:35:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91YU6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91YU6"}, "ts": "2023-07-13 21:35:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14841", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:35:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14841.787.787"}, "ts": "2023-07-13 21:35:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11207363", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:35:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11207363", "type": "PubMed"}, "ts": "2023-07-13 21:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99J86", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:36:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99J86"}, "ts": "2023-07-13 21:36:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:36:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Q2.411.411"}, "ts": "2023-07-13 21:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63155-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:36:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63155-1.478.478"}, "ts": "2023-07-13 21:36:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07737"}, "ts": "2023-07-13 21:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:37:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15052.133.133"}, "ts": "2023-07-13 21:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21490621", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:37:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21490621", "type": "PubMed"}, "ts": "2023-07-13 21:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20301753", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:37:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20301753", "type": "PubMed"}, "ts": "2023-07-13 21:37:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BR77-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:37:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BR77-1"}, "ts": "2023-07-13 21:37:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34704412", "type": "PubMed"}, "ts": "2023-07-13 21:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34704412", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42263", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:38:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42263.95.95"}, "ts": "2023-07-13 21:38:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:39:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62959-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:39:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62959-1.73.73"}, "ts": "2023-07-13 21:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L2J0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:39:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L2J0"}, "ts": "2023-07-13 21:39:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17589526", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:39:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17589526", "type": "PubMed"}, "ts": "2023-07-13 21:39:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43427"}, "ts": "2023-07-13 21:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43427", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X91"}, "ts": "2023-07-13 21:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X91", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:41:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27573237", "type": "PubMed"}, "ts": "2023-07-13 21:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27573237", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4T2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:41:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4T2"}, "ts": "2023-07-13 21:41:47 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000018", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-13 21:42:23 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000018", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-13 21:42:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CCS2"}, "ts": "2023-07-13 21:42:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000018", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 21:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CCS2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-13 21:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09324", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:42:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09324"}, "ts": "2023-07-13 21:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12124352", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:42:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12124352", "type": "PubMed"}, "ts": "2023-07-13 21:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12124352", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:42:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20369371", "type": "PubMed"}, "ts": "2023-07-13 21:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20369371", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33917849", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:43:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33917849", "type": "PubMed"}, "ts": "2023-07-13 21:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23729WG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:44:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23729WG"}, "ts": "2023-07-13 21:44:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX72"}, "ts": "2023-07-13 21:44:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:44:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14694", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:45:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14694.378.378"}, "ts": "2023-07-13 21:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G33476GF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:46:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G33476GF"}, "ts": "2023-07-13 21:46:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95999.91.91"}, "ts": "2023-07-13 21:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95999", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62384-1"}, "ts": "2023-07-13 21:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62384-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:46:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32722PR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:46:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32722PR"}, "ts": "2023-07-13 21:46:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17020", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:47:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17020"}, "ts": "2023-07-13 21:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BU23", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:48:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BU23.97.97"}, "ts": "2023-07-13 21:48:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UZ39", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:48:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UZ39.348.348"}, "ts": "2023-07-13 21:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42229"}, "ts": "2023-07-13 21:48:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:48:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60749"}, "ts": "2023-07-13 21:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0E2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:48:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0E2.471.471"}, "ts": "2023-07-13 21:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:48:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5H9.215.215"}, "ts": "2023-07-13 21:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3T4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:48:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3T4-1"}, "ts": "2023-07-13 21:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42262", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:49:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42262.610.610"}, "ts": "2023-07-13 21:49:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36983SB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:49:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36983SB"}, "ts": "2023-07-13 21:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSR8"}, "ts": "2023-07-13 21:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSR8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:50:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6Q9"}, "ts": "2023-07-13 21:50:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95936", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:51:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95936.167.167"}, "ts": "2023-07-13 21:51:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NA8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:51:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NA8"}, "ts": "2023-07-13 21:51:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16601204", "type": "PubMed"}, "ts": "2023-07-13 21:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16601204", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34248DA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:52:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34248DA"}, "ts": "2023-07-13 21:52:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q76LX8.942.942"}, "ts": "2023-07-13 21:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:52:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9703429", "type": "PubMed"}, "ts": "2023-07-13 21:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9703429", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:52:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49182"}, "ts": "2023-07-13 21:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49182", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:53:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QZ86.519.519"}, "ts": "2023-07-13 21:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZ86", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:53:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15407.252.252"}, "ts": "2023-07-13 21:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15407", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09216"}, "ts": "2023-07-13 21:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09216", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:53:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HC35.146.146"}, "ts": "2023-07-13 21:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC35", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:53:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35813"}, "ts": "2023-07-13 21:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6172714", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:54:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6172714", "type": "PubMed"}, "ts": "2023-07-13 21:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29016", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:55:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29016"}, "ts": "2023-07-13 21:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:56:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31785.287.287"}, "ts": "2023-07-13 21:56:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05329.311.311"}, "ts": "2023-07-13 21:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05329", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31796800", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:57:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31796800", "type": "PubMed"}, "ts": "2023-07-13 21:57:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31796800", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 21:57:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEJ3"}, "ts": "2023-07-13 21:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEJ3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16790", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:57:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16790"}, "ts": "2023-07-13 21:57:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z388.123.123"}, "ts": "2023-07-13 21:58:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 21:58:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-13 21:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 21:58:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 21:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z388", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 21:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:58:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27658", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 21:58:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27658"}, "ts": "2023-07-13 21:58:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16790", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:58:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16790"}, "ts": "2023-07-13 21:58:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22361XJ"}, "ts": "2023-07-13 21:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22361XJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 21:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:58:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CG38"}, "ts": "2023-07-13 21:58:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:58:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22314"}, "ts": "2023-07-13 21:59:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 21:59:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 21:59:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23825428", "type": "PubMed"}, "ts": "2023-07-13 21:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23825428", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 21:59:55 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 22:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 22:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 22:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 22:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 22:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 22:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 22:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 22:00:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 22:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3f3436b3f77a42879f5eb0a170328500", "user": "Undecided", "type": "error", "page": "glycan-list", "message": "non-existent-search-results error code. list api call"}, "ts": "2023-07-13 22:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:00:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:00:11 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:00:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ7"}, "ts": "2023-07-13 22:00:11 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 22:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 22:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 22:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11150", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:00:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11150"}, "ts": "2023-07-13 22:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:00:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8416919", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:00:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8416919", "type": "PubMed"}, "ts": "2023-07-13 22:00:23 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(5)NeuAc(1)", "term_category": "any"}, "ts": "2023-07-13 22:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 22:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(5)NeuAc(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 22:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 22:00:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 22:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57504TA"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23340ZN"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86298IX"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79394LC"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25140TA"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63939TP"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99440FA"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48648VZ"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86632ZU"}, "ts": "2023-07-13 22:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80759CD"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33947BV"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40490KT"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05850WN"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61465OY"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24202BK"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82138AT"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40734VV"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58063ME"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21327TO"}, "ts": "2023-07-13 22:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 22:00:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-13 22:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZCM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00665JQ"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92073XL"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88198IB"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25529RM"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78519JI"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64002SF"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26301NP"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21880FP"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48896XT"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16857IL"}, "ts": "2023-07-13 22:00:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72986IT"}, "ts": "2023-07-13 22:00:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZCM9"}, "ts": "2023-07-13 22:00:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73938VT"}, "ts": "2023-07-13 22:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74344BJ"}, "ts": "2023-07-13 22:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12386ZH"}, "ts": "2023-07-13 22:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22335YF"}, "ts": "2023-07-13 22:00:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08276QL"}, "ts": "2023-07-13 22:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VP1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:00:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86VP1.306.306"}, "ts": "2023-07-13 22:00:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "mass", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-13 22:00:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "cc0332d55a0435fef723320fa5a345e2", "offset": 1, "sort": "mass", "limit": 20, "order": "asc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-13 22:00:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:00:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09874-1.426.426"}, "ts": "2023-07-13 22:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14149", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14149"}, "ts": "2023-07-13 22:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:01:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14632196", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:01:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14632196", "type": "PubMed"}, "ts": "2023-07-13 22:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:02:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXN2"}, "ts": "2023-07-13 22:02:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VXU1"}, "ts": "2023-07-13 22:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VXU1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZTN6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:02:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZTN6.111.111"}, "ts": "2023-07-13 22:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01582", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:02:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01582", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 22:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01582", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 22:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:03:11 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:03:11 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 22:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 22:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 22:03:12 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(5)HexNAc(5)", "term_category": "any"}, "ts": "2023-07-13 22:03:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 22:03:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">4f47d6c261ad583d7687cb0ac270bc8f", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(5)HexNAc(5)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 22:03:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 22:03:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 22:03:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52934AK"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14127XU"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14998UC"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97765TT"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07041CT"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50779LX"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45187EI"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60215UL"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70945OS"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55396DW"}, "ts": "2023-07-13 22:03:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41331JX"}, "ts": "2023-07-13 22:03:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61792ET"}, "ts": "2023-07-13 22:03:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10691MJ"}, "ts": "2023-07-13 22:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 22:03:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4f47d6c261ad583d7687cb0ac270bc8f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-13 22:03:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29651HS"}, "ts": "2023-07-13 22:03:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65184UU"}, "ts": "2023-07-13 22:03:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18214MO"}, "ts": "2023-07-13 22:03:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26403SG"}, "ts": "2023-07-13 22:03:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79568CQ"}, "ts": "2023-07-13 22:03:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70822IO"}, "ts": "2023-07-13 22:03:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22625SJ"}, "ts": "2023-07-13 22:03:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98611JV"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69107AL"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71506JZ"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70538OR"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63194GH"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98327TQ"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37282LW"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95698VF"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98798WK"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46520QG"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63188OY"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90999PU"}, "ts": "2023-07-13 22:03:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9077527", "type": "PubMed"}, "ts": "2023-07-13 22:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9077527", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:03:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16501887", "type": "PubMed"}, "ts": "2023-07-13 22:03:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16501887", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:03:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95954", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:03:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95954"}, "ts": "2023-07-13 22:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2109322", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:04:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2109322", "type": "PubMed"}, "ts": "2023-07-13 22:04:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P27338", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 22:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27338", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11410838", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:04:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11410838", "type": "PubMed"}, "ts": "2023-07-13 22:04:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78380.271.271"}, "ts": "2023-07-13 22:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78380", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23248241", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSD9"}, "ts": "2023-07-13 22:06:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23248241", "type": "PubMed"}, "ts": "2023-07-13 22:06:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 22:06:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHI8"}, "ts": "2023-07-13 22:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHI8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:06:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R0I4-1"}, "ts": "2023-07-13 22:07:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTA9"}, "ts": "2023-07-13 22:07:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R0I4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31616413", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:07:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31616413", "type": "PubMed"}, "ts": "2023-07-13 22:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:07:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4C1.659.659"}, "ts": "2023-07-13 22:07:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34549824", "type": "PubMed"}, "ts": "2023-07-13 22:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34549824", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 22:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:07:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H082"}, "ts": "2023-07-13 22:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:07:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01732.139.139"}, "ts": "2023-07-13 22:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03951-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:07:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P03951-1.491.491"}, "ts": "2023-07-13 22:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:07:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R151-1"}, "ts": "2023-07-13 22:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:07:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27169"}, "ts": "2023-07-13 22:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27169", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:07:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q4VC44", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 22:08:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC44", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:08:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09429", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 22:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJ41-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:08:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJ41-2"}, "ts": "2023-07-13 22:08:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14934"}, "ts": "2023-07-13 22:08:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14934", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:08:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A075B6Q5-1.36.36"}, "ts": "2023-07-13 22:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A075B6Q5-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:08:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:09:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43489", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:09:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43489"}, "ts": "2023-07-13 22:09:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MS0"}, "ts": "2023-07-13 22:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MS0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:09:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19191331", "type": "PubMed"}, "ts": "2023-07-13 22:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19191331", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10320813", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:10:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10320813", "type": "PubMed"}, "ts": "2023-07-13 22:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:10:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IPK4"}, "ts": "2023-07-13 22:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IPK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14498", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:10:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14498.353.353"}, "ts": "2023-07-13 22:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY84-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY84-1"}, "ts": "2023-07-13 22:11:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMC9.85.85"}, "ts": "2023-07-13 22:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMC9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70309", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:11:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70309"}, "ts": "2023-07-13 22:11:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11069186", "type": "PubMed"}, "ts": "2023-07-13 22:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11069186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09200", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:12:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09200"}, "ts": "2023-07-13 22:12:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17556730", "type": "PubMed"}, "ts": "2023-07-13 22:13:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17556730", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13162-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:13:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13162-1"}, "ts": "2023-07-13 22:13:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32564485", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:14:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32564485", "type": "PubMed"}, "ts": "2023-07-13 22:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CAX5"}, "ts": "2023-07-13 22:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CAX5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53EL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:14:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q53EL6.67.67"}, "ts": "2023-07-13 22:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56481", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:14:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56481"}, "ts": "2023-07-13 22:14:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N1F7.15.15"}, "ts": "2023-07-13 22:16:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1F7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:16:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L73"}, "ts": "2023-07-13 22:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A7F4"}, "ts": "2023-07-13 22:18:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A7F4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:18:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34153683", "type": "PubMed"}, "ts": "2023-07-13 22:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34153683", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N357", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:18:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N357"}, "ts": "2023-07-13 22:18:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:18:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16849"}, "ts": "2023-07-13 22:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:18:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21754"}, "ts": "2023-07-13 22:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21754", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:19:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE57"}, "ts": "2023-07-13 22:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE57", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:19:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VGV7-1"}, "ts": "2023-07-13 22:19:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VGV7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:19:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O43169", "cluster_type": "unselected"}, "ts": "2023-07-13 22:19:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43169", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:19:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQX1-1"}, "ts": "2023-07-13 22:19:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQX1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:19:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "20237269"}, "ts": "2023-07-13 22:19:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 22:19:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:19:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95407"}, "ts": "2023-07-13 22:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95407", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:20:00 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 22:20:05 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 22:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 22:20:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42658"}, "ts": "2023-07-13 22:20:12 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(1)dHex(1)", "term_category": "any"}, "ts": "2023-07-13 22:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42658", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 22:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b47ff99fa11034ca82f58511341ac5a4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(1)dHex(1)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 22:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b47ff99fa11034ca82f58511341ac5a4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 22:20:17 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b47ff99fa11034ca82f58511341ac5a4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 22:20:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47180UC"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55559HZ"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70593HA"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60605ZN"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91028VZ"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18220BL"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50236GJ"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27608TI"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19813SH"}, "ts": "2023-07-13 22:20:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98896IU"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00054MO"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00051MO"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00672PE"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80722US"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00659GQ"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91532KA"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61459JW"}, "ts": "2023-07-13 22:20:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91028VZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 22:20:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91028VZ"}, "ts": "2023-07-13 22:20:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00194GV"}, "ts": "2023-07-13 22:20:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39631KX"}, "ts": "2023-07-13 22:20:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34329HY"}, "ts": "2023-07-13 22:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:21:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW92"}, "ts": "2023-07-13 22:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:21:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWX8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:21:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWX8.828.828"}, "ts": "2023-07-13 22:21:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78357-1"}, "ts": "2023-07-13 22:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78357-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:21:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEQ6"}, "ts": "2023-07-13 22:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923L3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923L3"}, "ts": "2023-07-13 22:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6VAB6"}, "ts": "2023-07-13 22:22:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6VAB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:22:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22105", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:22:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22105.2649.2649"}, "ts": "2023-07-13 22:22:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17849173", "type": "PubMed"}, "ts": "2023-07-13 22:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17849173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A1Y7VNZ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:23:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A1Y7VNZ0"}, "ts": "2023-07-13 22:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P82-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:23:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P82-1"}, "ts": "2023-07-13 22:23:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H553-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPD8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:23:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZPD8.271.271"}, "ts": "2023-07-13 22:23:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H553-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 22:23:34 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:25:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:25:06 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:25:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:25:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43134TX"}, "ts": "2023-07-13 22:25:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43134TX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 22:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31641"}, "ts": "2023-07-13 22:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31641", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:25:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9R1Z8.594.594"}, "ts": "2023-07-13 22:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1Z8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:25:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZSA0-1"}, "ts": "2023-07-13 22:26:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZSA0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTI5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:26:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NTI5.1140.1140"}, "ts": "2023-07-13 22:26:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21368295", "type": "PubMed"}, "ts": "2023-07-13 22:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21368295", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:26:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43424-1"}, "ts": "2023-07-13 22:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43424-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:26:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WVH3.262.262"}, "ts": "2023-07-13 22:27:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVH3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:27:05 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FU4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:27:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FU4"}, "ts": "2023-07-13 22:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B7Z6K7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:27:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B7Z6K7.296.296"}, "ts": "2023-07-13 22:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:28:04 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JSJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:28:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C9JSJ3"}, "ts": "2023-07-13 22:28:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22366-1.244.244"}, "ts": "2023-07-13 22:28:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22366-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:28:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-13 22:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 22:28:34 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "G00031MO"}, "ts": "2023-07-13 22:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 22:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=G00031MO"}, "ts": "2023-07-13 22:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43148", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:28:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43148.327.327"}, "ts": "2023-07-13 22:28:44 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 22:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d713d21eb1f66aa8fd7c36f309007ffa", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 22:28:47 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d713d21eb1f66aa8fd7c36f309007ffa", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 22:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-13 22:28:54 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "G00031MO"}, "ts": "2023-07-13 22:28:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=G00031MO"}, "ts": "2023-07-13 22:28:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2X9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:29:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2X9.447.447"}, "ts": "2023-07-13 22:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33999358", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:30:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33999358", "type": "PubMed"}, "ts": "2023-07-13 22:30:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96M91"}, "ts": "2023-07-13 22:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96M91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:30:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A9Q0"}, "ts": "2023-07-13 22:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A9Q0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:31:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:31:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P4E1.117.117"}, "ts": "2023-07-13 22:31:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21854"}, "ts": "2023-07-13 22:31:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21854", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:31:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CJ9-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:31:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68CJ9-1.220.220"}, "ts": "2023-07-13 22:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00461", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:32:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00461.27.27"}, "ts": "2023-07-13 22:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:32:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24480542", "type": "PubMed"}, "ts": "2023-07-13 22:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24480542", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92833", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:33:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92833"}, "ts": "2023-07-13 22:33:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:33:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVL1"}, "ts": "2023-07-13 22:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:33:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13261"}, "ts": "2023-07-13 22:33:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 22:33:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49286"}, "ts": "2023-07-13 22:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49286", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TR58", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:34:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TR58"}, "ts": "2023-07-13 22:34:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53752TA"}, "ts": "2023-07-13 22:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53752TA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 22:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:35:43 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 22:35:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 22:35:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34627746", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:36:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A484", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:36:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34627746", "type": "PubMed"}, "ts": "2023-07-13 22:36:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "A2A484", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 22:36:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWT9.593.593"}, "ts": "2023-07-13 22:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWT9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:36:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVG6-1"}, "ts": "2023-07-13 22:36:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVG6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:36:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-13 22:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53049OY"}, "ts": "2023-07-13 22:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08481", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08481"}, "ts": "2023-07-13 22:37:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JTH9"}, "ts": "2023-07-13 22:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTH9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:37:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKQ2.325.325"}, "ts": "2023-07-13 22:37:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-13 22:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8262389", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:38:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8262389", "type": "PubMed"}, "ts": "2023-07-13 22:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30817320", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:38:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30817320", "type": "PubMed"}, "ts": "2023-07-13 22:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10915770", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:38:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10915770", "type": "PubMed"}, "ts": "2023-07-13 22:39:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26677959", "type": "PubMed"}, "ts": "2023-07-13 22:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26677959", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:40:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92949-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:40:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92949-1"}, "ts": "2023-07-13 22:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13395"}, "ts": "2023-07-13 22:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12411443", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:41:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12411443", "type": "PubMed"}, "ts": "2023-07-13 22:41:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11057907", "type": "PubMed"}, "ts": "2023-07-13 22:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11057907", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNR9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:42:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNR9"}, "ts": "2023-07-13 22:42:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25407049", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:42:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25407049", "type": "PubMed"}, "ts": "2023-07-13 22:42:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5K3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:42:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5K3"}, "ts": "2023-07-13 22:42:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20729278", "type": "PubMed"}, "ts": "2023-07-13 22:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20729278", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61827-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:43:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61827-1"}, "ts": "2023-07-13 22:43:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95294"}, "ts": "2023-07-13 22:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05086", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:43:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05086.231.231"}, "ts": "2023-07-13 22:43:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63942"}, "ts": "2023-07-13 22:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60901-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:44:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60901-1"}, "ts": "2023-07-13 22:44:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3B7Z2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:44:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3B7Z2"}, "ts": "2023-07-13 22:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24864", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:45:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24864.103.103"}, "ts": "2023-07-13 22:45:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UIK5", "cluster_type": "unselected"}, "ts": "2023-07-13 22:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIK5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 22:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIK5", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 22:46:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:46:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:46:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14817"}, "ts": "2023-07-13 22:46:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-13 22:46:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "about", "message": "page access"}, "ts": "2023-07-13 22:46:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZNA4.911.911"}, "ts": "2023-07-13 22:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNA4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:46:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03426"}, "ts": "2023-07-13 22:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03426", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:47:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "14739326"}, "ts": "2023-07-13 22:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ER39", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:48:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ER39"}, "ts": "2023-07-13 22:48:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43474"}, "ts": "2023-07-13 22:49:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43474", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H307", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:49:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H307.48.48"}, "ts": "2023-07-13 22:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12884", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12884"}, "ts": "2023-07-13 22:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:49:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPS6.1320.1320"}, "ts": "2023-07-13 22:49:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26866982", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:50:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26866982", "type": "PubMed"}, "ts": "2023-07-13 22:50:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07197.863.863"}, "ts": "2023-07-13 22:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07197", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22043319", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:50:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22043319", "type": "PubMed"}, "ts": "2023-07-13 22:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17021"}, "ts": "2023-07-13 22:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:50:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:50:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17490"}, "ts": "2023-07-13 22:50:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DFD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DFD8"}, "ts": "2023-07-13 22:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96G23"}, "ts": "2023-07-13 22:51:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:51:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A158"}, "ts": "2023-07-13 22:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L8W6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:52:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L8W6"}, "ts": "2023-07-13 22:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26951", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:52:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26951"}, "ts": "2023-07-13 22:52:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29906447", "type": "PubMed"}, "ts": "2023-07-13 22:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29906447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:52:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6E9"}, "ts": "2023-07-13 22:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:52:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 22:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 22:52:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 22:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 22:53:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-13 22:53:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-13 22:53:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35658"}, "ts": "2023-07-13 22:53:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35658", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9110362", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:53:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9110362", "type": "PubMed"}, "ts": "2023-07-13 22:53:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IUC8.120.120"}, "ts": "2023-07-13 22:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-13 22:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06418"}, "ts": "2023-07-13 22:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:54:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:54:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BRQ8.152.152"}, "ts": "2023-07-13 22:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16422", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 22:54:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16422.232.232"}, "ts": "2023-07-13 22:54:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15317934", "type": "PubMed"}, "ts": "2023-07-13 22:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15317934", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:56:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2X4"}, "ts": "2023-07-13 22:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2X4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-13 22:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99836", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 22:57:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99836"}, "ts": "2023-07-13 22:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-13 22:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z204", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z204"}, "ts": "2023-07-13 22:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWZ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 22:58:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWZ7"}, "ts": "2023-07-13 22:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12732141", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 22:58:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12732141", "type": "PubMed"}, "ts": "2023-07-13 22:58:20 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-13 23:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-13 23:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-13 23:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-13 23:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-13 23:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-13 23:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16444", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:00:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16444.281.281"}, "ts": "2023-07-13 23:00:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BG89.176.176"}, "ts": "2023-07-13 23:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BG89", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DFL5-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DFL5-1"}, "ts": "2023-07-13 23:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15860461", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:01:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15860461", "type": "PubMed"}, "ts": "2023-07-13 23:01:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UF1.194.194"}, "ts": "2023-07-13 23:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UF1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8652809", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:02:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8652809", "type": "PubMed"}, "ts": "2023-07-13 23:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20068069", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:02:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20068069", "type": "PubMed"}, "ts": "2023-07-13 23:02:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26410531", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:02:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26410531", "type": "PubMed"}, "ts": "2023-07-13 23:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:03:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYA8-1"}, "ts": "2023-07-13 23:03:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYA8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H156", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:03:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H156"}, "ts": "2023-07-13 23:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36552", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:03:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36552"}, "ts": "2023-07-13 23:03:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47211"}, "ts": "2023-07-13 23:05:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:05:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45985", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:05:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45985"}, "ts": "2023-07-13 23:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJE1"}, "ts": "2023-07-13 23:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:06:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15336"}, "ts": "2023-07-13 23:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15336", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:06:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRN7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:06:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRN7.304.304"}, "ts": "2023-07-13 23:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12792", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:06:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12792.143.143"}, "ts": "2023-07-13 23:06:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHF3"}, "ts": "2023-07-13 23:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75509", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:07:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75509.261.261"}, "ts": "2023-07-13 23:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 23:07:14 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 23:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 23:07:26 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "G49108TO", "term_category": "glycan"}, "ts": "2023-07-13 23:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">ed0442614f1404f27f2e9a2839230b0a", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"G49108TO\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-13 23:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ed0442614f1404f27f2e9a2839230b0a", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-13 23:07:28 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 23:07:28 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "ed0442614f1404f27f2e9a2839230b0a", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 23:07:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14696"}, "ts": "2023-07-13 23:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14696", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:07:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03519", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:07:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03519.291.291"}, "ts": "2023-07-13 23:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15146", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15146"}, "ts": "2023-07-13 23:08:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28332314", "type": "PubMed"}, "ts": "2023-07-13 23:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28332314", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:10:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVC0"}, "ts": "2023-07-13 23:10:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34638792", "type": "PubMed"}, "ts": "2023-07-13 23:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34638792", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4L1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:11:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4L1.772.772"}, "ts": "2023-07-13 23:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23711367", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:11:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23711367", "type": "PubMed"}, "ts": "2023-07-13 23:11:32 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "ed0442614f1404f27f2e9a2839230b0a", "offset": 21, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 23:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10865058", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:12:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10865058", "type": "PubMed"}, "ts": "2023-07-13 23:12:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969H0"}, "ts": "2023-07-13 23:12:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969H0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:12:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CPU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:13:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CPU2"}, "ts": "2023-07-13 23:13:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPW0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:13:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPW0-1"}, "ts": "2023-07-13 23:13:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24204276", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:13:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24204276", "type": "PubMed"}, "ts": "2023-07-13 23:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48735", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:13:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48735.111.111"}, "ts": "2023-07-13 23:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10721", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:13:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10721.352.352"}, "ts": "2023-07-13 23:13:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PZ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:14:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PZ0"}, "ts": "2023-07-13 23:14:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ffzkhsjbctnfnh3zfu8lu6u6tvf0et8c", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 23:14:16 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-13 23:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ffzkhsjbctnfnh3zfu8lu6u6tvf0et8c", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-13 23:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55097ES", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 23:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2MKA7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:14:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2MKA7"}, "ts": "2023-07-13 23:14:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55097ES"}, "ts": "2023-07-13 23:14:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHB8"}, "ts": "2023-07-13 23:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P768"}, "ts": "2023-07-13 23:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P768", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:15:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0C2-1"}, "ts": "2023-07-13 23:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0C2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:15:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEQ8.397.397"}, "ts": "2023-07-13 23:15:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 23:16:11 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 23:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 23:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15049", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15049"}, "ts": "2023-07-13 23:16:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16513652", "type": "PubMed"}, "ts": "2023-07-13 23:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16513652", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:18:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:18:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16666.146.146"}, "ts": "2023-07-13 23:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92945", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:19:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92945.125.125"}, "ts": "2023-07-13 23:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32305957", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:20:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32305957", "type": "PubMed"}, "ts": "2023-07-13 23:20:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3X6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:20:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3X6"}, "ts": "2023-07-13 23:20:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-13 23:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16651434", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:21:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16651434", "type": "PubMed"}, "ts": "2023-07-13 23:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N323", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:21:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N323.286.286"}, "ts": "2023-07-13 23:21:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20826455", "type": "PubMed"}, "ts": "2023-07-13 23:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20826455", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:22:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21327982", "type": "PubMed"}, "ts": "2023-07-13 23:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21327982", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VB7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:23:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86VB7.123.123"}, "ts": "2023-07-13 23:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7B0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:23:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z7B0.351.351"}, "ts": "2023-07-13 23:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDG5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:23:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDG5"}, "ts": "2023-07-13 23:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17670796", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:23:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17670796", "type": "PubMed"}, "ts": "2023-07-13 23:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS7"}, "ts": "2023-07-13 23:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ST3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:24:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96ST3.860.860"}, "ts": "2023-07-13 23:24:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "17192257"}, "ts": "2023-07-13 23:24:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 23:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15269"}, "ts": "2023-07-13 23:24:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15269", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JW98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:25:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JW98"}, "ts": "2023-07-13 23:25:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZ23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:25:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZ23"}, "ts": "2023-07-13 23:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 23:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 23:25:55 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 23:26:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 23:26:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P52565", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 23:26:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52565", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 23:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q3P4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:26:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q3P4"}, "ts": "2023-07-13 23:26:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZJ7.63.63"}, "ts": "2023-07-13 23:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:26:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01027.489.489"}, "ts": "2023-07-13 23:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01027", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:27:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY25"}, "ts": "2023-07-13 23:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYA8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:27:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYA8"}, "ts": "2023-07-13 23:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27540", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:29:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27540.58.58"}, "ts": "2023-07-13 23:29:24 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 23:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 23:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 23:30:10 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 23:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 23:30:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60963"}, "ts": "2023-07-13 23:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60963", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47820-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:30:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47820-1"}, "ts": "2023-07-13 23:30:19 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(4)HexNAc(2)NeuAc(3)", "term_category": "any"}, "ts": "2023-07-13 23:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 23:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">ea3757e63bf9f035a753db7c8a2287aa", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(4)HexNAc(2)NeuAc(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 23:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ea3757e63bf9f035a753db7c8a2287aa", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 23:30:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ea3757e63bf9f035a753db7c8a2287aa", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 23:30:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9565599", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:30:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9565599", "type": "PubMed"}, "ts": "2023-07-13 23:30:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97623TJ"}, "ts": "2023-07-13 23:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99373GG"}, "ts": "2023-07-13 23:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52475DQ"}, "ts": "2023-07-13 23:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00841YH"}, "ts": "2023-07-13 23:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06971VR"}, "ts": "2023-07-13 23:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21058TC"}, "ts": "2023-07-13 23:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22709NM"}, "ts": "2023-07-13 23:30:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99373GG"}, "ts": "2023-07-13 23:30:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99373GG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 23:30:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-13 23:30:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-13 23:30:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66882ES"}, "ts": "2023-07-13 23:30:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 23:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 23:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 23:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 23:31:58 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(4)HexNAc(2)NeuAc(4)", "term_category": "any"}, "ts": "2023-07-13 23:31:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(4)HexNAc(2)NeuAc(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 23:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 23:32:04 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(4)HexNAc(2)NeuAc(4)", "term_category": "any"}, "ts": "2023-07-13 23:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(4)HexNAc(2)NeuAc(4)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 23:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04435"}, "ts": "2023-07-13 23:32:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04435", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13536", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-13 23:32:09 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(6)HexNAc(5)dHex(1)NeuAc(2)", "term_category": "any"}, "ts": "2023-07-13 23:32:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 23:32:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">fdaaeb4f710ca2e0d9413827f3bf1c4f", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(6)HexNAc(5)dHex(1)NeuAc(2)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 23:32:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "fdaaeb4f710ca2e0d9413827f3bf1c4f", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 23:32:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "fdaaeb4f710ca2e0d9413827f3bf1c4f", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 23:32:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16529MG"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91905FJ"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765SF"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80537QW"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10228OD"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96503EZ"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38022PE"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23345GE"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72580QS"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42686NQ"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03895SR"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16150CJ"}, "ts": "2023-07-13 23:32:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45661NA"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58848QS"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75977KH"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00800WJ"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25713RA"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22208HN"}, "ts": "2023-07-13 23:32:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07199", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:33:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07199.239.239"}, "ts": "2023-07-13 23:33:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BQ52.208.208"}, "ts": "2023-07-13 23:33:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ52", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:33:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NWW9"}, "ts": "2023-07-13 23:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NWW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RKR3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:34:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5RKR3.720.720"}, "ts": "2023-07-13 23:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:34:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11971983", "type": "PubMed"}, "ts": "2023-07-13 23:34:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11971983", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2CW77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:35:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2CW77"}, "ts": "2023-07-13 23:35:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P656"}, "ts": "2023-07-13 23:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ZCN5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:35:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3ZCN5.1208.1208"}, "ts": "2023-07-13 23:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-13 23:35:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-13 23:35:54 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-13 23:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 23:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-13 23:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYR3-1"}, "ts": "2023-07-13 23:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-13 23:36:25 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Hex(2)HexNAc(4)NeuAc(3)", "term_category": "any"}, "ts": "2023-07-13 23:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b30e57a634273d53a49dd36b3c0789f4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Hex(2)HexNAc(4)NeuAc(3)\",\"term_category\":\"any\"}"}, "ts": "2023-07-13 23:36:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b30e57a634273d53a49dd36b3c0789f4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 23:36:26 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b30e57a634273d53a49dd36b3c0789f4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-13 23:36:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46823ME"}, "ts": "2023-07-13 23:36:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64102JR"}, "ts": "2023-07-13 23:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88089UV"}, "ts": "2023-07-13 23:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08246QI"}, "ts": "2023-07-13 23:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85618IE"}, "ts": "2023-07-13 23:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71138QD"}, "ts": "2023-07-13 23:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70753DP"}, "ts": "2023-07-13 23:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05289OX"}, "ts": "2023-07-13 23:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22862WY"}, "ts": "2023-07-13 23:36:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b30e57a634273d53a49dd36b3c0789f4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-13 23:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b30e57a634273d53a49dd36b3c0789f4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-13 23:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q674X7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:36:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7"}, "ts": "2023-07-13 23:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LXC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:36:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64102JR"}, "ts": "2023-07-13 23:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64102JR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 23:36:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LXC0"}, "ts": "2023-07-13 23:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56196WL"}, "ts": "2023-07-13 23:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-13 23:36:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08708", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:36:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08708"}, "ts": "2023-07-13 23:36:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z3L3"}, "ts": "2023-07-13 23:36:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z3L3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19574390", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:37:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19574390", "type": "PubMed"}, "ts": "2023-07-13 23:37:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26926266", "type": "PubMed"}, "ts": "2023-07-13 23:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26926266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26926266", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-13 23:37:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21836"}, "ts": "2023-07-13 23:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21836", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05011"}, "ts": "2023-07-13 23:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05011", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:37:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96NL6.377.377"}, "ts": "2023-07-13 23:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K268", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K268"}, "ts": "2023-07-13 23:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15887", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:38:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15887"}, "ts": "2023-07-13 23:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29180417", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:38:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29180417", "type": "PubMed"}, "ts": "2023-07-13 23:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:38:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05048"}, "ts": "2023-07-13 23:38:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05048", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYH4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:38:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYH4"}, "ts": "2023-07-13 23:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23184662", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:39:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23184662", "type": "PubMed"}, "ts": "2023-07-13 23:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23690950", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:40:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23690950", "type": "PubMed"}, "ts": "2023-07-13 23:40:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78563", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:40:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78563.346.346"}, "ts": "2023-07-13 23:40:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZFN9"}, "ts": "2023-07-13 23:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZFN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43895", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:42:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43895.65.65"}, "ts": "2023-07-13 23:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61924"}, "ts": "2023-07-13 23:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61924", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:42:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12406576", "type": "PubMed"}, "ts": "2023-07-13 23:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12406576", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:43:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60264-1"}, "ts": "2023-07-13 23:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60264-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:43:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75157.537.537"}, "ts": "2023-07-13 23:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75157", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TB24", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:44:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TB24"}, "ts": "2023-07-13 23:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23471", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:44:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23471.9.9"}, "ts": "2023-07-13 23:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19225519", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:44:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19225519", "type": "PubMed"}, "ts": "2023-07-13 23:44:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IYU2.626.626"}, "ts": "2023-07-13 23:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:46:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BZ11.7.7"}, "ts": "2023-07-13 23:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZ11", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:46:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43365XJ"}, "ts": "2023-07-13 23:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 23:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43365XJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 23:47:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFI2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:47:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFI2"}, "ts": "2023-07-13 23:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2H2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:47:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2H2.777.777"}, "ts": "2023-07-13 23:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36544", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:48:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36544"}, "ts": "2023-07-13 23:48:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28653"}, "ts": "2023-07-13 23:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:50:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X55"}, "ts": "2023-07-13 23:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:51:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13439.1505.1505"}, "ts": "2023-07-13 23:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23457", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:52:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23457"}, "ts": "2023-07-13 23:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15488"}, "ts": "2023-07-13 23:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:52:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI17"}, "ts": "2023-07-13 23:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-13 23:52:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 23:52:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-13 23:52:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12515813", "type": "PubMed"}, "ts": "2023-07-13 23:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12515813", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-13 23:52:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NH49.191.191"}, "ts": "2023-07-13 23:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH49", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92546", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:53:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92546"}, "ts": "2023-07-13 23:53:59 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "ed0442614f1404f27f2e9a2839230b0a", "offset": 41, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-13 23:54:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A2Z8"}, "ts": "2023-07-13 23:54:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A2Z8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:54:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-13 23:55:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-13 23:55:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-13 23:56:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-13 23:56:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NR19", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-13 23:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR19", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-13 23:56:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-13 23:56:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-13 23:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PG6"}, "ts": "2023-07-13 23:56:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PG6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-13 23:56:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PXX9"}, "ts": "2023-07-13 23:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PXX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04920", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:57:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04920.223.223"}, "ts": "2023-07-13 23:57:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28661.117.117"}, "ts": "2023-07-13 23:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-13 23:57:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04350"}, "ts": "2023-07-13 23:57:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04350"}, "ts": "2023-07-13 23:57:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y275"}, "ts": "2023-07-13 23:57:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:57:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AIR5-1"}, "ts": "2023-07-13 23:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AIR5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-13 23:58:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49959.597.597"}, "ts": "2023-07-13 23:59:02 EDT-0400"}]