[{"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 00:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 00:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 00:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 00:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 00:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 00:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15520"}, "ts": "2023-07-09 00:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63471-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:01:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63471-1"}, "ts": "2023-07-09 00:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VV8"}, "ts": "2023-07-09 00:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULE3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:01:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ULE3.276.276"}, "ts": "2023-07-09 00:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:02:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYK1"}, "ts": "2023-07-09 00:02:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06455"}, "ts": "2023-07-09 00:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06455", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:02:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.94.94"}, "ts": "2023-07-09 00:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31587OK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:02:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31587OK"}, "ts": "2023-07-09 00:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 00:02:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 00:02:42 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 00:02:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46019"}, "ts": "2023-07-09 00:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00483", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:03:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00483"}, "ts": "2023-07-09 00:03:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L3B6"}, "ts": "2023-07-09 00:03:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L3B6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:03:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:03:38 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q2M385", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 00:03:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 00:03:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M385", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 00:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-09 00:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M385", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-09 00:04:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IW41"}, "ts": "2023-07-09 00:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2Z2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:06:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2Z2"}, "ts": "2023-07-09 00:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:06:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59900"}, "ts": "2023-07-09 00:06:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2V8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:07:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2V8-1"}, "ts": "2023-07-09 00:07:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-09 00:07:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAV8-1"}, "ts": "2023-07-09 00:07:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAV8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5H3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:08:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5H3.831.831"}, "ts": "2023-07-09 00:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G28830ZA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:09:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G28830ZA"}, "ts": "2023-07-09 00:09:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-09 00:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:09:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30392959", "type": "PubMed"}, "ts": "2023-07-09 00:09:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30392959", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:09:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N386"}, "ts": "2023-07-09 00:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:10:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:10:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96G27"}, "ts": "2023-07-09 00:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:10:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:10:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGM5"}, "ts": "2023-07-09 00:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:13:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8N7"}, "ts": "2023-07-09 00:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8N7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:13:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08172.250.250"}, "ts": "2023-07-09 00:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08172", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:13:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32899047", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:13:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32899047", "type": "PubMed"}, "ts": "2023-07-09 00:13:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32899047", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 00:13:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02545"}, "ts": "2023-07-09 00:14:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LVG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:15:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LVG4"}, "ts": "2023-07-09 00:15:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8514852", "type": "PubMed"}, "ts": "2023-07-09 00:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8514852", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32450229", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:15:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32450229", "type": "PubMed"}, "ts": "2023-07-09 00:15:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H792"}, "ts": "2023-07-09 00:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13614", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:16:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13614.640.640"}, "ts": "2023-07-09 00:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:16:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64280"}, "ts": "2023-07-09 00:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01701", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:16:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01701"}, "ts": "2023-07-09 00:16:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWS5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:17:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWS5"}, "ts": "2023-07-09 00:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99598", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:19:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99598"}, "ts": "2023-07-09 00:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07358", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:20:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07358.148.148"}, "ts": "2023-07-09 00:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:20:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15375", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:20:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15375.444.444"}, "ts": "2023-07-09 00:20:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY07.496.496"}, "ts": "2023-07-09 00:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY07", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:20:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61220.56.56"}, "ts": "2023-07-09 00:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61220", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60303", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:21:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60303.691.691"}, "ts": "2023-07-09 00:21:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50281"}, "ts": "2023-07-09 00:22:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50281", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43451", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:22:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43451.1140.1140"}, "ts": "2023-07-09 00:22:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95486.812.812"}, "ts": "2023-07-09 00:23:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95486", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13247", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:23:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13247.81.81"}, "ts": "2023-07-09 00:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62182OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:24:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-09 00:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42574"}, "ts": "2023-07-09 00:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:25:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00264.74.74"}, "ts": "2023-07-09 00:25:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y232.170.170"}, "ts": "2023-07-09 00:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y232", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:25:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54707"}, "ts": "2023-07-09 00:25:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PDY2-1"}, "ts": "2023-07-09 00:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PDY2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J2D5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:26:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J2D5"}, "ts": "2023-07-09 00:26:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:26:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBR2"}, "ts": "2023-07-09 00:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12079346", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:27:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12079346", "type": "PubMed"}, "ts": "2023-07-09 00:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:27:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJS0-1"}, "ts": "2023-07-09 00:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJS0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:27:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55042"}, "ts": "2023-07-09 00:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55042", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47929", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:27:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47929.69.69"}, "ts": "2023-07-09 00:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:27:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00051MO"}, "ts": "2023-07-09 00:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:28:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RU3.296.296"}, "ts": "2023-07-09 00:28:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES89"}, "ts": "2023-07-09 00:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:28:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-09 00:29:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5L3-1"}, "ts": "2023-07-09 00:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L3-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:30:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-09 00:30:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H583", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:30:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H583.1126.1126"}, "ts": "2023-07-09 00:30:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02545", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:30:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17764014", "type": "PubMed"}, "ts": "2023-07-09 00:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17764014", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84074", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84074"}, "ts": "2023-07-09 00:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23863939", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:33:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23863939", "type": "PubMed"}, "ts": "2023-07-09 00:33:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04323", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:33:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04323.199.199"}, "ts": "2023-07-09 00:33:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10950925", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:34:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10950925", "type": "PubMed"}, "ts": "2023-07-09 00:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DT37", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:35:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DT37"}, "ts": "2023-07-09 00:35:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF01", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:35:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF01"}, "ts": "2023-07-09 00:35:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23468"}, "ts": "2023-07-09 00:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23468", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54105-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:37:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54105-1"}, "ts": "2023-07-09 00:37:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62995-1"}, "ts": "2023-07-09 00:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62995-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:37:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92982"}, "ts": "2023-07-09 00:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92982", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:38:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-09 00:38:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17927", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:38:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96P67"}, "ts": "2023-07-09 00:38:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:39:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17927.317.317"}, "ts": "2023-07-09 00:39:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31123898", "type": "PubMed"}, "ts": "2023-07-09 00:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31123898", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00629"}, "ts": "2023-07-09 00:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10940905", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:40:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10940905", "type": "PubMed"}, "ts": "2023-07-09 00:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 00:40:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P54855", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 00:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54855", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 00:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25691885", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:41:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25691885", "type": "PubMed"}, "ts": "2023-07-09 00:41:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-09 00:41:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14CN4.441.441"}, "ts": "2023-07-09 00:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14CN4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:41:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G44510KF"}, "ts": "2023-07-09 00:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G44510KF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26253028", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:42:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26253028", "type": "PubMed"}, "ts": "2023-07-09 00:42:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31944"}, "ts": "2023-07-09 00:42:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31944", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:42:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06211"}, "ts": "2023-07-09 00:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:43:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P30273", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 00:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30273", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 00:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32332164", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:45:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32332164", "type": "PubMed"}, "ts": "2023-07-09 00:45:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-09 00:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67870", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:45:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P67870.82.82"}, "ts": "2023-07-09 00:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19878874", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:45:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19878874", "type": "PubMed"}, "ts": "2023-07-09 00:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05141", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:45:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05141.277.277"}, "ts": "2023-07-09 00:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57818FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:45:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-09 00:45:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DD0"}, "ts": "2023-07-09 00:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUI4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 00:46:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IUI4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 00:46:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 00:46:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUI4", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 00:46:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24347", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:47:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24347"}, "ts": "2023-07-09 00:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y277"}, "ts": "2023-07-09 00:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28622512", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:47:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28622512", "type": "PubMed"}, "ts": "2023-07-09 00:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69ZS0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:47:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69ZS0-1"}, "ts": "2023-07-09 00:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZ26", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:47:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZ26"}, "ts": "2023-07-09 00:47:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16782892", "type": "PubMed"}, "ts": "2023-07-09 00:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16782892", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:47:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KN2.312.312"}, "ts": "2023-07-09 00:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KN2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C119", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:48:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C119"}, "ts": "2023-07-09 00:48:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03135-1"}, "ts": "2023-07-09 00:48:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41438"}, "ts": "2023-07-09 00:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:48:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-09 00:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66621EA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:49:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHI5"}, "ts": "2023-07-09 00:49:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55144"}, "ts": "2023-07-09 00:49:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:49:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFN1"}, "ts": "2023-07-09 00:50:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:50:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052"}, "ts": "2023-07-09 00:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48546"}, "ts": "2023-07-09 00:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UT41"}, "ts": "2023-07-09 00:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UT41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:51:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60766"}, "ts": "2023-07-09 00:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16442"}, "ts": "2023-07-09 00:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29977911", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:53:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29977911", "type": "PubMed"}, "ts": "2023-07-09 00:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:54:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-09 00:54:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09633HU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 00:56:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09633HU"}, "ts": "2023-07-09 00:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:56:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-09 00:56:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:56:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556"}, "ts": "2023-07-09 00:56:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31170160", "type": "PubMed"}, "ts": "2023-07-09 00:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31170160", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 00:56:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43405"}, "ts": "2023-07-09 00:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:57:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VAA2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:57:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VAA2-1"}, "ts": "2023-07-09 00:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0C0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 00:57:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0C0"}, "ts": "2023-07-09 00:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27321-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:57:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27321-1"}, "ts": "2023-07-09 00:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 00:58:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Q9.1198.1198"}, "ts": "2023-07-09 00:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20594"}, "ts": "2023-07-09 00:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:58:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20594", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:58:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y572-1"}, "ts": "2023-07-09 00:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y572-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:58:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:58:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 00:58:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-09 00:59:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 00:59:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TY0"}, "ts": "2023-07-09 00:59:04 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 01:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 01:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 01:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 01:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 01:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 01:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:00:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-09 01:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53QW1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53QW1"}, "ts": "2023-07-09 01:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-09 01:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PG6"}, "ts": "2023-07-09 01:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:00:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29475", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:01:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29475.572.572"}, "ts": "2023-07-09 01:01:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35632"}, "ts": "2023-07-09 01:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWK0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:01:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VWK0.619.619"}, "ts": "2023-07-09 01:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:02:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB63"}, "ts": "2023-07-09 01:02:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2I2-3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2I2-3"}, "ts": "2023-07-09 01:02:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7F8X3"}, "ts": "2023-07-09 01:03:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7F8X3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7F8X3", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 01:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4J7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:03:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4J7-1"}, "ts": "2023-07-09 01:03:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16537381", "type": "PubMed"}, "ts": "2023-07-09 01:03:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16537381", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:03:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:03:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13361"}, "ts": "2023-07-09 01:03:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:03:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-09 01:03:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-09 01:03:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66K80"}, "ts": "2023-07-09 01:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66K80", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41438", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:04:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:04:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2G8"}, "ts": "2023-07-09 01:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:04:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53350"}, "ts": "2023-07-09 01:04:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:04:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2G8"}, "ts": "2023-07-09 01:04:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G44510KF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:05:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G44510KF"}, "ts": "2023-07-09 01:05:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O09061.208.208"}, "ts": "2023-07-09 01:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09061", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYA4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:06:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYA4"}, "ts": "2023-07-09 01:06:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35580"}, "ts": "2023-07-09 01:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35580", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:07:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWX8"}, "ts": "2023-07-09 01:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVM1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:07:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVM1-1"}, "ts": "2023-07-09 01:07:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09629"}, "ts": "2023-07-09 01:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:07:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1V8.377.377"}, "ts": "2023-07-09 01:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1V8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:08:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15022"}, "ts": "2023-07-09 01:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15022", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:08:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNK6"}, "ts": "2023-07-09 01:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000111", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 01:09:01 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000111", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 01:09:01 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000111", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 01:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 01:09:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33908"}, "ts": "2023-07-09 01:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33908", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63073", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63073"}, "ts": "2023-07-09 01:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R187"}, "ts": "2023-07-09 01:10:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R187", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:10:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:10:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47962", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47962"}, "ts": "2023-07-09 01:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61084", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:11:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61084"}, "ts": "2023-07-09 01:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6R3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:11:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6R3"}, "ts": "2023-07-09 01:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:12:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIQ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:12:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIQ2-1"}, "ts": "2023-07-09 01:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6B7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:13:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z6B7.1085.1085"}, "ts": "2023-07-09 01:13:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:13:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-09 01:13:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22888"}, "ts": "2023-07-09 01:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5UCC4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 01:14:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5UCC4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 01:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:15:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15185.118.118"}, "ts": "2023-07-09 01:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15185", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:15:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YC3"}, "ts": "2023-07-09 01:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75054", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:15:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75054.436.436"}, "ts": "2023-07-09 01:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTA9"}, "ts": "2023-07-09 01:15:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:15:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TAX3.1154.1154"}, "ts": "2023-07-09 01:15:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TAX3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:15:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IN33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:15:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:15:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IN33"}, "ts": "2023-07-09 01:15:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:16:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43808"}, "ts": "2023-07-09 01:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43808", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:17:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-09 01:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30635284", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:19:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30635284", "type": "PubMed"}, "ts": "2023-07-09 01:19:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ3"}, "ts": "2023-07-09 01:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:21:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7LFX5"}, "ts": "2023-07-09 01:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LFX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:21:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26059044", "type": "PubMed"}, "ts": "2023-07-09 01:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26059044", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:22:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62805.181.181"}, "ts": "2023-07-09 01:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62805", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:22:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08123"}, "ts": "2023-07-09 01:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08123", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:22:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:22:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6Q4G3.607.607"}, "ts": "2023-07-09 01:23:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q4G3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:23:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P542"}, "ts": "2023-07-09 01:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P542", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:23:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TAA0.244.244"}, "ts": "2023-07-09 01:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TAA0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:23:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:23:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00059"}, "ts": "2023-07-09 01:23:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6SJQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:24:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6SJQ0"}, "ts": "2023-07-09 01:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54949-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:24:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54949-1"}, "ts": "2023-07-09 01:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HDC5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:25:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HDC5-1"}, "ts": "2023-07-09 01:25:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J241"}, "ts": "2023-07-09 01:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J241", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCX3"}, "ts": "2023-07-09 01:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:25:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IE82"}, "ts": "2023-07-09 01:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IE82", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2H8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:25:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2H8"}, "ts": "2023-07-09 01:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09061", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:26:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O09061.208.208"}, "ts": "2023-07-09 01:26:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAA1"}, "ts": "2023-07-09 01:26:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:26:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62258"}, "ts": "2023-07-09 01:27:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z1X2-1.14.14"}, "ts": "2023-07-09 01:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1X2-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:27:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4F1"}, "ts": "2023-07-09 01:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4F1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11172", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:28:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11172"}, "ts": "2023-07-09 01:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U4D9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U4D9"}, "ts": "2023-07-09 01:28:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VBZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:29:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VBZ3"}, "ts": "2023-07-09 01:29:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY35", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:29:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY35.72.72"}, "ts": "2023-07-09 01:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:29:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-09 01:30:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:30:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60840"}, "ts": "2023-07-09 01:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUI4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 01:30:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IUI4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 01:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUI4", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 01:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:31:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKR0"}, "ts": "2023-07-09 01:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPJ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:31:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPJ4-1"}, "ts": "2023-07-09 01:31:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27338"}, "ts": "2023-07-09 01:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:32:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IMA7"}, "ts": "2023-07-09 01:32:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31587OK"}, "ts": "2023-07-09 01:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31587OK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IMA7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B9EKR1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:32:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B9EKR1.576.576"}, "ts": "2023-07-09 01:32:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61548-1"}, "ts": "2023-07-09 01:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61548-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:33:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15713649", "type": "PubMed"}, "ts": "2023-07-09 01:33:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15713649", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15381", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:33:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15381.594.594"}, "ts": "2023-07-09 01:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:34:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8-1"}, "ts": "2023-07-09 01:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AJ15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:34:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AJ15"}, "ts": "2023-07-09 01:34:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:34:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "29321139"}, "ts": "2023-07-09 01:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 01:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18938DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z333"}, "ts": "2023-07-09 01:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z333", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:35:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-09 01:35:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMQ3"}, "ts": "2023-07-09 01:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ45", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:35:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ45"}, "ts": "2023-07-09 01:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48436", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:36:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48436"}, "ts": "2023-07-09 01:36:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2R0"}, "ts": "2023-07-09 01:36:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2R0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8543191", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:36:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8543191", "type": "PubMed"}, "ts": "2023-07-09 01:36:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1320959", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:37:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1320959", "type": "PubMed"}, "ts": "2023-07-09 01:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:37:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59998"}, "ts": "2023-07-09 01:37:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:38:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3X1"}, "ts": "2023-07-09 01:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49257", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:38:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49257"}, "ts": "2023-07-09 01:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98168", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:38:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98168.226.226"}, "ts": "2023-07-09 01:38:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5"}, "ts": "2023-07-09 01:38:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:38:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O00590", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 01:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00590", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 01:39:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHX3"}, "ts": "2023-07-09 01:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:40:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD9"}, "ts": "2023-07-09 01:40:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-09 01:40:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29880602", "type": "PubMed"}, "ts": "2023-07-09 01:40:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29880602", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29880602", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 01:40:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02013"}, "ts": "2023-07-09 01:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94779", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:41:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94779.81.81"}, "ts": "2023-07-09 01:41:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:41:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFX2"}, "ts": "2023-07-09 01:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7V5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:41:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7V5-1"}, "ts": "2023-07-09 01:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14416", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:42:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14416"}, "ts": "2023-07-09 01:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15904", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:43:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15904.184.184"}, "ts": "2023-07-09 01:43:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15340156", "type": "PubMed"}, "ts": "2023-07-09 01:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15340156", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62879", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62879"}, "ts": "2023-07-09 01:43:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20645"}, "ts": "2023-07-09 01:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20645", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:44:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRA0"}, "ts": "2023-07-09 01:45:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:45:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20732331", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:45:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20732331", "type": "PubMed"}, "ts": "2023-07-09 01:45:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NDH6"}, "ts": "2023-07-09 01:45:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NDH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZP29"}, "ts": "2023-07-09 01:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZP29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:46:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42226.611.611"}, "ts": "2023-07-09 01:46:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27368196", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:46:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27368196", "type": "PubMed"}, "ts": "2023-07-09 01:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27368196", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 01:46:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11131"}, "ts": "2023-07-09 01:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11131", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:46:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16204.244.244"}, "ts": "2023-07-09 01:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16204", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:46:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32418.405.405"}, "ts": "2023-07-09 01:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-09 01:47:18 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 01:47:19 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-09 01:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-09 01:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2753907", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:47:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2753907", "type": "PubMed"}, "ts": "2023-07-09 01:47:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IBS0.149.149"}, "ts": "2023-07-09 01:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IBS0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07763", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:48:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07763.197.197"}, "ts": "2023-07-09 01:48:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:49:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57768"}, "ts": "2023-07-09 01:49:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38532-1"}, "ts": "2023-07-09 01:49:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38532-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ35", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:49:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQ35.971.971"}, "ts": "2023-07-09 01:49:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1701694", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:49:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1701694", "type": "PubMed"}, "ts": "2023-07-09 01:49:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7779757", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:49:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7779757", "type": "PubMed"}, "ts": "2023-07-09 01:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16204NU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZE15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:49:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16204NU"}, "ts": "2023-07-09 01:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GM8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GM8-1"}, "ts": "2023-07-09 01:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZE15"}, "ts": "2023-07-09 01:49:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75487-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 01:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33908", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33908"}, "ts": "2023-07-09 01:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 01:49:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DHY5-1"}, "ts": "2023-07-09 01:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DHY5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75487-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 01:49:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RQ9.253.253"}, "ts": "2023-07-09 01:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RQ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP73-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 01:49:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NP73-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 01:49:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U3N6-1"}, "ts": "2023-07-09 01:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U3N6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98177", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:50:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98177"}, "ts": "2023-07-09 01:50:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07113"}, "ts": "2023-07-09 01:50:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68372-1"}, "ts": "2023-07-09 01:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68372-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:50:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35385"}, "ts": "2023-07-09 01:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35385", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR73", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR73"}, "ts": "2023-07-09 01:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-09 01:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:51:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08069.1161.1161"}, "ts": "2023-07-09 01:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08069", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 01:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6WRI0"}, "ts": "2023-07-09 01:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6WRI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UNN8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:51:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UNN8"}, "ts": "2023-07-09 01:51:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12637748", "type": "PubMed"}, "ts": "2023-07-09 01:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12637748", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:52:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61543"}, "ts": "2023-07-09 01:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18172012", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 01:53:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18172012", "type": "PubMed"}, "ts": "2023-07-09 01:53:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13639"}, "ts": "2023-07-09 01:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:54:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-09 01:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64287", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64287"}, "ts": "2023-07-09 01:55:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HD20-1.1137.1137"}, "ts": "2023-07-09 01:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:55:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHQ4"}, "ts": "2023-07-09 01:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "how-to-cite", "message": "page access"}, "ts": "2023-07-09 01:55:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G52260VY"}, "ts": "2023-07-09 01:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G52260VY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 01:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R424-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:56:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R424-1"}, "ts": "2023-07-09 01:56:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:56:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6Q9"}, "ts": "2023-07-09 01:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:56:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75575"}, "ts": "2023-07-09 01:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:57:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PK04-1"}, "ts": "2023-07-09 01:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK04-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:58:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70277"}, "ts": "2023-07-09 01:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70277", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 01:58:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-09 01:58:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35627"}, "ts": "2023-07-09 01:59:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35627", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 01:59:17 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 02:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 02:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 02:00:01 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 02:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 02:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 02:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y277"}, "ts": "2023-07-09 02:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y277", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:00:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34830054", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:00:33 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 02:00:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34830054", "type": "PubMed"}, "ts": "2023-07-09 02:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 02:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 02:00:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42574"}, "ts": "2023-07-09 02:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXY0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:00:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXY0-1"}, "ts": "2023-07-09 02:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:00:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16787389", "type": "PubMed"}, "ts": "2023-07-09 02:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16787389", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:01:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35701"}, "ts": "2023-07-09 02:01:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35701", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DN25"}, "ts": "2023-07-09 02:01:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96P63"}, "ts": "2023-07-09 02:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P63", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DN25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58876"}, "ts": "2023-07-09 02:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58876", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:02:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02078"}, "ts": "2023-07-09 02:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02078", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PX95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PX95"}, "ts": "2023-07-09 02:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61147", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB30", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:03:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TB30.130.130"}, "ts": "2023-07-09 02:03:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61147.138.138"}, "ts": "2023-07-09 02:03:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23467.127.127"}, "ts": "2023-07-09 02:03:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23467", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92623"}, "ts": "2023-07-09 02:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92623", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:04:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80317"}, "ts": "2023-07-09 02:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:04:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:04:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:04:47 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 02:04:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H190", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:04:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H190"}, "ts": "2023-07-09 02:04:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98095"}, "ts": "2023-07-09 02:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:05:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2V4.321.321"}, "ts": "2023-07-09 02:05:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2V4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07113", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:06:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:06:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB6"}, "ts": "2023-07-09 02:06:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:06:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38398", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:07:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38398.782.782"}, "ts": "2023-07-09 02:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAT2"}, "ts": "2023-07-09 02:07:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:07:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PVX1-1"}, "ts": "2023-07-09 02:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PVX1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:07:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35280FV"}, "ts": "2023-07-09 02:07:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P28332", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 02:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64321", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 02:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28332", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 02:08:05 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q64321", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 02:08:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 02:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14980", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:08:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14980.556.556"}, "ts": "2023-07-09 02:08:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:09:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61793"}, "ts": "2023-07-09 02:09:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17604723", "type": "PubMed"}, "ts": "2023-07-09 02:09:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17604723", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:09:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19174.902.902"}, "ts": "2023-07-09 02:09:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45379"}, "ts": "2023-07-09 02:09:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19174", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:09:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30835", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-09 02:10:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98164"}, "ts": "2023-07-09 02:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:10:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54652-1"}, "ts": "2023-07-09 02:11:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1A5S3"}, "ts": "2023-07-09 02:11:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12778-1"}, "ts": "2023-07-09 02:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A5S3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:11:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88673AA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 02:11:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88673AA"}, "ts": "2023-07-09 02:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BG32", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:11:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BG32"}, "ts": "2023-07-09 02:11:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z1X2-1.14.14"}, "ts": "2023-07-09 02:12:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1X2-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:12:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UH17"}, "ts": "2023-07-09 02:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UH17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:13:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40225.197.197"}, "ts": "2023-07-09 02:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95972"}, "ts": "2023-07-09 02:13:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95972", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:13:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BV29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BV29"}, "ts": "2023-07-09 02:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14116"}, "ts": "2023-07-09 02:14:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:14:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "7808216"}, "ts": "2023-07-09 02:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:15:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LA5.45.45"}, "ts": "2023-07-09 02:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZQ0-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 02:16:06 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8JZQ0-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 02:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y320"}, "ts": "2023-07-09 02:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y320", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYQ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:16:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYQ5.125.125"}, "ts": "2023-07-09 02:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:16:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-09 02:16:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWB9"}, "ts": "2023-07-09 02:17:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWB9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:17:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCB6"}, "ts": "2023-07-09 02:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60603", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:17:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60603.978.978"}, "ts": "2023-07-09 02:17:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-09 02:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21359", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:18:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21359.482.482"}, "ts": "2023-07-09 02:18:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-09 02:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGZ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGZ7"}, "ts": "2023-07-09 02:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0B1"}, "ts": "2023-07-09 02:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0B1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:19:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L014", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:19:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L014.199.199"}, "ts": "2023-07-09 02:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6U841", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:19:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6U841.1085.1085"}, "ts": "2023-07-09 02:19:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19349279", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:19:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19349279", "type": "PubMed"}, "ts": "2023-07-09 02:19:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-09 02:20:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AX2"}, "ts": "2023-07-09 02:20:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8978778", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:20:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8978778", "type": "PubMed"}, "ts": "2023-07-09 02:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:20:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PFR5-1"}, "ts": "2023-07-09 02:21:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PFR5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:21:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-09 02:21:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63252"}, "ts": "2023-07-09 02:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:21:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZW4"}, "ts": "2023-07-09 02:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZW4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:21:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39900"}, "ts": "2023-07-09 02:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27540", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:22:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27540.643.643"}, "ts": "2023-07-09 02:22:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60478", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:22:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60478.263.263"}, "ts": "2023-07-09 02:22:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9624159", "type": "PubMed"}, "ts": "2023-07-09 02:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9624159", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:23:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX03"}, "ts": "2023-07-09 02:23:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0X4.116.116"}, "ts": "2023-07-09 02:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0X4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14914", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14914"}, "ts": "2023-07-09 02:24:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20701.830.830"}, "ts": "2023-07-09 02:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20701", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:25:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:25:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBS8"}, "ts": "2023-07-09 02:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:25:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-09 02:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54652-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:27:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01920", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 02:28:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01920", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 02:28:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987-1"}, "ts": "2023-07-09 02:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1H2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:28:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3T1H2"}, "ts": "2023-07-09 02:28:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63470"}, "ts": "2023-07-09 02:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63470", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13509"}, "ts": "2023-07-09 02:29:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27825172", "type": "PubMed"}, "ts": "2023-07-09 02:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27825172", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:30:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27825172", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 02:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-09 02:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:32:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TBG4"}, "ts": "2023-07-09 02:32:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95813"}, "ts": "2023-07-09 02:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:33:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90333CG"}, "ts": "2023-07-09 02:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90333CG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 02:33:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99808"}, "ts": "2023-07-09 02:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99808", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19440-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 02:33:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P19440-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 02:33:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XKD3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 02:33:36 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6XKD3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 02:33:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XKD3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 02:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:33:51 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 02:33:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:33:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 02:34:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85194VU"}, "ts": "2023-07-09 02:34:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85194VU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 02:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BY6"}, "ts": "2023-07-09 02:35:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04695"}, "ts": "2023-07-09 02:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:37:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VP6"}, "ts": "2023-07-09 02:37:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:37:22 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 02:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:38:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RR4"}, "ts": "2023-07-09 02:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13724", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:39:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13724"}, "ts": "2023-07-09 02:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00478-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:39:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00478-1"}, "ts": "2023-07-09 02:39:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6C9"}, "ts": "2023-07-09 02:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6C9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:39:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZL4"}, "ts": "2023-07-09 02:39:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TB30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:40:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TB30"}, "ts": "2023-07-09 02:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:40:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12096056", "type": "PubMed"}, "ts": "2023-07-09 02:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12096056", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:40:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16707451", "type": "PubMed"}, "ts": "2023-07-09 02:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16707451", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:42:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXH0"}, "ts": "2023-07-09 02:42:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-09 02:42:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:42:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-09 02:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75159", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75159"}, "ts": "2023-07-09 02:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:43:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKS6"}, "ts": "2023-07-09 02:43:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00966"}, "ts": "2023-07-09 02:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:44:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02543"}, "ts": "2023-07-09 02:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24821", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:44:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HD20-1.905.905"}, "ts": "2023-07-09 02:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD20-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:44:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24821.551.551"}, "ts": "2023-07-09 02:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:44:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18644862", "type": "PubMed"}, "ts": "2023-07-09 02:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18644862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95948", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95948"}, "ts": "2023-07-09 02:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23396"}, "ts": "2023-07-09 02:45:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31922199", "type": "PubMed"}, "ts": "2023-07-09 02:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31922199", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31922199", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 02:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:45:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4L180"}, "ts": "2023-07-09 02:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4L180", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:45:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60306.845.845"}, "ts": "2023-07-09 02:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60306", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-09 02:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SE7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SE7-1"}, "ts": "2023-07-09 02:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-09 02:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54785"}, "ts": "2023-07-09 02:46:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54645.360.360"}, "ts": "2023-07-09 02:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54645", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:47:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7A4"}, "ts": "2023-07-09 02:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7A4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZI8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:48:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZI8"}, "ts": "2023-07-09 02:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25092-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:48:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25092-1"}, "ts": "2023-07-09 02:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16377619", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:48:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16377619", "type": "PubMed"}, "ts": "2023-07-09 02:48:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54965"}, "ts": "2023-07-09 02:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54965", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:49:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y271", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:49:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y271"}, "ts": "2023-07-09 02:49:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UMF0.482.482"}, "ts": "2023-07-09 02:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:49:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZC3.124.124"}, "ts": "2023-07-09 02:50:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZC3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71RJ2"}, "ts": "2023-07-09 02:50:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33151"}, "ts": "2023-07-09 02:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3B2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:51:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y3B2.28.28"}, "ts": "2023-07-09 02:51:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-09 02:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:51:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17050-1"}, "ts": "2023-07-09 02:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:52:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQQ1"}, "ts": "2023-07-09 02:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7L0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:52:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13885", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:52:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13885"}, "ts": "2023-07-09 02:52:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7L0"}, "ts": "2023-07-09 02:52:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 02:54:18 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 02:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 02:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ53", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:54:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZ53.312.312"}, "ts": "2023-07-09 02:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:54:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02788"}, "ts": "2023-07-09 02:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06870", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06870"}, "ts": "2023-07-09 02:54:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15309", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:55:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15309.162.162"}, "ts": "2023-07-09 02:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05112"}, "ts": "2023-07-09 02:55:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K078"}, "ts": "2023-07-09 02:55:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K078", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:56:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12872", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:56:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12872"}, "ts": "2023-07-09 02:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8575831", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 02:56:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8575831", "type": "PubMed"}, "ts": "2023-07-09 02:56:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:56:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 02:56:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 02:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:56:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYX7"}, "ts": "2023-07-09 02:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9Y6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:57:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H9Y6"}, "ts": "2023-07-09 02:57:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0E2"}, "ts": "2023-07-09 02:57:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0E2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:57:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04900"}, "ts": "2023-07-09 02:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04900", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZN5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 02:57:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZN5"}, "ts": "2023-07-09 02:57:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5R3I4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:57:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5R3I4"}, "ts": "2023-07-09 02:57:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00888.227.227"}, "ts": "2023-07-09 02:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00888", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:58:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV9"}, "ts": "2023-07-09 02:58:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H9R7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:58:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5H9R7.427.427"}, "ts": "2023-07-09 02:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 02:59:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BTY2.334.334"}, "ts": "2023-07-09 02:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTY2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 02:59:59 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 03:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 03:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 03:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 03:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 03:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 03:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02647", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02647"}, "ts": "2023-07-09 03:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21845-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:00:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21845-1"}, "ts": "2023-07-09 03:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:00:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-09 03:00:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "B4F7A1-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 03:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B4F7A1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:00:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-09 03:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23396", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:01:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924U1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:01:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924U1"}, "ts": "2023-07-09 03:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:01:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGT4"}, "ts": "2023-07-09 03:01:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13987-1.43.43"}, "ts": "2023-07-09 03:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13987-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:02:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10070"}, "ts": "2023-07-09 03:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:02:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-09 03:02:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10749569", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:03:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10749569", "type": "PubMed"}, "ts": "2023-07-09 03:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10749569", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 03:03:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:03:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CQ7"}, "ts": "2023-07-09 03:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01522FD"}, "ts": "2023-07-09 03:03:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7574678", "type": "PubMed"}, "ts": "2023-07-09 03:03:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7574678", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:03:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06795", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:04:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06795"}, "ts": "2023-07-09 03:04:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96SR6.316.316"}, "ts": "2023-07-09 03:04:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SR6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:04:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD20-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:04:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HD20-1.905.905"}, "ts": "2023-07-09 03:04:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:04:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04230"}, "ts": "2023-07-09 03:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04230", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14656"}, "ts": "2023-07-09 03:04:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34837923", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:06:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34837923", "type": "PubMed"}, "ts": "2023-07-09 03:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34837923", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 03:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:06:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969N2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:06:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969N2-1"}, "ts": "2023-07-09 03:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:06:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NGS2"}, "ts": "2023-07-09 03:07:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NGS2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17050-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:07:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30559"}, "ts": "2023-07-09 03:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30559", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:07:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-09 03:07:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106-1"}, "ts": "2023-07-09 03:08:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-09 03:09:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15599"}, "ts": "2023-07-09 03:09:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-09 03:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:10:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16666.153.153"}, "ts": "2023-07-09 03:10:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35364"}, "ts": "2023-07-09 03:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35364", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923K1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:10:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q923K1"}, "ts": "2023-07-09 03:10:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-09 03:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:11:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13477"}, "ts": "2023-07-09 03:11:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:11:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92887", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:11:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92887.879.879"}, "ts": "2023-07-09 03:11:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXR9-1"}, "ts": "2023-07-09 03:12:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXR9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48549", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:12:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48549.458.458"}, "ts": "2023-07-09 03:12:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15040000", "type": "PubMed"}, "ts": "2023-07-09 03:12:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15040000", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-09 03:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41221"}, "ts": "2023-07-09 03:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41221", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZNW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:13:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZNW8"}, "ts": "2023-07-09 03:13:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876"}, "ts": "2023-07-09 03:14:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07307", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:15:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P07307", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 03:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:15:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-09 03:15:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00287.233.233"}, "ts": "2023-07-09 03:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZV9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:16:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZV9"}, "ts": "2023-07-09 03:16:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75914.121.121"}, "ts": "2023-07-09 03:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75914", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01098-1"}, "ts": "2023-07-09 03:16:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01098-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 03:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TA6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TA6"}, "ts": "2023-07-09 03:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:17:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10819545", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:17:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10819545", "type": "PubMed"}, "ts": "2023-07-09 03:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14168", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:17:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14168"}, "ts": "2023-07-09 03:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07861-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:17:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P07861-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 03:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:17:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20439430", "type": "PubMed"}, "ts": "2023-07-09 03:17:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQA5.358.358"}, "ts": "2023-07-09 03:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20439430", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:17:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q75NI5-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 03:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75NI5-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75NI5-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 03:17:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1505991"}, "ts": "2023-07-09 03:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 03:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:18:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQN3"}, "ts": "2023-07-09 03:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQN3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:18:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:18:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0B1"}, "ts": "2023-07-09 03:19:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7U7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:19:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N7U7.362.362"}, "ts": "2023-07-09 03:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0B1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:19:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z628"}, "ts": "2023-07-09 03:19:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XPT3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:19:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XPT3-1"}, "ts": "2023-07-09 03:19:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:19:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-09 03:19:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z628", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8F0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8F0-1"}, "ts": "2023-07-09 03:20:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:20:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GQ7"}, "ts": "2023-07-09 03:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BII1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:20:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BII1"}, "ts": "2023-07-09 03:20:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14116"}, "ts": "2023-07-09 03:20:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:20:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDV1"}, "ts": "2023-07-09 03:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDV1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:21:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NEZ2.178.178"}, "ts": "2023-07-09 03:21:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-09 03:21:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZA44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:21:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZA44"}, "ts": "2023-07-09 03:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26972003", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:21:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26972003", "type": "PubMed"}, "ts": "2023-07-09 03:21:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 03:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 03:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 03:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:22:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTL9"}, "ts": "2023-07-09 03:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 03:22:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 03:22:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 03:22:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09493"}, "ts": "2023-07-09 03:23:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:23:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PH1.137.137"}, "ts": "2023-07-09 03:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:23:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PPN0"}, "ts": "2023-07-09 03:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PPN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:24:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27496765", "type": "PubMed"}, "ts": "2023-07-09 03:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27496765", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:24:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT56"}, "ts": "2023-07-09 03:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:25:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:25:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63544.72.72"}, "ts": "2023-07-09 03:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63544", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50552", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:26:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50552.239.239"}, "ts": "2023-07-09 03:26:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13595"}, "ts": "2023-07-09 03:26:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13595", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16478", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:27:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16478"}, "ts": "2023-07-09 03:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q29980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:27:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q29980"}, "ts": "2023-07-09 03:27:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17050"}, "ts": "2023-07-09 03:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17050", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:27:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27881703", "type": "PubMed"}, "ts": "2023-07-09 03:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27881703", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27881703", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 03:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34795444", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:28:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34795444", "type": "PubMed"}, "ts": "2023-07-09 03:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35803", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:28:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35803"}, "ts": "2023-07-09 03:28:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41587"}, "ts": "2023-07-09 03:29:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:29:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:29:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JL27-1"}, "ts": "2023-07-09 03:29:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JL27-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:29:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K2H4"}, "ts": "2023-07-09 03:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K2H4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:29:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04792"}, "ts": "2023-07-09 03:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:30:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15466", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:30:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15466"}, "ts": "2023-07-09 03:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78386", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:30:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-09 03:30:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-09 03:30:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01581", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:31:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01581"}, "ts": "2023-07-09 03:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:31:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GM8"}, "ts": "2023-07-09 03:31:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-09 03:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56373", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:33:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56373.147.147"}, "ts": "2023-07-09 03:33:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1N9"}, "ts": "2023-07-09 03:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1N9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48039", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:33:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48039"}, "ts": "2023-07-09 03:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T8D3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:34:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T8D3"}, "ts": "2023-07-09 03:34:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP77"}, "ts": "2023-07-09 03:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:34:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HB29.234.234"}, "ts": "2023-07-09 03:34:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB29", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:34:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-09 03:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:34:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94907"}, "ts": "2023-07-09 03:34:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00987"}, "ts": "2023-07-09 03:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00987", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:35:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28273928", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:35:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05724UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:35:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28273928", "type": "PubMed"}, "ts": "2023-07-09 03:35:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPT8"}, "ts": "2023-07-09 03:36:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPT8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47893", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:36:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47893"}, "ts": "2023-07-09 03:36:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20962268", "type": "PubMed"}, "ts": "2023-07-09 03:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20962268", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:37:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZCM2"}, "ts": "2023-07-09 03:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZCM2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35803", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35803"}, "ts": "2023-07-09 03:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:38:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQY5"}, "ts": "2023-07-09 03:38:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14616.47.47"}, "ts": "2023-07-09 03:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14616", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:38:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YH22"}, "ts": "2023-07-09 03:38:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YH22", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:38:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBD3"}, "ts": "2023-07-09 03:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBD3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31627033", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:39:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31627033", "type": "PubMed"}, "ts": "2023-07-09 03:39:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23754376", "type": "PubMed"}, "ts": "2023-07-09 03:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23754376", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY64", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:40:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY64.397.397"}, "ts": "2023-07-09 03:40:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13987-1.43.43"}, "ts": "2023-07-09 03:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13987-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:40:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:41:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-09 03:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:41:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31994"}, "ts": "2023-07-09 03:41:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31994", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFL0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:41:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFL0.172.172"}, "ts": "2023-07-09 03:41:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T8P6"}, "ts": "2023-07-09 03:41:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T8P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:41:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07359"}, "ts": "2023-07-09 03:41:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:42:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD9"}, "ts": "2023-07-09 03:42:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY74.464.464"}, "ts": "2023-07-09 03:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23340ZN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:42:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23340ZN"}, "ts": "2023-07-09 03:42:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51553"}, "ts": "2023-07-09 03:42:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51553", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62351", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:43:32 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q62351", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 03:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34080"}, "ts": "2023-07-09 03:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:44:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17448995", "type": "PubMed"}, "ts": "2023-07-09 03:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17448995", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZS9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:44:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZS9.73.73"}, "ts": "2023-07-09 03:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20762", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:46:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20762"}, "ts": "2023-07-09 03:46:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80180SI"}, "ts": "2023-07-09 03:46:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80180SI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50281"}, "ts": "2023-07-09 03:46:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50281", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02880", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:47:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02880"}, "ts": "2023-07-09 03:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:47:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-09 03:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10144", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:47:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10144.247.247"}, "ts": "2023-07-09 03:47:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-09 03:48:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-09 03:48:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13835"}, "ts": "2023-07-09 03:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13835", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:48:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P15260-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 03:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15260-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06795", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:49:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06795"}, "ts": "2023-07-09 03:49:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCJ2"}, "ts": "2023-07-09 03:49:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCJ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:49:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JZH3-1"}, "ts": "2023-07-09 03:49:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JZH3-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M824"}, "ts": "2023-07-09 03:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M824", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:49:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6C9"}, "ts": "2023-07-09 03:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6C9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 03:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31260032", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:50:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31260032", "type": "PubMed"}, "ts": "2023-07-09 03:50:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-09 03:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:50:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7FFS7-1"}, "ts": "2023-07-09 03:51:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7FFS7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22451650", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:51:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22451650", "type": "PubMed"}, "ts": "2023-07-09 03:51:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VU36-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:52:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VU36-1"}, "ts": "2023-07-09 03:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WTS1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 03:52:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WTS1"}, "ts": "2023-07-09 03:52:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14314"}, "ts": "2023-07-09 03:53:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:53:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7859283", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:53:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7859283", "type": "PubMed"}, "ts": "2023-07-09 03:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y243", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:53:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y243.305.305"}, "ts": "2023-07-09 03:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5A9"}, "ts": "2023-07-09 03:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:53:47 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P68363", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 03:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 03:54:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-09 03:55:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75891", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:55:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75891"}, "ts": "2023-07-09 03:55:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11847227", "type": "PubMed"}, "ts": "2023-07-09 03:55:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11847227", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 03:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47872", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:57:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47872.375.375"}, "ts": "2023-07-09 03:57:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-09 03:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WGJ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 03:57:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2WGJ6"}, "ts": "2023-07-09 03:57:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P273.450.450"}, "ts": "2023-07-09 03:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P273", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 03:58:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-09 03:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 04:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 04:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 04:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1M0-1"}, "ts": "2023-07-09 04:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 04:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1M0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 04:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 04:00:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-09 04:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q45VN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q45VN2"}, "ts": "2023-07-09 04:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VEH6"}, "ts": "2023-07-09 04:00:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VEH6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-09 04:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:01:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052"}, "ts": "2023-07-09 04:01:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DP42"}, "ts": "2023-07-09 04:01:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0B0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:01:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0B0"}, "ts": "2023-07-09 04:01:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9083493"}, "ts": "2023-07-09 04:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16382"}, "ts": "2023-07-09 04:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16382", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60825", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:01:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60825"}, "ts": "2023-07-09 04:01:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27844UM"}, "ts": "2023-07-09 04:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27844UM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 04:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27226632", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:02:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27226632", "type": "PubMed"}, "ts": "2023-07-09 04:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:02:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07307"}, "ts": "2023-07-09 04:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCJ5"}, "ts": "2023-07-09 04:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G5E8A8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:02:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G5E8A8"}, "ts": "2023-07-09 04:02:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5L3-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L3-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:03:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P68403-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68403-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18583-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:03:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18583-1.1849.1849"}, "ts": "2023-07-09 04:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:04:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CQ1"}, "ts": "2023-07-09 04:04:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNL2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:04:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNL2"}, "ts": "2023-07-09 04:04:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MI9"}, "ts": "2023-07-09 04:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MI9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:04:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:04:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92610"}, "ts": "2023-07-09 04:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92610", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:04:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-09 04:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "K7N6Y3-1"}, "ts": "2023-07-09 04:05:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "K7N6Y3-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:05:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R2H5.592.592"}, "ts": "2023-07-09 04:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2H5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:05:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63326-1"}, "ts": "2023-07-09 04:05:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63326-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:06:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z5M8"}, "ts": "2023-07-09 04:06:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5M8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:06:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78406"}, "ts": "2023-07-09 04:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78406", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:06:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 04:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:06:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11583998", "type": "PubMed"}, "ts": "2023-07-09 04:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11583998", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:06:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:06:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UHH8"}, "ts": "2023-07-09 04:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYE1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:06:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYE1-1"}, "ts": "2023-07-09 04:06:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAU0-1"}, "ts": "2023-07-09 04:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAU0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:07:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48547", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:07:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48547.436.436"}, "ts": "2023-07-09 04:07:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IY85.682.682"}, "ts": "2023-07-09 04:07:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY85", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:07:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11532"}, "ts": "2023-07-09 04:07:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35173"}, "ts": "2023-07-09 04:07:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35173", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:07:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66JT1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66JT1"}, "ts": "2023-07-09 04:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVK6"}, "ts": "2023-07-09 04:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FWH7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:08:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5FWH7.322.322"}, "ts": "2023-07-09 04:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKK7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:08:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKK7"}, "ts": "2023-07-09 04:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-09 04:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:08:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A087X1C5.416.416"}, "ts": "2023-07-09 04:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087X1C5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:08:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29456", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:09:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29456"}, "ts": "2023-07-09 04:09:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:09:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60763"}, "ts": "2023-07-09 04:09:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880"}, "ts": "2023-07-09 04:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01826", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:10:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01826"}, "ts": "2023-07-09 04:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:10:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92752-1.394.394"}, "ts": "2023-07-09 04:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92752-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27923808", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:11:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27923808", "type": "PubMed"}, "ts": "2023-07-09 04:11:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-09 04:11:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:11:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TY3-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:11:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86TY3-1.242.242"}, "ts": "2023-07-09 04:11:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60452UF"}, "ts": "2023-07-09 04:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:12:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCL8-1"}, "ts": "2023-07-09 04:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCL8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:12:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-09 04:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:13:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3G5"}, "ts": "2023-07-09 04:13:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:13:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14DG7.323.323"}, "ts": "2023-07-09 04:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14DG7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15853", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:14:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15853"}, "ts": "2023-07-09 04:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WC56", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:15:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WC56"}, "ts": "2023-07-09 04:15:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYK5"}, "ts": "2023-07-09 04:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYK5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 04:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:17:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q14956", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14956", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:17:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z2D5.323.323"}, "ts": "2023-07-09 04:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2D5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00567", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:18:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00567.573.573"}, "ts": "2023-07-09 04:18:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92628.1301.1301"}, "ts": "2023-07-09 04:18:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92628", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:18:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AX2"}, "ts": "2023-07-09 04:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:19:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07358.245.245"}, "ts": "2023-07-09 04:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07358", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15338056", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:20:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15338056", "type": "PubMed"}, "ts": "2023-07-09 04:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61543"}, "ts": "2023-07-09 04:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:20:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBD1"}, "ts": "2023-07-09 04:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1310898", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:21:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1310898", "type": "PubMed"}, "ts": "2023-07-09 04:21:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYP3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:21:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYP3"}, "ts": "2023-07-09 04:21:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXH0.891.891"}, "ts": "2023-07-09 04:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXH0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60462", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:23:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60462"}, "ts": "2023-07-09 04:23:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5U2Z7.391.391"}, "ts": "2023-07-09 04:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2Z7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:24:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKX7"}, "ts": "2023-07-09 04:24:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68363", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:24:44 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P68363", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJ83-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:24:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UJ83-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:24:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9EP69-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP69-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:24:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-09 04:25:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IMI6"}, "ts": "2023-07-09 04:25:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IMI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:25:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21399-1"}, "ts": "2023-07-09 04:25:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21399-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:25:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ70", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:25:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BQ70.675.675"}, "ts": "2023-07-09 04:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15369"}, "ts": "2023-07-09 04:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:26:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92769"}, "ts": "2023-07-09 04:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:26:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60613"}, "ts": "2023-07-09 04:26:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:26:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13007"}, "ts": "2023-07-09 04:26:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32770009", "type": "PubMed"}, "ts": "2023-07-09 04:27:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32770009", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:27:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09661.116.116"}, "ts": "2023-07-09 04:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AY61", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:27:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AY61"}, "ts": "2023-07-09 04:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15187158", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:27:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15187158", "type": "PubMed"}, "ts": "2023-07-09 04:27:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9217161", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:27:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9217161", "type": "PubMed"}, "ts": "2023-07-09 04:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:28:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H082"}, "ts": "2023-07-09 04:28:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62912"}, "ts": "2023-07-09 04:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62912", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29975-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29975-1"}, "ts": "2023-07-09 04:29:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13506"}, "ts": "2023-07-09 04:30:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13506", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:30:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20921225", "type": "PubMed"}, "ts": "2023-07-09 04:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20921225", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 04:30:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53801"}, "ts": "2023-07-09 04:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53801", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:30:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1291713", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:30:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1291713", "type": "PubMed"}, "ts": "2023-07-09 04:30:58 EDT-0400"}, {"api": "/data/section_download/", "req": {"id": "O60462", "download_type": "protein_section", "section": "glycosylation_reported_with_glycans", "format": "csv", "compressed": false}, "ts": "2023-07-09 04:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60462", "user": "Undecided", "type": "user", "page": "protein", "message": "csv"}, "ts": "2023-07-09 04:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:32:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y6Q9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:32:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3035575", "type": "PubMed"}, "ts": "2023-07-09 04:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3035575", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGP2-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:32:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGP2-1"}, "ts": "2023-07-09 04:32:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13511DV"}, "ts": "2023-07-09 04:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30999-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:33:14 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P30999-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:33:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02641-1"}, "ts": "2023-07-09 04:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02641-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:33:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:33:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10.1038/emboj.2013.79", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:33:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10.1038/emboj.2013.79", "type": "DOI"}, "ts": "2023-07-09 04:33:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X52-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X52-1"}, "ts": "2023-07-09 04:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96011", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:34:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96011"}, "ts": "2023-07-09 04:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G97345NY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 04:34:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-09 04:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6M0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:34:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6M0"}, "ts": "2023-07-09 04:34:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QE2"}, "ts": "2023-07-09 04:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QE2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75V66"}, "ts": "2023-07-09 04:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75V66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:36:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09922"}, "ts": "2023-07-09 04:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09922", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35544", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:37:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35544"}, "ts": "2023-07-09 04:37:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q612-1"}, "ts": "2023-07-09 04:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q612-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:37:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:37:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXZ2"}, "ts": "2023-07-09 04:38:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00501-1"}, "ts": "2023-07-09 04:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00501-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:38:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y613.573.573"}, "ts": "2023-07-09 04:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y613", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43489", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:38:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43489"}, "ts": "2023-07-09 04:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15848", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:39:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15848"}, "ts": "2023-07-09 04:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:40:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98164"}, "ts": "2023-07-09 04:40:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25704764", "type": "PubMed"}, "ts": "2023-07-09 04:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25704764", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25704764", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 04:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:42:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32519.432.432"}, "ts": "2023-07-09 04:42:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32519", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A571BDE3-1"}, "ts": "2023-07-09 04:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A571BDE3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TCZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:43:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TCZ1"}, "ts": "2023-07-09 04:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P209", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P209"}, "ts": "2023-07-09 04:43:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02985.185.185"}, "ts": "2023-07-09 04:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02985", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 04:44:52 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 04:44:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 04:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75829", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:45:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75829"}, "ts": "2023-07-09 04:45:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16382"}, "ts": "2023-07-09 04:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16382", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9639672", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:45:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9639672", "type": "PubMed"}, "ts": "2023-07-09 04:45:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14429"}, "ts": "2023-07-09 04:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B4F7A1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:46:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "B4F7A1-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75NI5-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:46:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q75NI5-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75NI5-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 04:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z324", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:46:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z324"}, "ts": "2023-07-09 04:46:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62246-1"}, "ts": "2023-07-09 04:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62246-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:47:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P0W2.89.89"}, "ts": "2023-07-09 04:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0W2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:47:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23103944", "type": "PubMed"}, "ts": "2023-07-09 04:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23103944", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:47:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T8P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:49:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T8P6"}, "ts": "2023-07-09 04:49:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:49:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61916"}, "ts": "2023-07-09 04:49:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:49:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-09 04:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:49:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35144"}, "ts": "2023-07-09 04:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22727"}, "ts": "2023-07-09 04:49:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:49:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55142"}, "ts": "2023-07-09 04:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UW1"}, "ts": "2023-07-09 04:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C2W1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:50:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C2W1"}, "ts": "2023-07-09 04:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMI0"}, "ts": "2023-07-09 04:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8124718", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 04:51:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8124718", "type": "PubMed"}, "ts": "2023-07-09 04:51:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97798.1433.1433"}, "ts": "2023-07-09 04:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97798", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43245", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:51:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43245"}, "ts": "2023-07-09 04:51:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13247-1"}, "ts": "2023-07-09 04:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13247-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:52:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:52:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94913"}, "ts": "2023-07-09 04:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY33-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:53:38 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9QY33-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20171", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:53:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20171"}, "ts": "2023-07-09 04:53:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DJJ3.78.78"}, "ts": "2023-07-09 04:53:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DJJ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22768VO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 04:54:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-09 04:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:54:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y543"}, "ts": "2023-07-09 04:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP69-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 04:54:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9EP69-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 04:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y223", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 04:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y223"}, "ts": "2023-07-09 04:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70355", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:55:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38435"}, "ts": "2023-07-09 04:55:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70355"}, "ts": "2023-07-09 04:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38435", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:55:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:55:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDX9"}, "ts": "2023-07-09 04:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:55:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:56:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98172"}, "ts": "2023-07-09 04:56:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98172", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:56:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02774"}, "ts": "2023-07-09 04:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02774", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TY3-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:56:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86TY3-1.242.242"}, "ts": "2023-07-09 04:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:57:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53671"}, "ts": "2023-07-09 04:57:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXP5.357.357"}, "ts": "2023-07-09 04:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 04:57:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34447YB"}, "ts": "2023-07-09 04:57:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53675"}, "ts": "2023-07-09 04:58:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53675", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:59:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-09 04:59:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 04:59:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV92"}, "ts": "2023-07-09 04:59:33 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 05:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 05:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 05:00:03 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 05:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 05:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 05:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULJ3"}, "ts": "2023-07-09 05:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2B4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:01:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2B4.278.278"}, "ts": "2023-07-09 05:01:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PE3"}, "ts": "2023-07-09 05:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:01:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16882"}, "ts": "2023-07-09 05:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16882", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:01:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZW4"}, "ts": "2023-07-09 05:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:01:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R3S3"}, "ts": "2023-07-09 05:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R3S3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:01:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P80303.172.172"}, "ts": "2023-07-09 05:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80303", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-09 05:02:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-09 05:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G54255OI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:02:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G54255OI"}, "ts": "2023-07-09 05:02:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-09 05:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29276", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:02:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01730"}, "ts": "2023-07-09 05:02:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29276"}, "ts": "2023-07-09 05:03:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89090", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:03:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O89090.493.493"}, "ts": "2023-07-09 05:03:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:03:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-09 05:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15041", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:05:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15041"}, "ts": "2023-07-09 05:05:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-09 05:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:05:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-09 05:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09493", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:06:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09493"}, "ts": "2023-07-09 05:06:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DC23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DC23"}, "ts": "2023-07-09 05:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95918", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:06:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95918"}, "ts": "2023-07-09 05:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFQ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:06:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFQ6.355.355"}, "ts": "2023-07-09 05:06:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:06:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95264"}, "ts": "2023-07-09 05:06:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80X19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:08:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80X19"}, "ts": "2023-07-09 05:08:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43034", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:08:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43034"}, "ts": "2023-07-09 05:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C8E4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:09:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C8E4-1"}, "ts": "2023-07-09 05:09:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:09:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z602"}, "ts": "2023-07-09 05:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:09:10 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5NCP0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 05:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5NCP0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 05:09:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A577"}, "ts": "2023-07-09 05:09:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QE2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:09:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QE2"}, "ts": "2023-07-09 05:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A577", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP6"}, "ts": "2023-07-09 05:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7J8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:10:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7J8"}, "ts": "2023-07-09 05:10:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1F6-1"}, "ts": "2023-07-09 05:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1F6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:11:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8912629", "type": "PubMed"}, "ts": "2023-07-09 05:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8912629", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F6VAN0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:11:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "F6VAN0.570.570"}, "ts": "2023-07-09 05:11:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68BL8.488.488"}, "ts": "2023-07-09 05:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68BL8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:12:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60882"}, "ts": "2023-07-09 05:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 05:12:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14869"}, "ts": "2023-07-09 05:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14869", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVM4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:12:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVM4-1"}, "ts": "2023-07-09 05:12:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31310", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:12:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31310"}, "ts": "2023-07-09 05:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:12:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYA6"}, "ts": "2023-07-09 05:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95677", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:13:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95677.327.327"}, "ts": "2023-07-09 05:13:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DF8"}, "ts": "2023-07-09 05:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DF8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:14:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92752", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:14:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92752.236.236"}, "ts": "2023-07-09 05:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25490"}, "ts": "2023-07-09 05:14:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28476"}, "ts": "2023-07-09 05:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28476", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:15:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY5"}, "ts": "2023-07-09 05:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-09 05:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30623799", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:15:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30623799", "type": "PubMed"}, "ts": "2023-07-09 05:15:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 05:15:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30550-1"}, "ts": "2023-07-09 05:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30550-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:17:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYQ8.996.996"}, "ts": "2023-07-09 05:17:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44510KF"}, "ts": "2023-07-09 05:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91023GB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:18:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-09 05:18:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:18:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80610PK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:18:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80610PK"}, "ts": "2023-07-09 05:18:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "12676087"}, "ts": "2023-07-09 05:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 05:18:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35813-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:18:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35813-1"}, "ts": "2023-07-09 05:18:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27512"}, "ts": "2023-07-09 05:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27512", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NX49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:19:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NX49"}, "ts": "2023-07-09 05:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:19:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WY21", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:19:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WY21.536.536"}, "ts": "2023-07-09 05:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B4F779", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:19:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B4F779"}, "ts": "2023-07-09 05:19:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08551.520.520"}, "ts": "2023-07-09 05:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08551", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:19:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08501"}, "ts": "2023-07-09 05:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:20:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15297"}, "ts": "2023-07-09 05:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15297", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:20:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HD20-1.946.946"}, "ts": "2023-07-09 05:20:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-09 05:21:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86VZ1.289.289"}, "ts": "2023-07-09 05:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VZ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:22:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-09 05:22:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB89"}, "ts": "2023-07-09 05:22:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:22:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92685-1"}, "ts": "2023-07-09 05:22:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92685-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:22:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z218.112.112"}, "ts": "2023-07-09 05:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z218", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:23:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60660BN"}, "ts": "2023-07-09 05:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHH8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95674", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:23:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95674.117.117"}, "ts": "2023-07-09 05:23:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHH8"}, "ts": "2023-07-09 05:23:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19577LJ"}, "ts": "2023-07-09 05:24:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20335448", "type": "PubMed"}, "ts": "2023-07-09 05:24:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20335448", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:24:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25106"}, "ts": "2023-07-09 05:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25106", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:24:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22223"}, "ts": "2023-07-09 05:25:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q640L3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:25:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q640L3-1"}, "ts": "2023-07-09 05:25:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21252287", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:26:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21252287", "type": "PubMed"}, "ts": "2023-07-09 05:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14776", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:26:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14776.11.11"}, "ts": "2023-07-09 05:26:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESW4-1"}, "ts": "2023-07-09 05:26:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESW4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29317", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:26:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29317.24.24"}, "ts": "2023-07-09 05:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:26:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0G8"}, "ts": "2023-07-09 05:26:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULL0"}, "ts": "2023-07-09 05:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12231510", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:26:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12231510", "type": "PubMed"}, "ts": "2023-07-09 05:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ13", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:27:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ13"}, "ts": "2023-07-09 05:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2C2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:27:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2C2"}, "ts": "2023-07-09 05:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34520490", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:27:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34520490", "type": "PubMed"}, "ts": "2023-07-09 05:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34520490", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 05:27:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60882", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:28:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07759-1"}, "ts": "2023-07-09 05:28:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515"}, "ts": "2023-07-09 05:28:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:29:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32745"}, "ts": "2023-07-09 05:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32745", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:29:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VT25"}, "ts": "2023-07-09 05:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VT25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XHY7-1"}, "ts": "2023-07-09 05:30:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XHY7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:30:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:30:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94880"}, "ts": "2023-07-09 05:30:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:30:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTX7"}, "ts": "2023-07-09 05:30:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:30:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCD5"}, "ts": "2023-07-09 05:30:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8978608", "type": "PubMed"}, "ts": "2023-07-09 05:30:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8978608", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:30:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:30:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42731RJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:30:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42731RJ"}, "ts": "2023-07-09 05:30:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0B0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:31:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0B0"}, "ts": "2023-07-09 05:31:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43246"}, "ts": "2023-07-09 05:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43246", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:32:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59998"}, "ts": "2023-07-09 05:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:32:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB8"}, "ts": "2023-07-09 05:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:32:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16179260", "type": "PubMed"}, "ts": "2023-07-09 05:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16179260", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:33:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24899140", "type": "PubMed"}, "ts": "2023-07-09 05:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24899140", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:33:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9811831", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:33:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9811831", "type": "PubMed"}, "ts": "2023-07-09 05:33:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13053"}, "ts": "2023-07-09 05:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13053", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:34:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL54"}, "ts": "2023-07-09 05:34:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:34:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:34:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12396GB"}, "ts": "2023-07-09 05:34:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-09 05:34:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-09 05:34:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-09 05:34:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16774YZ"}, "ts": "2023-07-09 05:34:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-09 05:35:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24432GW"}, "ts": "2023-07-09 05:35:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42686NQ"}, "ts": "2023-07-09 05:35:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-09 05:35:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-09 05:35:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-09 05:35:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16150CJ"}, "ts": "2023-07-09 05:35:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38022PE"}, "ts": "2023-07-09 05:35:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-09 05:35:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-09 05:35:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-09 05:35:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X76", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:36:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X76.47.47"}, "ts": "2023-07-09 05:36:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15043"}, "ts": "2023-07-09 05:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15043", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:37:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "21300897"}, "ts": "2023-07-09 05:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:37:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JHP7.152.152"}, "ts": "2023-07-09 05:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHP7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-09 05:39:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-settings", "message": "page access"}, "ts": "2023-07-09 05:39:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:39:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5G3.296.296"}, "ts": "2023-07-09 05:39:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19577LJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:40:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBD5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:40:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBD5-1"}, "ts": "2023-07-09 05:40:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97527", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:40:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97527.816.816"}, "ts": "2023-07-09 05:40:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-09 05:40:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1694218", "type": "PubMed"}, "ts": "2023-07-09 05:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1694218", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1694218", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 05:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ84"}, "ts": "2023-07-09 05:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03956-1"}, "ts": "2023-07-09 05:41:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03956-1"}, "ts": "2023-07-09 05:41:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:42:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15327282", "type": "PubMed"}, "ts": "2023-07-09 05:42:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15327282", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHD9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:43:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHD9.112.112"}, "ts": "2023-07-09 05:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07759-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:45:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25905573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:45:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25905573", "type": "PubMed"}, "ts": "2023-07-09 05:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34427588", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:45:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34427588", "type": "PubMed"}, "ts": "2023-07-09 05:45:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ARV4"}, "ts": "2023-07-09 05:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ARV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:46:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0B6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:46:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0B6.445.445"}, "ts": "2023-07-09 05:46:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35144.366.366"}, "ts": "2023-07-09 05:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35144", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QNW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:47:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P57096-1", "cluster_type": "unselected"}, "ts": "2023-07-09 05:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57096-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 05:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57096-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 05:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:47:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56400"}, "ts": "2023-07-09 05:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56400", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:47:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15121"}, "ts": "2023-07-09 05:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXQ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:47:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXQ4"}, "ts": "2023-07-09 05:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:48:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02545.91.91"}, "ts": "2023-07-09 05:48:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02545", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:48:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBS9"}, "ts": "2023-07-09 05:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBS9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:48:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:48:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49913"}, "ts": "2023-07-09 05:48:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-09 05:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G97345NY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:49:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:49:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCJ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:49:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCJ0.415.415"}, "ts": "2023-07-09 05:49:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49321", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49321"}, "ts": "2023-07-09 05:49:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZM5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:50:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZM5"}, "ts": "2023-07-09 05:50:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:50:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-09 05:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:50:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNA0"}, "ts": "2023-07-09 05:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16695"}, "ts": "2023-07-09 05:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16695", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:51:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12830"}, "ts": "2023-07-09 05:51:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92956-1"}, "ts": "2023-07-09 05:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92956-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22002", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:52:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22002"}, "ts": "2023-07-09 05:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04233-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04233-1"}, "ts": "2023-07-09 05:52:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13308", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:52:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13308.216.216"}, "ts": "2023-07-09 05:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:52:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38919"}, "ts": "2023-07-09 05:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZNE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:52:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZNE7"}, "ts": "2023-07-09 05:52:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00144"}, "ts": "2023-07-09 05:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14793"}, "ts": "2023-07-09 05:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:53:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06186NU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:53:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06186NU"}, "ts": "2023-07-09 05:53:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:53:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35462.173.173"}, "ts": "2023-07-09 05:53:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41181.259.259"}, "ts": "2023-07-09 05:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41181", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:53:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-09 05:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:53:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731"}, "ts": "2023-07-09 05:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NM28", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:53:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NM28.212.212"}, "ts": "2023-07-09 05:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:53:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "14623098"}, "ts": "2023-07-09 05:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0P6D2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:54:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0P6D2"}, "ts": "2023-07-09 05:54:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5NCP0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 05:54:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5NCP0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 05:54:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJ12"}, "ts": "2023-07-09 05:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJ12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:55:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:55:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPZ2"}, "ts": "2023-07-09 05:55:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18258917", "type": "PubMed"}, "ts": "2023-07-09 05:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18258917", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12501214", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:55:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12501214", "type": "PubMed"}, "ts": "2023-07-09 05:55:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-09 05:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2BI93", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:56:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2BI93"}, "ts": "2023-07-09 05:56:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6X3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:56:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6X3.15.15"}, "ts": "2023-07-09 05:56:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45452"}, "ts": "2023-07-09 05:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A571BD55-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:56:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A571BD55-1"}, "ts": "2023-07-09 05:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94779", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:57:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94779.1003.1003"}, "ts": "2023-07-09 05:57:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 05:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GX5"}, "ts": "2023-07-09 05:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:57:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75592"}, "ts": "2023-07-09 05:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75592", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03956-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03956-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 05:57:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15198VK"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02628JF"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38349VC"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36221RT"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48381WH"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56284ZY"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52880ZN"}, "ts": "2023-07-09 05:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58268WC"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64706DG"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50757KG"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70418MS"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72667IM"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76012OT"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76136FD"}, "ts": "2023-07-09 05:58:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JM00"}, "ts": "2023-07-09 05:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JM00", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 05:58:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19965672", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 05:59:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19965672", "type": "PubMed"}, "ts": "2023-07-09 05:59:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13542.37.37"}, "ts": "2023-07-09 05:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13542", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 05:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 06:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 06:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 06:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 06:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 06:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23978"}, "ts": "2023-07-09 06:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 06:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23978", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "659613", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:00:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "659613", "type": "PubMed"}, "ts": "2023-07-09 06:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:01:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52793"}, "ts": "2023-07-09 06:01:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TR76"}, "ts": "2023-07-09 06:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TR76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18507"}, "ts": "2023-07-09 06:01:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:01:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13813.1041.1041"}, "ts": "2023-07-09 06:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13813", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89020", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:02:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O89020"}, "ts": "2023-07-09 06:02:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHJ9"}, "ts": "2023-07-09 06:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:02:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35626"}, "ts": "2023-07-09 06:02:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15488CF"}, "ts": "2023-07-09 06:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14843", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:03:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14843.46.46"}, "ts": "2023-07-09 06:03:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:04:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14766.347.347"}, "ts": "2023-07-09 06:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10066-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:04:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10066-1"}, "ts": "2023-07-09 06:04:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23916625", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:04:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23916625", "type": "PubMed"}, "ts": "2023-07-09 06:04:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62316-1"}, "ts": "2023-07-09 06:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62316-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:04:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P63261.278.278"}, "ts": "2023-07-09 06:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63261", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:05:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21620YQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 06:05:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21620YQ"}, "ts": "2023-07-09 06:05:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3UHJ0-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 06:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UHJ0-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31997489", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:05:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31997489", "type": "PubMed"}, "ts": "2023-07-09 06:05:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-09 06:06:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUH8"}, "ts": "2023-07-09 06:06:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:06:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-09 06:06:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11392CL"}, "ts": "2023-07-09 06:06:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11392CL"}, "ts": "2023-07-09 06:06:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34023356", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:07:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34023356", "type": "PubMed"}, "ts": "2023-07-09 06:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34023356", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 06:07:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "F6VAN0.570.570"}, "ts": "2023-07-09 06:08:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F6VAN0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:08:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A500"}, "ts": "2023-07-09 06:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A500", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3SXZ3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:09:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3SXZ3"}, "ts": "2023-07-09 06:09:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19731XS"}, "ts": "2023-07-09 06:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19731XS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 06:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:09:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VZ1"}, "ts": "2023-07-09 06:09:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:11:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBM4"}, "ts": "2023-07-09 06:11:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC35"}, "ts": "2023-07-09 06:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE79", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:11:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NE79.30.30"}, "ts": "2023-07-09 06:11:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X5"}, "ts": "2023-07-09 06:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:12:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-09 06:12:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O89017"}, "ts": "2023-07-09 06:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89017", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:12:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:12:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26896299", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:14:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26896299", "type": "PubMed"}, "ts": "2023-07-09 06:14:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 06:14:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 06:14:45 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 06:14:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28070.55.55"}, "ts": "2023-07-09 06:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28070", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBJ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:15:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBJ2.310.310"}, "ts": "2023-07-09 06:15:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35433", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35433"}, "ts": "2023-07-09 06:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22058212", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:16:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22058212", "type": "PubMed"}, "ts": "2023-07-09 06:16:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXI9-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:16:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6UXI9-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 06:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:16:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6M4"}, "ts": "2023-07-09 06:16:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P57096-1", "cluster_type": "unselected"}, "ts": "2023-07-09 06:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57096-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57096-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 06:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:17:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22061"}, "ts": "2023-07-09 06:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35243", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:17:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35243"}, "ts": "2023-07-09 06:17:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09629.110.110"}, "ts": "2023-07-09 06:17:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09629", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95295", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:17:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95295"}, "ts": "2023-07-09 06:17:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTU3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:17:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTU3"}, "ts": "2023-07-09 06:17:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BKK5"}, "ts": "2023-07-09 06:18:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BKK5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:19:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYQ7"}, "ts": "2023-07-09 06:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0U6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0U6"}, "ts": "2023-07-09 06:19:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIQ6.850.850"}, "ts": "2023-07-09 06:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIQ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:19:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880.113.113"}, "ts": "2023-07-09 06:19:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37136", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:20:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P37136.495.495"}, "ts": "2023-07-09 06:20:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JH7"}, "ts": "2023-07-09 06:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14543-1"}, "ts": "2023-07-09 06:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24499735", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:21:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24499735", "type": "PubMed"}, "ts": "2023-07-09 06:21:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6M1.162.162"}, "ts": "2023-07-09 06:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ERU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:21:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ERU3"}, "ts": "2023-07-09 06:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:21:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q7TSH8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 06:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSH8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:22:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18564.419.419"}, "ts": "2023-07-09 06:22:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11279-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 06:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11392CL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 06:22:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11392CL"}, "ts": "2023-07-09 06:22:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-09 06:22:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83555HU"}, "ts": "2023-07-09 06:22:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01924ZE"}, "ts": "2023-07-09 06:22:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27658AJ"}, "ts": "2023-07-09 06:22:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42553JB"}, "ts": "2023-07-09 06:23:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16352"}, "ts": "2023-07-09 06:24:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:24:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32751111", "type": "PubMed"}, "ts": "2023-07-09 06:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32751111", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:24:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14921"}, "ts": "2023-07-09 06:25:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11555652", "type": "PubMed"}, "ts": "2023-07-09 06:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11555652", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:25:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19263524", "type": "PubMed"}, "ts": "2023-07-09 06:26:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19263524", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:26:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYQ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:27:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WYQ5.267.267"}, "ts": "2023-07-09 06:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18094055", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:27:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18094055", "type": "PubMed"}, "ts": "2023-07-09 06:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWY4"}, "ts": "2023-07-09 06:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:27:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33655331", "type": "PubMed"}, "ts": "2023-07-09 06:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33655331", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:27:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQH7-1"}, "ts": "2023-07-09 06:27:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-09 06:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQH7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11466314", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:27:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11466314", "type": "PubMed"}, "ts": "2023-07-09 06:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33655331", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 06:27:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14185"}, "ts": "2023-07-09 06:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14185", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:27:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 06:28:02 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 06:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 06:28:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU6"}, "ts": "2023-07-09 06:28:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:28:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M853"}, "ts": "2023-07-09 06:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M853", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UEW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:29:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UEW3"}, "ts": "2023-07-09 06:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK59", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:29:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UK59.540.540"}, "ts": "2023-07-09 06:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JUK3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:30:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JUK3.137.137"}, "ts": "2023-07-09 06:30:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V096"}, "ts": "2023-07-09 06:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V096", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2J0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:30:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2J0"}, "ts": "2023-07-09 06:30:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81605", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:31:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P81605.26.26"}, "ts": "2023-07-09 06:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W4"}, "ts": "2023-07-09 06:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38159", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:31:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38159.1.1"}, "ts": "2023-07-09 06:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BIS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:31:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BIS8"}, "ts": "2023-07-09 06:31:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16220"}, "ts": "2023-07-09 06:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJW2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:32:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJW2.177.177"}, "ts": "2023-07-09 06:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:33:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921I1"}, "ts": "2023-07-09 06:33:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05026"}, "ts": "2023-07-09 06:34:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-09 06:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R72", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:35:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96R72", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 06:35:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R72", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 06:35:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15553.377.377"}, "ts": "2023-07-09 06:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15553", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56524-1"}, "ts": "2023-07-09 06:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:36:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB6"}, "ts": "2023-07-09 06:36:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14543-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22105", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:36:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22105.47.47"}, "ts": "2023-07-09 06:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29017"}, "ts": "2023-07-09 06:36:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29017", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07895-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:36:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07895-1"}, "ts": "2023-07-09 06:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q569E7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q569E7"}, "ts": "2023-07-09 06:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV35"}, "ts": "2023-07-09 06:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18564", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:38:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09328"}, "ts": "2023-07-09 06:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09328", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:38:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-09 06:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIK4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:39:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIK4.299.299"}, "ts": "2023-07-09 06:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42553JB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 06:39:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27496765", "type": "PubMed"}, "ts": "2023-07-09 06:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27496765", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:39:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61087"}, "ts": "2023-07-09 06:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61087", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28358", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:40:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28358"}, "ts": "2023-07-09 06:40:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TRV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:40:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TRV8"}, "ts": "2023-07-09 06:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97678", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:40:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97678.142.142"}, "ts": "2023-07-09 06:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04899"}, "ts": "2023-07-09 06:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04899", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:41:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50235"}, "ts": "2023-07-09 06:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZQ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:42:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZQ9"}, "ts": "2023-07-09 06:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12941847", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:42:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12941847", "type": "PubMed"}, "ts": "2023-07-09 06:42:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15031.1002.1002"}, "ts": "2023-07-09 06:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15031", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:43:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61581"}, "ts": "2023-07-09 06:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:43:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-09 06:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H342"}, "ts": "2023-07-09 06:44:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPX3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:45:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BPX3.631.631"}, "ts": "2023-07-09 06:45:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15057.581.581"}, "ts": "2023-07-09 06:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15057", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:46:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CQ7"}, "ts": "2023-07-09 06:46:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88689.442.442"}, "ts": "2023-07-09 06:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88689", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:46:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55058.245.245"}, "ts": "2023-07-09 06:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55058", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14597179", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:46:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14597179", "type": "PubMed"}, "ts": "2023-07-09 06:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BS26", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:46:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BS26"}, "ts": "2023-07-09 06:46:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95428.872.872"}, "ts": "2023-07-09 06:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95428", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VY9-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:47:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q86VY9-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 06:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VY9-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 06:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30413613", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:47:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30413613", "type": "PubMed"}, "ts": "2023-07-09 06:47:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17184233", "type": "PubMed"}, "ts": "2023-07-09 06:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:47:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20827"}, "ts": "2023-07-09 06:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:47:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYQ8.996.996"}, "ts": "2023-07-09 06:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVN8"}, "ts": "2023-07-09 06:47:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02402FF"}, "ts": "2023-07-09 06:47:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-09 06:47:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-09 06:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:47:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-09 06:47:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66538GV"}, "ts": "2023-07-09 06:47:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70220"}, "ts": "2023-07-09 06:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17184233", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:48:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06330RB"}, "ts": "2023-07-09 06:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV29", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV29"}, "ts": "2023-07-09 06:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23992033", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:48:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23992033", "type": "PubMed"}, "ts": "2023-07-09 06:48:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72344YZ"}, "ts": "2023-07-09 06:48:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72344YZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 06:48:23 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 06:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 06:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 06:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:49:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHC0"}, "ts": "2023-07-09 06:49:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9039917", "type": "PubMed"}, "ts": "2023-07-09 06:49:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9039917", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:49:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-09 06:49:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:50:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-09 06:50:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41242-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:50:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P41242-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 06:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38532-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:50:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38532-1"}, "ts": "2023-07-09 06:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:50:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KX2"}, "ts": "2023-07-09 06:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 06:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 06:50:24 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 06:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05026", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14896"}, "ts": "2023-07-09 06:50:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 06:50:38 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "Homo sapiens", "term_category": "any"}, "ts": "2023-07-09 06:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">65f46a3d64d171681bb858d68a23ea0c", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"Homo sapiens\",\"term_category\":\"any\"}"}, "ts": "2023-07-09 06:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "65f46a3d64d171681bb858d68a23ea0c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 06:50:39 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "65f46a3d64d171681bb858d68a23ea0c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 06:50:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-09 06:50:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-09 06:50:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63889NK"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91365ZQ"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-09 06:50:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:51:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15652.1457.1457"}, "ts": "2023-07-09 06:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15652", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "65f46a3d64d171681bb858d68a23ea0c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 06:51:29 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "65f46a3d64d171681bb858d68a23ea0c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 06:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56524-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:52:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XR8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XR8-1"}, "ts": "2023-07-09 06:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 06:52:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-09 06:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01543", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:52:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01543.15.15"}, "ts": "2023-07-09 06:52:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-09 06:52:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-09 06:52:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-09 06:52:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-09 06:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6X632", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6X632"}, "ts": "2023-07-09 06:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:53:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZY6"}, "ts": "2023-07-09 06:53:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12183458", "type": "PubMed"}, "ts": "2023-07-09 06:53:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12183458", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "65f46a3d64d171681bb858d68a23ea0c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 06:54:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "65f46a3d64d171681bb858d68a23ea0c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 06:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 06:54:09 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 06:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:54:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-09 06:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:54:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-09 06:54:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EB1"}, "ts": "2023-07-09 06:54:43 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-09 06:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-09 06:54:47 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 06:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:54:47 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 06:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 06:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:55:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L591.124.124"}, "ts": "2023-07-09 06:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L591", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 06:55:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5L0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 06:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68104", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:56:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P68104.191.191"}, "ts": "2023-07-09 06:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZMU8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:56:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZMU8"}, "ts": "2023-07-09 06:56:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYX8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 06:56:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYX8"}, "ts": "2023-07-09 06:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:57:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WUM9.460.460"}, "ts": "2023-07-09 06:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-09 06:58:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16895553", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 06:58:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16895553", "type": "PubMed"}, "ts": "2023-07-09 06:58:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2F1-1"}, "ts": "2023-07-09 06:58:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2F1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61967", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:58:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61967"}, "ts": "2023-07-09 06:58:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00401", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 06:59:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00401.250.250"}, "ts": "2023-07-09 06:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:59:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:59:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-09 06:59:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:59:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JK41"}, "ts": "2023-07-09 06:59:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZC7"}, "ts": "2023-07-09 06:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 06:59:52 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 07:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 07:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 07:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 07:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 07:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 07:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43240"}, "ts": "2023-07-09 07:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-09 07:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZC82-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:02:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZC82-1"}, "ts": "2023-07-09 07:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JB8"}, "ts": "2023-07-09 07:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31933128", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:02:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CGZ2"}, "ts": "2023-07-09 07:02:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31933128", "type": "PubMed"}, "ts": "2023-07-09 07:02:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CGZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:02:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-09 07:02:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53041", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53041"}, "ts": "2023-07-09 07:03:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10632-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:05:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10632-1"}, "ts": "2023-07-09 07:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYX4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:05:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYX4-1"}, "ts": "2023-07-09 07:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:05:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49789"}, "ts": "2023-07-09 07:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTH9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:06:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JTH9"}, "ts": "2023-07-09 07:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NJZ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:06:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NJZ7.667.667"}, "ts": "2023-07-09 07:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97792"}, "ts": "2023-07-09 07:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35268"}, "ts": "2023-07-09 07:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35268", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:07:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00176HZ"}, "ts": "2023-07-09 07:07:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70239", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:10:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70239"}, "ts": "2023-07-09 07:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:10:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LX8"}, "ts": "2023-07-09 07:10:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIK5"}, "ts": "2023-07-09 07:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:11:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12933"}, "ts": "2023-07-09 07:11:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43252"}, "ts": "2023-07-09 07:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17785674", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:11:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17785674", "type": "PubMed"}, "ts": "2023-07-09 07:11:34 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O35099-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 07:12:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35099-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 07:12:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14882EB"}, "ts": "2023-07-09 07:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:13:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05783"}, "ts": "2023-07-09 07:13:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05783", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:13:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:14:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18847"}, "ts": "2023-07-09 07:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RTX5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:14:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2RTX5.562.562"}, "ts": "2023-07-09 07:14:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:14:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50616"}, "ts": "2023-07-09 07:14:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50616", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:15:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25233"}, "ts": "2023-07-09 07:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25233", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFN8"}, "ts": "2023-07-09 07:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:15:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12909012", "type": "PubMed"}, "ts": "2023-07-09 07:16:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12909012", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:16:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02818", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:16:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02818"}, "ts": "2023-07-09 07:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 07:16:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5JWF2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 07:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H825", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 07:16:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H825", "cluster_type": "unselected"}, "ts": "2023-07-09 07:16:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:16:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81133-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:16:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYQ7"}, "ts": "2023-07-09 07:16:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81133-1"}, "ts": "2023-07-09 07:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H825", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 07:16:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98556BK"}, "ts": "2023-07-09 07:17:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15118"}, "ts": "2023-07-09 07:17:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96CC6.503.503"}, "ts": "2023-07-09 07:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CC6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:17:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74324NE"}, "ts": "2023-07-09 07:17:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14456RI"}, "ts": "2023-07-09 07:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75830", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:19:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75830.148.148"}, "ts": "2023-07-09 07:19:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02091-1"}, "ts": "2023-07-09 07:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26255-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26255-1"}, "ts": "2023-07-09 07:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09472"}, "ts": "2023-07-09 07:20:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09472", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:20:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:20:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75822", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:20:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75822"}, "ts": "2023-07-09 07:20:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q31093"}, "ts": "2023-07-09 07:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q31093", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08183", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:21:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52565"}, "ts": "2023-07-09 07:21:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08183.641.641"}, "ts": "2023-07-09 07:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:22:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-09 07:22:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76090", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:23:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O76090.146.146"}, "ts": "2023-07-09 07:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:23:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00303"}, "ts": "2023-07-09 07:23:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08520NM"}, "ts": "2023-07-09 07:24:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35034634", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:24:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35034634", "type": "PubMed"}, "ts": "2023-07-09 07:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35034634", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 07:24:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9271635", "type": "PubMed"}, "ts": "2023-07-09 07:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9271635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:25:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQZ7"}, "ts": "2023-07-09 07:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQZ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16627869", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:27:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16627869", "type": "PubMed"}, "ts": "2023-07-09 07:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:27:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TR8"}, "ts": "2023-07-09 07:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TR8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:27:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95992"}, "ts": "2023-07-09 07:27:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-09 07:29:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-09 07:29:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06290IR"}, "ts": "2023-07-09 07:30:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80075"}, "ts": "2023-07-09 07:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7836467", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:31:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7836467", "type": "PubMed"}, "ts": "2023-07-09 07:31:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5JWF2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 07:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 07:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:32:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O96018"}, "ts": "2023-07-09 07:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92551", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:32:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92551.151.151"}, "ts": "2023-07-09 07:32:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTX8"}, "ts": "2023-07-09 07:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31639", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:33:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31639.99.99"}, "ts": "2023-07-09 07:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01638", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:33:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01638.191.191"}, "ts": "2023-07-09 07:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAR4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAR4-1"}, "ts": "2023-07-09 07:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:33:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:33:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7-1"}, "ts": "2023-07-09 07:33:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61201"}, "ts": "2023-07-09 07:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61201", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25775514", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q674X7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:33:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25775514", "type": "PubMed"}, "ts": "2023-07-09 07:33:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-09 07:33:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:34:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZI7"}, "ts": "2023-07-09 07:34:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10600"}, "ts": "2023-07-09 07:34:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10600", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:34:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIR0.290.290"}, "ts": "2023-07-09 07:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:35:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PQL3-1"}, "ts": "2023-07-09 07:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQL3-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:37:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8G8"}, "ts": "2023-07-09 07:37:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-09 07:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52565", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15930129", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:38:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15930129", "type": "PubMed"}, "ts": "2023-07-09 07:38:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14429"}, "ts": "2023-07-09 07:39:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA42"}, "ts": "2023-07-09 07:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:39:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52888"}, "ts": "2023-07-09 07:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:39:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-09 07:39:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:39:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13232"}, "ts": "2023-07-09 07:39:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13232", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:39:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51797"}, "ts": "2023-07-09 07:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51797", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:40:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQA5"}, "ts": "2023-07-09 07:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:40:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H490"}, "ts": "2023-07-09 07:40:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZV4"}, "ts": "2023-07-09 07:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24592", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:40:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24592"}, "ts": "2023-07-09 07:40:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15211"}, "ts": "2023-07-09 07:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:40:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74621LB"}, "ts": "2023-07-09 07:41:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D1D4"}, "ts": "2023-07-09 07:41:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D1D4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11804779", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:41:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2IBD0"}, "ts": "2023-07-09 07:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2IBD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:41:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11804779", "type": "PubMed"}, "ts": "2023-07-09 07:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUT1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:42:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUT1"}, "ts": "2023-07-09 07:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NW7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:43:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96NW7.1439.1439"}, "ts": "2023-07-09 07:43:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21267416", "type": "PubMed"}, "ts": "2023-07-09 07:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21267416", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62956", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:43:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62956.473.473"}, "ts": "2023-07-09 07:43:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25775266", "type": "PubMed"}, "ts": "2023-07-09 07:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25775266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:44:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-09 07:44:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LV45"}, "ts": "2023-07-09 07:45:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LV45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:45:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10.1038/emboj.2013.79", "type": "DOI"}, "ts": "2023-07-09 07:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10.1038/emboj.2013.79", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q075Z2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:45:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q075Z2"}, "ts": "2023-07-09 07:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65562ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 07:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHL3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:45:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61115", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:45:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61115"}, "ts": "2023-07-09 07:45:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TBP0.352.352"}, "ts": "2023-07-09 07:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBP0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:46:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHL3-1"}, "ts": "2023-07-09 07:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5F7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5F7"}, "ts": "2023-07-09 07:46:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0F0.78.78"}, "ts": "2023-07-09 07:46:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "privacy-policy", "message": "page access"}, "ts": "2023-07-09 07:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0F0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:46:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWT6"}, "ts": "2023-07-09 07:46:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51679"}, "ts": "2023-07-09 07:47:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27952"}, "ts": "2023-07-09 07:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27952", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:47:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-09 07:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHL0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:47:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHL0-1"}, "ts": "2023-07-09 07:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8247017", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:47:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8247017", "type": "PubMed"}, "ts": "2023-07-09 07:47:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:47:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVB6"}, "ts": "2023-07-09 07:47:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K004", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:47:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K004"}, "ts": "2023-07-09 07:47:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12434311", "type": "PubMed"}, "ts": "2023-07-09 07:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12434311", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:47:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26374642", "type": "PubMed"}, "ts": "2023-07-09 07:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26374642", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:48:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ALS5-1"}, "ts": "2023-07-09 07:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ALS5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:48:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLF7"}, "ts": "2023-07-09 07:48:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01591"}, "ts": "2023-07-09 07:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:49:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL40"}, "ts": "2023-07-09 07:49:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HH3-1"}, "ts": "2023-07-09 07:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HH3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:49:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-09 07:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05161"}, "ts": "2023-07-09 07:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQ15"}, "ts": "2023-07-09 07:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU39", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:53:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WU39.232.232"}, "ts": "2023-07-09 07:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:53:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60715"}, "ts": "2023-07-09 07:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32918700", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:53:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60715", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:53:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32918700", "type": "PubMed"}, "ts": "2023-07-09 07:53:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35580", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:53:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35580.1632.1632"}, "ts": "2023-07-09 07:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:53:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBE1"}, "ts": "2023-07-09 07:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PEY1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18146"}, "ts": "2023-07-09 07:54:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18146", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJ42"}, "ts": "2023-07-09 07:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJ42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60891", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:54:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19483673", "type": "PubMed"}, "ts": "2023-07-09 07:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19483673", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:54:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q17RY0"}, "ts": "2023-07-09 07:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17RY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:54:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 07:54:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15541", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 07:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 07:54:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WV54.258.258"}, "ts": "2023-07-09 07:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV54", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12645", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:55:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12645.69.69"}, "ts": "2023-07-09 07:55:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15662416", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:55:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15662416", "type": "PubMed"}, "ts": "2023-07-09 07:55:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06759"}, "ts": "2023-07-09 07:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06759", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 07:55:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13591.228.228"}, "ts": "2023-07-09 07:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13591", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 07:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:56:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37237"}, "ts": "2023-07-09 07:56:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JRC9-1"}, "ts": "2023-07-09 07:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JRC9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:56:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-09 07:56:55 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-09 07:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:57:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAS1"}, "ts": "2023-07-09 07:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27631728", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 07:58:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27631728", "type": "PubMed"}, "ts": "2023-07-09 07:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVB6"}, "ts": "2023-07-09 07:58:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHK5"}, "ts": "2023-07-09 07:58:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:58:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:59:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC29"}, "ts": "2023-07-09 07:59:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83858"}, "ts": "2023-07-09 07:59:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 07:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 08:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 08:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 08:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 08:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 08:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 08:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZQ1"}, "ts": "2023-07-09 08:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41146", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:00:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41146.341.341"}, "ts": "2023-07-09 08:00:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7H5"}, "ts": "2023-07-09 08:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05503", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:00:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05503"}, "ts": "2023-07-09 08:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ASI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:00:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ASI5"}, "ts": "2023-07-09 08:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20458337", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:01:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20458337", "type": "PubMed"}, "ts": "2023-07-09 08:01:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J2F0"}, "ts": "2023-07-09 08:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J2F0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35407"}, "ts": "2023-07-09 08:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35407", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43414-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:01:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43414-1.133.133"}, "ts": "2023-07-09 08:01:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AKB9"}, "ts": "2023-07-09 08:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AKB9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:02:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16570"}, "ts": "2023-07-09 08:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01031", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:03:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031"}, "ts": "2023-07-09 08:03:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXC1.987.987"}, "ts": "2023-07-09 08:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXC1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:04:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:04:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TM6"}, "ts": "2023-07-09 08:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13233", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:04:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13233"}, "ts": "2023-07-09 08:04:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33485967", "type": "PubMed"}, "ts": "2023-07-09 08:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33485967", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UNU4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:05:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UNU4"}, "ts": "2023-07-09 08:05:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:05:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20458337", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 08:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAB3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:07:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TAB3.747.747"}, "ts": "2023-07-09 08:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R2P8"}, "ts": "2023-07-09 08:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DF27"}, "ts": "2023-07-09 08:07:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DF27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A9S3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:08:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A9S3"}, "ts": "2023-07-09 08:08:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97797-1"}, "ts": "2023-07-09 08:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC62", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:11:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC62"}, "ts": "2023-07-09 08:11:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "G3V8Y7.400.400"}, "ts": "2023-07-09 08:11:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V8Y7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:11:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83461WR"}, "ts": "2023-07-09 08:11:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14576297", "type": "PubMed"}, "ts": "2023-07-09 08:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14576297", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:12:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23633571", "type": "PubMed"}, "ts": "2023-07-09 08:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23633571", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:12:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS6"}, "ts": "2023-07-09 08:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72750GQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:13:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72750GQ"}, "ts": "2023-07-09 08:13:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876-1"}, "ts": "2023-07-09 08:13:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25100"}, "ts": "2023-07-09 08:13:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25100", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:13:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60174"}, "ts": "2023-07-09 08:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R5M4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:14:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R5M4-1"}, "ts": "2023-07-09 08:14:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08334"}, "ts": "2023-07-09 08:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08334", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34482592", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:14:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34482592", "type": "PubMed"}, "ts": "2023-07-09 08:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4W1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:15:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4W1"}, "ts": "2023-07-09 08:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZF6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:15:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZF6.453.453"}, "ts": "2023-07-09 08:15:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14974.299.299"}, "ts": "2023-07-09 08:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14974", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 08:16:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3UFT3", "cluster_type": "unselected"}, "ts": "2023-07-09 08:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UFT3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 08:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UFT3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 08:16:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-09 08:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:16:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13716-1"}, "ts": "2023-07-09 08:16:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13716-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:16:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TC56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:16:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TC56"}, "ts": "2023-07-09 08:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV43", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:16:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VV43"}, "ts": "2023-07-09 08:16:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41706FJ"}, "ts": "2023-07-09 08:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41706FJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:17:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2S8"}, "ts": "2023-07-09 08:17:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2S8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:17:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04075"}, "ts": "2023-07-09 08:17:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12814", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:18:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12814.890.890"}, "ts": "2023-07-09 08:18:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48735"}, "ts": "2023-07-09 08:18:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92519", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:18:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92519.44.44"}, "ts": "2023-07-09 08:18:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q61423", "cluster_type": "unselected"}, "ts": "2023-07-09 08:18:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61423", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 08:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61423", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 08:18:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20489-1"}, "ts": "2023-07-09 08:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30598546", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:18:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30598546", "type": "PubMed"}, "ts": "2023-07-09 08:18:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2R6.421.421"}, "ts": "2023-07-09 08:19:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2R6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95180", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:19:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95180.781.781"}, "ts": "2023-07-09 08:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CPY6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:20:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CPY6-1"}, "ts": "2023-07-09 08:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04202", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:20:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04202"}, "ts": "2023-07-09 08:20:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15800"}, "ts": "2023-07-09 08:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15800", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:20:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49591"}, "ts": "2023-07-09 08:20:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DU8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:21:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DU8"}, "ts": "2023-07-09 08:21:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49748"}, "ts": "2023-07-09 08:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8QZW3"}, "ts": "2023-07-09 08:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8QZW3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:21:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96F46.562.562"}, "ts": "2023-07-09 08:21:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F46", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:21:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N3Z0.329.329"}, "ts": "2023-07-09 08:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3Z0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33376131", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:21:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33376131", "type": "PubMed"}, "ts": "2023-07-09 08:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6U841", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:22:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6U841.440.440"}, "ts": "2023-07-09 08:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16880209", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:23:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16880209", "type": "PubMed"}, "ts": "2023-07-09 08:23:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:24:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZJ7"}, "ts": "2023-07-09 08:24:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02818"}, "ts": "2023-07-09 08:24:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02818", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:24:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQT8"}, "ts": "2023-07-09 08:24:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQT8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 08:24:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15541", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 08:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 08:24:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05141"}, "ts": "2023-07-09 08:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:25:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52655.251.251"}, "ts": "2023-07-09 08:25:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24879834", "type": "PubMed"}, "ts": "2023-07-09 08:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52655", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24879834", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88822", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:26:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88822"}, "ts": "2023-07-09 08:26:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02786"}, "ts": "2023-07-09 08:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:26:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17991739", "type": "PubMed"}, "ts": "2023-07-09 08:26:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17991739", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:26:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPR9-1"}, "ts": "2023-07-09 08:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPR9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75179", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:26:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75179.1618.1618"}, "ts": "2023-07-09 08:26:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2KAH3"}, "ts": "2023-07-09 08:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2KAH3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:27:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08722"}, "ts": "2023-07-09 08:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:27:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70340"}, "ts": "2023-07-09 08:27:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70340", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:27:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43632.84.84"}, "ts": "2023-07-09 08:27:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43632", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83461WR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92791", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:27:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92791.314.314"}, "ts": "2023-07-09 08:27:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H28"}, "ts": "2023-07-09 08:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H28", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:29:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-09 08:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:29:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00533.523.523"}, "ts": "2023-07-09 08:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00533", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23919"}, "ts": "2023-07-09 08:30:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49247"}, "ts": "2023-07-09 08:30:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03984TW"}, "ts": "2023-07-09 08:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:30:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-09 08:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:30:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83951ZY"}, "ts": "2023-07-09 08:30:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79286RS"}, "ts": "2023-07-09 08:30:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34617SM"}, "ts": "2023-07-09 08:30:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-09 08:30:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92081HT"}, "ts": "2023-07-09 08:30:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26928.305.305"}, "ts": "2023-07-09 08:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-09 08:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26928", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86234IN"}, "ts": "2023-07-09 08:30:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-09 08:30:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-09 08:30:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-09 08:30:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-09 08:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16141059", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:30:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16141059", "type": "PubMed"}, "ts": "2023-07-09 08:30:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q704Y3"}, "ts": "2023-07-09 08:30:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16524428", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B23"}, "ts": "2023-07-09 08:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91413ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22760", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:32:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22760.40.40"}, "ts": "2023-07-09 08:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33527", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:32:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33527.617.617"}, "ts": "2023-07-09 08:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:32:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47869", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:32:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47869"}, "ts": "2023-07-09 08:32:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KR66-1"}, "ts": "2023-07-09 08:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KR66-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:33:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99963-1"}, "ts": "2023-07-09 08:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99963-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:33:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32109412", "type": "PubMed"}, "ts": "2023-07-09 08:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32109412", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:33:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 08:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35225", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:33:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35225.63.63"}, "ts": "2023-07-09 08:33:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXP8.1476.1476"}, "ts": "2023-07-09 08:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXP8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y261", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:34:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y261.451.451"}, "ts": "2023-07-09 08:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20489-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:34:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:34:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14246"}, "ts": "2023-07-09 08:34:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G95271EU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:34:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95271EU"}, "ts": "2023-07-09 08:34:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:35:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04075"}, "ts": "2023-07-09 08:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LRM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LRM0"}, "ts": "2023-07-09 08:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09874", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:36:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09874.426.426"}, "ts": "2023-07-09 08:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14C87", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:36:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14C87.219.219"}, "ts": "2023-07-09 08:36:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TEM1.31.31"}, "ts": "2023-07-09 08:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEM1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35711", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:37:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35711.540.540"}, "ts": "2023-07-09 08:37:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:37:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-09 08:37:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14050", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:37:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14050"}, "ts": "2023-07-09 08:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A35", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:38:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96A35.24.24"}, "ts": "2023-07-09 08:38:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15313", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:38:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15313"}, "ts": "2023-07-09 08:38:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:39:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UVM3.124.124"}, "ts": "2023-07-09 08:39:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:39:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62136"}, "ts": "2023-07-09 08:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62136", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:39:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10913173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:39:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10913173", "type": "PubMed"}, "ts": "2023-07-09 08:39:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75173.491.491"}, "ts": "2023-07-09 08:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75173", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:40:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:40:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00507"}, "ts": "2023-07-09 08:40:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11217"}, "ts": "2023-07-09 08:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11217", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:40:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51787"}, "ts": "2023-07-09 08:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51787", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:40:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:40:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGW6"}, "ts": "2023-07-09 08:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:41:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IUX7.416.416"}, "ts": "2023-07-09 08:41:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FW4"}, "ts": "2023-07-09 08:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99613", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:41:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99613"}, "ts": "2023-07-09 08:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:41:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18669"}, "ts": "2023-07-09 08:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:41:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 08:41:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5H9R7.315.315"}, "ts": "2023-07-09 08:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H9R7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:42:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18669"}, "ts": "2023-07-09 08:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:42:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:42:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18669.135.135"}, "ts": "2023-07-09 08:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56202", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:42:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56202.205.205"}, "ts": "2023-07-09 08:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:42:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18669"}, "ts": "2023-07-09 08:42:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCX7-1"}, "ts": "2023-07-09 08:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCX7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1V9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:42:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18669"}, "ts": "2023-07-09 08:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:43:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2288909"}, "ts": "2023-07-09 08:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 08:43:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.56.56"}, "ts": "2023-07-09 08:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16408927", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:43:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16408927", "type": "PubMed"}, "ts": "2023-07-09 08:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13797", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:44:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13797"}, "ts": "2023-07-09 08:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:44:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33214551", "type": "PubMed"}, "ts": "2023-07-09 08:44:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33214551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:44:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBM4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:44:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBM4.198.198"}, "ts": "2023-07-09 08:44:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00751"}, "ts": "2023-07-09 08:45:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00751", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:45:07 EDT-0400"}, {"api": "/data/section_download/", "req": {"id": "pubmed.33214551", "download_type": "publication_section", "section": "referenced_proteins", "format": "csv", "compressed": false}, "ts": "2023-07-09 08:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "pubmed.33214551", "user": "Undecided", "type": "user", "page": "publication", "message": "csv"}, "ts": "2023-07-09 08:45:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08999", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:45:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08999.401.401"}, "ts": "2023-07-09 08:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:46:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12909012", "type": "PubMed"}, "ts": "2023-07-09 08:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12909012", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q704Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2Q3"}, "ts": "2023-07-09 08:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2Q3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43399", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:48:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43399.96.96"}, "ts": "2023-07-09 08:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5C9Z4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5C9Z4"}, "ts": "2023-07-09 08:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16204NU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:49:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16204NU"}, "ts": "2023-07-09 08:49:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-09 08:49:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:49:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12492477", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:50:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12492477", "type": "PubMed"}, "ts": "2023-07-09 08:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33214551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:50:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33214551", "type": "PubMed"}, "ts": "2023-07-09 08:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26255-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:50:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26255-1"}, "ts": "2023-07-09 08:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43795", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 08:50:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43795"}, "ts": "2023-07-09 08:50:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11780124", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:50:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11780124", "type": "PubMed"}, "ts": "2023-07-09 08:50:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:50:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96L91.2608.2608"}, "ts": "2023-07-09 08:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:51:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LT4"}, "ts": "2023-07-09 08:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2R3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:51:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2R3"}, "ts": "2023-07-09 08:51:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3K2.24.24"}, "ts": "2023-07-09 08:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3K2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:51:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LJ2"}, "ts": "2023-07-09 08:51:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IP4"}, "ts": "2023-07-09 08:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:53:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-09 08:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:53:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15118.378.378"}, "ts": "2023-07-09 08:53:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56539"}, "ts": "2023-07-09 08:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56539", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHU4-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:53:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JHU4-1.4216.4216"}, "ts": "2023-07-09 08:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J262", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J262"}, "ts": "2023-07-09 08:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15408"}, "ts": "2023-07-09 08:54:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11296287", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15408", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:54:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11296287", "type": "PubMed"}, "ts": "2023-07-09 08:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08431-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:54:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08431-1"}, "ts": "2023-07-09 08:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16630", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19833968", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 08:54:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19833968", "type": "PubMed"}, "ts": "2023-07-09 08:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46098", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:55:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46098.219.219"}, "ts": "2023-07-09 08:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7M4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T7M4"}, "ts": "2023-07-09 08:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:57:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V01"}, "ts": "2023-07-09 08:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:57:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54760.353.353"}, "ts": "2023-07-09 08:57:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54760", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95407", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 08:58:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95407.170.170"}, "ts": "2023-07-09 08:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91625IP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 08:58:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91625IP"}, "ts": "2023-07-09 08:58:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:58:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKX5"}, "ts": "2023-07-09 08:58:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 08:59:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWY2"}, "ts": "2023-07-09 08:59:10 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 09:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 09:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 09:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 09:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 09:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 09:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D4E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:00:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D4E9"}, "ts": "2023-07-09 09:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:01:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y286-1"}, "ts": "2023-07-09 09:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y286-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:01:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06656BE"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21196UL"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27102CT"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-09 09:01:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39943KJ"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57141NR"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57818FI"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67030CA"}, "ts": "2023-07-09 09:01:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P62745.185.185"}, "ts": "2023-07-09 09:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62745", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:02:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9BUD6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUD6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:02:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1J9-1"}, "ts": "2023-07-09 09:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L0X0"}, "ts": "2023-07-09 09:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L0X0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:03:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10923.106.106"}, "ts": "2023-07-09 09:03:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:05:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34852960", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17RY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:05:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34852960", "type": "PubMed"}, "ts": "2023-07-09 09:05:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q17RY0"}, "ts": "2023-07-09 09:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34852960", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 09:05:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:05:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4R8"}, "ts": "2023-07-09 09:05:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53680"}, "ts": "2023-07-09 09:05:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:06:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9P6"}, "ts": "2023-07-09 09:06:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13243"}, "ts": "2023-07-09 09:06:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13243", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:06:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A9L9"}, "ts": "2023-07-09 09:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A9L9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:06:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q562R1.177.177"}, "ts": "2023-07-09 09:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q562R1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:06:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C6S8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:06:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C6S8.133.133"}, "ts": "2023-07-09 09:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:07:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QUN7.147.147"}, "ts": "2023-07-09 09:07:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8040304", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:07:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8040304", "type": "PubMed"}, "ts": "2023-07-09 09:07:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18818698", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:07:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18818698", "type": "PubMed"}, "ts": "2023-07-09 09:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DC77", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DC77"}, "ts": "2023-07-09 09:08:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBH5"}, "ts": "2023-07-09 09:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:08:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08431-1"}, "ts": "2023-07-09 09:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:09:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07954-1"}, "ts": "2023-07-09 09:09:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07954-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:09:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43414-1.133.133"}, "ts": "2023-07-09 09:09:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43414-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:09:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75880", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:10:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75880.33.33"}, "ts": "2023-07-09 09:10:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BIZ6"}, "ts": "2023-07-09 09:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BIZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17172455", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:10:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17172455", "type": "PubMed"}, "ts": "2023-07-09 09:10:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:11:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96P63.294.294"}, "ts": "2023-07-09 09:11:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:11:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M2I8"}, "ts": "2023-07-09 09:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M2I8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5I0I2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:12:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5I0I2"}, "ts": "2023-07-09 09:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUS6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:12:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6NUS6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:12:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07814.885.885"}, "ts": "2023-07-09 09:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07814", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:12:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A7"}, "ts": "2023-07-09 09:12:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-09 09:12:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-09 09:13:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:13:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-09 09:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21290787", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:14:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21290787", "type": "PubMed"}, "ts": "2023-07-09 09:14:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21290787", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 09:14:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52888.404.404"}, "ts": "2023-07-09 09:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52888", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:14:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:14:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHK6"}, "ts": "2023-07-09 09:14:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54814"}, "ts": "2023-07-09 09:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54814", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JUZ0"}, "ts": "2023-07-09 09:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JUZ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00762-1"}, "ts": "2023-07-09 09:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00762-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:16:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15408"}, "ts": "2023-07-09 09:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15408", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:16:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99983"}, "ts": "2023-07-09 09:16:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVI1"}, "ts": "2023-07-09 09:16:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:16:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05503"}, "ts": "2023-07-09 09:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05503", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56A06", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:16:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56A06"}, "ts": "2023-07-09 09:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30558", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:16:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30558.423.423"}, "ts": "2023-07-09 09:16:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQT6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:16:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQT6"}, "ts": "2023-07-09 09:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:17:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWP9"}, "ts": "2023-07-09 09:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:17:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5Q5"}, "ts": "2023-07-09 09:17:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Q5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:17:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBM8"}, "ts": "2023-07-09 09:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:17:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80Z37", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:18:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80Z37.999.999"}, "ts": "2023-07-09 09:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30260", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30260"}, "ts": "2023-07-09 09:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:19:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22079"}, "ts": "2023-07-09 09:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22079", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:19:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-09 09:19:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33023375", "type": "PubMed"}, "ts": "2023-07-09 09:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33023375", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:20:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33023375", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 09:20:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDB2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDB2-1"}, "ts": "2023-07-09 09:20:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49789"}, "ts": "2023-07-09 09:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:20:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6NUJ1.311.311"}, "ts": "2023-07-09 09:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:21:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51814"}, "ts": "2023-07-09 09:21:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UVJ0.231.231"}, "ts": "2023-07-09 09:22:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVJ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:23:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-09 09:23:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HZE4"}, "ts": "2023-07-09 09:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HZE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:23:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1Z4.161.161"}, "ts": "2023-07-09 09:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1Z4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99958", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:23:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99958"}, "ts": "2023-07-09 09:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TAP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:23:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TAP6"}, "ts": "2023-07-09 09:23:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-09 09:24:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02775"}, "ts": "2023-07-09 09:25:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02775", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12864", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:25:49 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q12864", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:25:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGW6"}, "ts": "2023-07-09 09:25:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PM3"}, "ts": "2023-07-09 09:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PM3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969Q4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:26:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969Q4"}, "ts": "2023-07-09 09:26:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-09 09:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:26:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2S2"}, "ts": "2023-07-09 09:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2S2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19139-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19139-1"}, "ts": "2023-07-09 09:26:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36956.534.534"}, "ts": "2023-07-09 09:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36956", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:27:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82675"}, "ts": "2023-07-09 09:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82675", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:27:34 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O96018", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96018", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:27:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2TGJ9-1"}, "ts": "2023-07-09 09:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O96018", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 09:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2TGJ9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:27:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05090.115.115"}, "ts": "2023-07-09 09:27:44 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q15054", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15054", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75439", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:28:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75439"}, "ts": "2023-07-09 09:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45209NR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:28:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-09 09:28:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13228"}, "ts": "2023-07-09 09:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13228", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:29:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-09 09:29:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IUR5-1"}, "ts": "2023-07-09 09:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IUR5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02769", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:30:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02769"}, "ts": "2023-07-09 09:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q58WW2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:31:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q58WW2.319.319"}, "ts": "2023-07-09 09:31:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43119"}, "ts": "2023-07-09 09:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43119", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:31:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21756023", "type": "PubMed"}, "ts": "2023-07-09 09:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21756023", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 09:31:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQA3-1"}, "ts": "2023-07-09 09:31:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000030", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 09:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQA3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:31:42 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000030", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 09:31:42 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000030", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 09:31:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30082792", "type": "PubMed"}, "ts": "2023-07-09 09:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30082792", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 09:32:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937-1"}, "ts": "2023-07-09 09:32:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQR9"}, "ts": "2023-07-09 09:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQR9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:33:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:34:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12656"}, "ts": "2023-07-09 09:34:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-09 09:34:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:35:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03956"}, "ts": "2023-07-09 09:35:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTY3.150.150"}, "ts": "2023-07-09 09:35:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:35:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14506936", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:35:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14506936", "type": "PubMed"}, "ts": "2023-07-09 09:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10613843", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:35:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10613843", "type": "PubMed"}, "ts": "2023-07-09 09:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:37:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0R7"}, "ts": "2023-07-09 09:37:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15063128", "type": "PubMed"}, "ts": "2023-07-09 09:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15063128", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:37:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43390"}, "ts": "2023-07-09 09:37:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16112"}, "ts": "2023-07-09 09:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17523162", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:38:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17523162", "type": "PubMed"}, "ts": "2023-07-09 09:38:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMX0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:38:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UMX0.518.518"}, "ts": "2023-07-09 09:38:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95819", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:38:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95819.629.629"}, "ts": "2023-07-09 09:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JWF2"}, "ts": "2023-07-09 09:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:38:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98158-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:38:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98158-1"}, "ts": "2023-07-09 09:38:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:38:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31785"}, "ts": "2023-07-09 09:39:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-09 09:39:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95631"}, "ts": "2023-07-09 09:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95631", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4Z2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4Z2"}, "ts": "2023-07-09 09:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H741", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:41:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H741.159.159"}, "ts": "2023-07-09 09:41:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00736"}, "ts": "2023-07-09 09:41:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00736", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:41:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2L4T2"}, "ts": "2023-07-09 09:41:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2L4T2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:41:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24298-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24298-1"}, "ts": "2023-07-09 09:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y277"}, "ts": "2023-07-09 09:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:42:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30554-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:42:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30554-1"}, "ts": "2023-07-09 09:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5J4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:42:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C5J4.2.2"}, "ts": "2023-07-09 09:42:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUM4"}, "ts": "2023-07-09 09:42:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:42:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1Q8"}, "ts": "2023-07-09 09:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1Q8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:43:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48556"}, "ts": "2023-07-09 09:43:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-09 09:44:22 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-09 09:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-09 09:44:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-09 09:44:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-09 09:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62132", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:45:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62132"}, "ts": "2023-07-09 09:45:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26924806", "type": "PubMed"}, "ts": "2023-07-09 09:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26924806", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:45:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPV7"}, "ts": "2023-07-09 09:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYS2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:45:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QYS2-1"}, "ts": "2023-07-09 09:45:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y617", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:46:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y617.153.153"}, "ts": "2023-07-09 09:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:46:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62913"}, "ts": "2023-07-09 09:46:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70302.567.567"}, "ts": "2023-07-09 09:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70302", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:46:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15379"}, "ts": "2023-07-09 09:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:47:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NI17"}, "ts": "2023-07-09 09:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:48:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-09 09:48:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:49:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07814"}, "ts": "2023-07-09 09:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51410"}, "ts": "2023-07-09 09:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51410", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QWF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:50:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QWF0"}, "ts": "2023-07-09 09:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50430-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:50:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:50:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50430-1"}, "ts": "2023-07-09 09:50:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-09 09:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:51:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:51:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07498"}, "ts": "2023-07-09 09:51:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-09 09:51:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-09 09:51:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05848DX"}, "ts": "2023-07-09 09:51:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29231AT"}, "ts": "2023-07-09 09:51:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-09 09:51:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37653KL"}, "ts": "2023-07-09 09:51:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41424HD"}, "ts": "2023-07-09 09:51:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69500TM"}, "ts": "2023-07-09 09:51:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70125XL"}, "ts": "2023-07-09 09:51:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86186US"}, "ts": "2023-07-09 09:51:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91875JA"}, "ts": "2023-07-09 09:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ2"}, "ts": "2023-07-09 09:51:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26794871", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:51:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26794871", "type": "PubMed"}, "ts": "2023-07-09 09:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL51"}, "ts": "2023-07-09 09:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-09 09:52:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2S6"}, "ts": "2023-07-09 09:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2S6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35138101", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:53:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35138101", "type": "PubMed"}, "ts": "2023-07-09 09:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70537", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70537"}, "ts": "2023-07-09 09:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZU15-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34725712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:53:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34725712", "type": "PubMed"}, "ts": "2023-07-09 09:53:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZU15-1"}, "ts": "2023-07-09 09:53:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96066HD"}, "ts": "2023-07-09 09:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96066HD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64191-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:53:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64191-1"}, "ts": "2023-07-09 09:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VAQ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 09:53:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q0VAQ4.9.9"}, "ts": "2023-07-09 09:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:54:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:54:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07498"}, "ts": "2023-07-09 09:54:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05848DX"}, "ts": "2023-07-09 09:54:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41424HD"}, "ts": "2023-07-09 09:54:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-09 09:54:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-09 09:54:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29231AT"}, "ts": "2023-07-09 09:54:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37653KL"}, "ts": "2023-07-09 09:54:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-09 09:54:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69500TM"}, "ts": "2023-07-09 09:54:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70125XL"}, "ts": "2023-07-09 09:54:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86186US"}, "ts": "2023-07-09 09:54:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91875JA"}, "ts": "2023-07-09 09:54:37 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9R0L9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0L9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:54:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P28653-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 09:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:54:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07498"}, "ts": "2023-07-09 09:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96577RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQ94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQ94"}, "ts": "2023-07-09 09:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33877894", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:55:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33877894", "type": "PubMed"}, "ts": "2023-07-09 09:55:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N114", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:56:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N114"}, "ts": "2023-07-09 09:56:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:56:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-09 09:56:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-09 09:56:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-09 09:56:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23052ZQ"}, "ts": "2023-07-09 09:56:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67200RM"}, "ts": "2023-07-09 09:56:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QVC8"}, "ts": "2023-07-09 09:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QVC8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:56:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-09 09:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:57:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZMP0"}, "ts": "2023-07-09 09:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36551", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:57:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36551"}, "ts": "2023-07-09 09:57:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:57:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07498"}, "ts": "2023-07-09 09:57:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEB5"}, "ts": "2023-07-09 09:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEB5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:57:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-09 09:57:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:57:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-09 09:57:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-09 09:57:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23052ZQ"}, "ts": "2023-07-09 09:57:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67200RM"}, "ts": "2023-07-09 09:57:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20038598", "type": "PubMed"}, "ts": "2023-07-09 09:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20038598", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 09:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:57:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-09 09:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:57:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07498"}, "ts": "2023-07-09 09:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:57:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 09:57:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-09 09:57:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64240"}, "ts": "2023-07-09 09:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:58:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPR2-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 09:58:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NPR2-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 09:58:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969N2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:59:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969N2"}, "ts": "2023-07-09 09:59:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02671"}, "ts": "2023-07-09 09:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "casein", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-09 09:59:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPX0"}, "ts": "2023-07-09 09:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 09:59:33 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "casein"}, "ts": "2023-07-09 09:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 09:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "casein", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=casein"}, "ts": "2023-07-09 09:59:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "06e19c199c37c2f3920b41729e45ff5c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 09:59:37 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "06e19c199c37c2f3920b41729e45ff5c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 09:59:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43303"}, "ts": "2023-07-09 09:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64133"}, "ts": "2023-07-09 09:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64133", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 09:59:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75326", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 09:59:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75326"}, "ts": "2023-07-09 09:59:57 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 10:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 10:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 10:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 10:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 10:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 10:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 10:00:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "06e19c199c37c2f3920b41729e45ff5c", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 10:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "06e19c199c37c2f3920b41729e45ff5c", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 10:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30153-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:00:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26068853", "type": "PubMed"}, "ts": "2023-07-09 10:00:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19196426", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:00:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19196426", "type": "PubMed"}, "ts": "2023-07-09 10:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:00:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15750.46.46"}, "ts": "2023-07-09 10:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15750", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26068853", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:00:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27425HP"}, "ts": "2023-07-09 10:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27425HP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:00:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-09 10:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:01:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPQ8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:01:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NPQ8", "cluster_type": "unselected"}, "ts": "2023-07-09 10:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPQ8", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 10:01:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "A6NFD8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 10:01:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFD8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:01:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWU9"}, "ts": "2023-07-09 10:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:02:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-09 10:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75665", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:02:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75665.834.834"}, "ts": "2023-07-09 10:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GTS8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:02:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6GTS8.442.442"}, "ts": "2023-07-09 10:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G23-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:02:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96G23-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 10:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6149934", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:02:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6149934", "type": "PubMed"}, "ts": "2023-07-09 10:02:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35556.788.788"}, "ts": "2023-07-09 10:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35556", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:02:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPU7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:03:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPU7"}, "ts": "2023-07-09 10:03:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-09 10:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NST1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NST1"}, "ts": "2023-07-09 10:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:03:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7D0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:04:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H7D0.1443.1443"}, "ts": "2023-07-09 10:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:04:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TB7"}, "ts": "2023-07-09 10:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31213", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:04:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31213"}, "ts": "2023-07-09 10:04:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95393JS"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96338EK"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98419CX"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98540DJ"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98732ZL"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99448WD"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99610EG"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99651QK"}, "ts": "2023-07-09 10:04:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99420ZQ"}, "ts": "2023-07-09 10:05:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98552UD"}, "ts": "2023-07-09 10:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99853JR"}, "ts": "2023-07-09 10:05:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95800DS"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95994EE"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96223WK"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96886RU"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97765TT"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98030BR"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98903TR"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99034SV"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99981ST"}, "ts": "2023-07-09 10:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5L9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:05:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5L9.240.240"}, "ts": "2023-07-09 10:05:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-09 10:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34725712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:05:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34725712", "type": "PubMed"}, "ts": "2023-07-09 10:05:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:05:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20929727", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:05:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20929727", "type": "PubMed"}, "ts": "2023-07-09 10:05:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:05:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "11295836"}, "ts": "2023-07-09 10:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 10:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91625IP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:05:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91625IP"}, "ts": "2023-07-09 10:05:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61144-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:05:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61144-1"}, "ts": "2023-07-09 10:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPT8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:06:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPT8"}, "ts": "2023-07-09 10:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09143", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:06:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09143"}, "ts": "2023-07-09 10:06:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H255"}, "ts": "2023-07-09 10:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H255", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:06:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92832", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:06:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92832.72.72"}, "ts": "2023-07-09 10:06:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:07:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32161263", "type": "PubMed"}, "ts": "2023-07-09 10:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32161263", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14756"}, "ts": "2023-07-09 10:08:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:08:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35303"}, "ts": "2023-07-09 10:08:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NES8"}, "ts": "2023-07-09 10:09:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NES8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4G1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:09:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4G1-1"}, "ts": "2023-07-09 10:09:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28660"}, "ts": "2023-07-09 10:09:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:09:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVR2"}, "ts": "2023-07-09 10:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3Y0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:10:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3Y0"}, "ts": "2023-07-09 10:10:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:10:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06481.736.736"}, "ts": "2023-07-09 10:10:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:10:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10934230", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:10:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10934230", "type": "PubMed"}, "ts": "2023-07-09 10:11:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97707"}, "ts": "2023-07-09 10:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01920", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:11:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01920"}, "ts": "2023-07-09 10:11:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HQ2"}, "ts": "2023-07-09 10:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HQ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:11:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVX2"}, "ts": "2023-07-09 10:12:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVX2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29794015", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:12:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29794015", "type": "PubMed"}, "ts": "2023-07-09 10:12:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 10:13:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55209.64.64"}, "ts": "2023-07-09 10:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55209", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00547", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00547"}, "ts": "2023-07-09 10:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:13:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-09 10:13:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-09 10:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19404", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:14:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19404"}, "ts": "2023-07-09 10:14:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43405", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:15:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43405.100.100"}, "ts": "2023-07-09 10:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:16:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0E7"}, "ts": "2023-07-09 10:16:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6S3"}, "ts": "2023-07-09 10:16:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T6S3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:16:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PCB5.176.176"}, "ts": "2023-07-09 10:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCB5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:16:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P09429", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 10:17:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:17:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:17:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25789"}, "ts": "2023-07-09 10:17:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95477", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:17:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95477.824.824"}, "ts": "2023-07-09 10:17:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-09 10:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUN9"}, "ts": "2023-07-09 10:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51693", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:17:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51693"}, "ts": "2023-07-09 10:17:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75096.1691.1691"}, "ts": "2023-07-09 10:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75096", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:18:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35626"}, "ts": "2023-07-09 10:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-09 10:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR97", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:19:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NR97", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 10:19:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13637"}, "ts": "2023-07-09 10:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:19:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09429"}, "ts": "2023-07-09 10:19:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61019"}, "ts": "2023-07-09 10:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:19:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKP5.172.172"}, "ts": "2023-07-09 10:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51807"}, "ts": "2023-07-09 10:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51807", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:21:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:21:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-09 10:21:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:21:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D21-1"}, "ts": "2023-07-09 10:21:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D21-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:21:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76050"}, "ts": "2023-07-09 10:21:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76050", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:21:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17126306", "type": "PubMed"}, "ts": "2023-07-09 10:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17126306", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BR09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:22:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BR09"}, "ts": "2023-07-09 10:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23945"}, "ts": "2023-07-09 10:22:53 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6UWJ1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 10:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWJ1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:23:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2M4"}, "ts": "2023-07-09 10:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2M4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:23:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPN1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:23:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EPN1.1707.1707"}, "ts": "2023-07-09 10:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DHY5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:23:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DHY5-1"}, "ts": "2023-07-09 10:23:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZJ1.556.556"}, "ts": "2023-07-09 10:24:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZJ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:24:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9473480", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:24:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9473480", "type": "PubMed"}, "ts": "2023-07-09 10:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HG0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:26:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HG0"}, "ts": "2023-07-09 10:26:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51686"}, "ts": "2023-07-09 10:27:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:27:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ65"}, "ts": "2023-07-09 10:27:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122-1"}, "ts": "2023-07-09 10:27:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60568"}, "ts": "2023-07-09 10:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:28:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPD8"}, "ts": "2023-07-09 10:28:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:28:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93033"}, "ts": "2023-07-09 10:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93033", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:28:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451-1"}, "ts": "2023-07-09 10:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16473", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:29:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16473"}, "ts": "2023-07-09 10:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D244-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:29:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:29:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D244-1"}, "ts": "2023-07-09 10:29:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99661.698.698"}, "ts": "2023-07-09 10:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:30:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHY2"}, "ts": "2023-07-09 10:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75808", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTE8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:30:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTE8"}, "ts": "2023-07-09 10:30:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75808"}, "ts": "2023-07-09 10:30:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QS1"}, "ts": "2023-07-09 10:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW52", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:30:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IW52.550.550"}, "ts": "2023-07-09 10:30:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59646", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:30:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59646"}, "ts": "2023-07-09 10:30:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:30:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49716"}, "ts": "2023-07-09 10:30:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80746IL"}, "ts": "2023-07-09 10:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15863494", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:31:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15863494", "type": "PubMed"}, "ts": "2023-07-09 10:31:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y230", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 10:33:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26718", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:33:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26718"}, "ts": "2023-07-09 10:33:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y230", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:33:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14828.37.37"}, "ts": "2023-07-09 10:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14828", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAL8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:34:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAL8"}, "ts": "2023-07-09 10:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99081", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99081"}, "ts": "2023-07-09 10:35:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-09 10:35:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02545"}, "ts": "2023-07-09 10:35:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-09 10:35:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZJ1.556.556"}, "ts": "2023-07-09 10:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYN3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:36:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYN3"}, "ts": "2023-07-09 10:36:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58161NS"}, "ts": "2023-07-09 10:36:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15146", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:37:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15146.834.834"}, "ts": "2023-07-09 10:37:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17676.11.11"}, "ts": "2023-07-09 10:38:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17676", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6548745", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:39:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6548745", "type": "PubMed"}, "ts": "2023-07-09 10:39:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2460050"}, "ts": "2023-07-09 10:39:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:39:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-09 10:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:40:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03431"}, "ts": "2023-07-09 10:40:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:40:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-09 10:40:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-09 10:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 10:40:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99985", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:40:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99985.585.585"}, "ts": "2023-07-09 10:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70994MS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:40:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-09 10:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:41:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-09 10:41:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-09 10:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHB9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:42:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHB9.359.359"}, "ts": "2023-07-09 10:42:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A1W2Q6C2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:42:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A1W2Q6C2"}, "ts": "2023-07-09 10:42:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-09 10:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14432-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:42:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14432-1"}, "ts": "2023-07-09 10:42:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-09 10:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80203", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:43:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80203"}, "ts": "2023-07-09 10:43:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-09 10:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65562ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:43:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-09 10:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:43:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90348RI"}, "ts": "2023-07-09 10:43:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1C4.101.101"}, "ts": "2023-07-09 10:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1C4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:44:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-09 10:44:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07954-1.1825.1825"}, "ts": "2023-07-09 10:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07954-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:44:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVH1"}, "ts": "2023-07-09 10:44:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q810U4"}, "ts": "2023-07-09 10:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810U4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:44:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13591"}, "ts": "2023-07-09 10:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:45:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:45:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60847"}, "ts": "2023-07-09 10:45:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-09 10:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:46:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14511"}, "ts": "2023-07-09 10:46:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11877449", "type": "PubMed"}, "ts": "2023-07-09 10:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11877449", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NU19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:47:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NU19"}, "ts": "2023-07-09 10:47:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231"}, "ts": "2023-07-09 10:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P2C0"}, "ts": "2023-07-09 10:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2C0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:47:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIS5"}, "ts": "2023-07-09 10:47:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:47:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63173"}, "ts": "2023-07-09 10:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:48:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-09 10:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "36580660", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:49:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "36580660", "type": "PubMed"}, "ts": "2023-07-09 10:49:01 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P10451", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 10:49:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10451", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 10:49:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:49:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-09 10:49:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:49:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1L157"}, "ts": "2023-07-09 10:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:50:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:50:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00068MO"}, "ts": "2023-07-09 10:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00068MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H8A4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:50:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5H8A4.751.751"}, "ts": "2023-07-09 10:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29025973", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:50:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29025973", "type": "PubMed"}, "ts": "2023-07-09 10:50:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12660"}, "ts": "2023-07-09 10:50:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TXU5-1"}, "ts": "2023-07-09 10:51:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TXU5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:51:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:51:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPV8"}, "ts": "2023-07-09 10:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00788"}, "ts": "2023-07-09 10:52:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58161NS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PTC3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PTC3-1"}, "ts": "2023-07-09 10:52:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CW1"}, "ts": "2023-07-09 10:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91WT8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 10:53:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91WT8"}, "ts": "2023-07-09 10:53:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33003281", "type": "PubMed"}, "ts": "2023-07-09 10:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33003281", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33003281", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 10:53:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SL4"}, "ts": "2023-07-09 10:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQA5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:54:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36507"}, "ts": "2023-07-09 10:55:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96F86"}, "ts": "2023-07-09 10:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:55:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQA5.51.51"}, "ts": "2023-07-09 10:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:55:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ01"}, "ts": "2023-07-09 10:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:56:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZWR6.8308.8308"}, "ts": "2023-07-09 10:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00255-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:56:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00255-1"}, "ts": "2023-07-09 10:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:56:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76071"}, "ts": "2023-07-09 10:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00367", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:57:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00367.473.473"}, "ts": "2023-07-09 10:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48414YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:57:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-09 10:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYB4"}, "ts": "2023-07-09 10:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:57:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-09 10:57:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-09 10:57:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJJ9"}, "ts": "2023-07-09 10:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 10:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50045TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 10:59:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12461691", "type": "PubMed"}, "ts": "2023-07-09 10:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12461691", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 10:59:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "32001436"}, "ts": "2023-07-09 10:59:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03351.710.710"}, "ts": "2023-07-09 10:59:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03351", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 10:59:59 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 11:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 11:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 11:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 11:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 11:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 11:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95232"}, "ts": "2023-07-09 11:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95232", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 11:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 11:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452"}, "ts": "2023-07-09 11:00:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08047.612.612"}, "ts": "2023-07-09 11:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08047", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DV7-1"}, "ts": "2023-07-09 11:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:00:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92575"}, "ts": "2023-07-09 11:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12931"}, "ts": "2023-07-09 11:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60825"}, "ts": "2023-07-09 11:01:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01019"}, "ts": "2023-07-09 11:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60825", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:01:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTS6.164.164"}, "ts": "2023-07-09 11:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:01:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:01:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43121"}, "ts": "2023-07-09 11:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:02:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-09 11:02:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21588"}, "ts": "2023-07-09 11:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:03:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-09 11:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:04:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42262.876.876"}, "ts": "2023-07-09 11:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42262", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:05:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:05:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19524571", "type": "PubMed"}, "ts": "2023-07-09 11:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19524571", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2V5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:06:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2V5-1"}, "ts": "2023-07-09 11:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28510447", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:06:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28510447", "type": "PubMed"}, "ts": "2023-07-09 11:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHG2"}, "ts": "2023-07-09 11:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TD49"}, "ts": "2023-07-09 11:07:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TD49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:07:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:07:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBG0"}, "ts": "2023-07-09 11:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:07:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14921"}, "ts": "2023-07-09 11:07:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15407YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:08:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15407YE"}, "ts": "2023-07-09 11:08:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-09 11:09:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4R6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:09:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4R6-1"}, "ts": "2023-07-09 11:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:09:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19924287", "type": "PubMed"}, "ts": "2023-07-09 11:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19924287", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:09:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BM0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:10:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BM0"}, "ts": "2023-07-09 11:10:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N0Y5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:10:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N0Y5.67.67"}, "ts": "2023-07-09 11:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CB9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:10:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CB9"}, "ts": "2023-07-09 11:10:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31268", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:11:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31268"}, "ts": "2023-07-09 11:11:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-09 11:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75121", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:12:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75121.111.111"}, "ts": "2023-07-09 11:12:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXY0"}, "ts": "2023-07-09 11:12:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:13:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:13:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54709"}, "ts": "2023-07-09 11:14:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54709", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:14:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:15:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSG0"}, "ts": "2023-07-09 11:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYN5"}, "ts": "2023-07-09 11:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYN5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:15:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6L1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:15:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z6L1.980.980"}, "ts": "2023-07-09 11:15:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82450"}, "ts": "2023-07-09 11:16:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:16:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 11:16:17 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 11:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 11:16:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-09 11:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16764867", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:16:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16764867", "type": "PubMed"}, "ts": "2023-07-09 11:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12707951", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:17:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12707951", "type": "PubMed"}, "ts": "2023-07-09 11:17:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61966"}, "ts": "2023-07-09 11:17:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IQ55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:17:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IQ55"}, "ts": "2023-07-09 11:17:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14678"}, "ts": "2023-07-09 11:18:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10669754", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:18:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10669754", "type": "PubMed"}, "ts": "2023-07-09 11:18:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02724-1.44.44"}, "ts": "2023-07-09 11:18:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653-1"}, "ts": "2023-07-09 11:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02724-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:18:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55186"}, "ts": "2023-07-09 11:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:18:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:18:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32302", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32302"}, "ts": "2023-07-09 11:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-09 11:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 11:19:31 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000025", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 11:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000025", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 11:19:33 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000025", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 11:19:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-09 11:20:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11340171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:20:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11340171", "type": "PubMed"}, "ts": "2023-07-09 11:20:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-09 11:21:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47820"}, "ts": "2023-07-09 11:21:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47820", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:21:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-09 11:21:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65937TS"}, "ts": "2023-07-09 11:22:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T9"}, "ts": "2023-07-09 11:22:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-09 11:22:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48740SL"}, "ts": "2023-07-09 11:22:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48740SL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:22:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18669"}, "ts": "2023-07-09 11:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:23:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CHP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:23:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CHP5"}, "ts": "2023-07-09 11:23:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01669LU"}, "ts": "2023-07-09 11:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01669LU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:23:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y666", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:24:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y666"}, "ts": "2023-07-09 11:24:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVI1"}, "ts": "2023-07-09 11:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:24:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36508-1"}, "ts": "2023-07-09 11:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36508-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:24:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:25:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-09 11:25:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14859"}, "ts": "2023-07-09 11:25:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15913950", "type": "PubMed"}, "ts": "2023-07-09 11:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15913950", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:26:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15371"}, "ts": "2023-07-09 11:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18624909", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:27:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18624909", "type": "PubMed"}, "ts": "2023-07-09 11:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12189148", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:27:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12189148", "type": "PubMed"}, "ts": "2023-07-09 11:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:28:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78357"}, "ts": "2023-07-09 11:28:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78357", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:28:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98088.1982.1982"}, "ts": "2023-07-09 11:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:28:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02779-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 11:28:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q02779-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 11:28:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82450", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:30:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10.1101/2020.04.01.020966", "type": "DOI"}, "ts": "2023-07-09 11:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10.1101/2020.04.01.020966", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:31:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJA2"}, "ts": "2023-07-09 11:32:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:32:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19139-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:32:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19139-1"}, "ts": "2023-07-09 11:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99N43", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:32:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99N43"}, "ts": "2023-07-09 11:32:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04075"}, "ts": "2023-07-09 11:32:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27751847", "type": "PubMed"}, "ts": "2023-07-09 11:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27751847", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:34:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:34:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-09 11:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:35:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23786"}, "ts": "2023-07-09 11:35:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05000-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 11:35:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P05000-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 11:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05000-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 11:35:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95182"}, "ts": "2023-07-09 11:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95182", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:36:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-09 11:36:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3T906"}, "ts": "2023-07-09 11:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T906", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 11:36:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493-1"}, "ts": "2023-07-09 11:37:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:37:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94923PG"}, "ts": "2023-07-09 11:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94923PG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-09 11:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:38:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99218-2"}, "ts": "2023-07-09 11:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99218-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:38:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-09 11:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:39:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-09 11:40:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-09 11:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09269CO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:40:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09269CO"}, "ts": "2023-07-09 11:40:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11735228", "type": "PubMed"}, "ts": "2023-07-09 11:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11735228", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:40:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-09 11:41:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:41:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:42:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10631108", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 11:42:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10631108", "type": "PubMed"}, "ts": "2023-07-09 11:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:42:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11274", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:43:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11274.246.246"}, "ts": "2023-07-09 11:43:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P34995.28.28"}, "ts": "2023-07-09 11:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34995", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:44:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20152-1"}, "ts": "2023-07-09 11:44:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20152-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:44:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56UD9"}, "ts": "2023-07-09 11:44:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56UD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PE5"}, "ts": "2023-07-09 11:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:45:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y618"}, "ts": "2023-07-09 11:45:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570-1"}, "ts": "2023-07-09 11:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99884", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:46:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99884"}, "ts": "2023-07-09 11:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20701", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:46:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20701.903.903"}, "ts": "2023-07-09 11:46:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32971-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:46:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32971-1"}, "ts": "2023-07-09 11:46:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46778"}, "ts": "2023-07-09 11:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:47:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43121"}, "ts": "2023-07-09 11:47:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-09 11:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:48:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:49:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL54"}, "ts": "2023-07-09 11:49:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-09 11:49:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-09 11:49:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-09 11:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30837", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:50:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30837"}, "ts": "2023-07-09 11:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2E5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:50:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2E5-1"}, "ts": "2023-07-09 11:50:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253-1"}, "ts": "2023-07-09 11:52:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07141"}, "ts": "2023-07-09 11:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-09 11:52:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CW1"}, "ts": "2023-07-09 11:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:53:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04791QM"}, "ts": "2023-07-09 11:53:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15054", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 11:53:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q15054", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 11:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G76384QV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:53:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76384QV"}, "ts": "2023-07-09 11:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 11:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56473", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 11:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56473"}, "ts": "2023-07-09 11:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 11:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-09 11:57:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-09 11:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:57:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43283"}, "ts": "2023-07-09 11:57:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43283", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:57:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 11:57:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULH4"}, "ts": "2023-07-09 11:57:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-09 11:58:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9ES70.206.206"}, "ts": "2023-07-09 11:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES70", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 11:58:43 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 12:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 12:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 12:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 12:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 12:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 12:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDS7"}, "ts": "2023-07-09 12:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:00:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-09 12:01:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23427326", "type": "PubMed"}, "ts": "2023-07-09 12:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23427326", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:02:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPD5"}, "ts": "2023-07-09 12:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42226"}, "ts": "2023-07-09 12:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 12:02:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78562"}, "ts": "2023-07-09 12:02:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H330"}, "ts": "2023-07-09 12:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78562", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 12:02:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-09 12:03:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61781"}, "ts": "2023-07-09 12:03:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61781", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:03:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:04:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53GQ0"}, "ts": "2023-07-09 12:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53GQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:04:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18550480", "type": "PubMed"}, "ts": "2023-07-09 12:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18550480", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:05:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:05:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14508"}, "ts": "2023-07-09 12:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:06:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02749.162.162"}, "ts": "2023-07-09 12:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02749", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:06:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-09 12:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:07:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1465414", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:07:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1465414", "type": "PubMed"}, "ts": "2023-07-09 12:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-09 12:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:08:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04791QM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 12:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:09:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU9"}, "ts": "2023-07-09 12:09:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41970-1"}, "ts": "2023-07-09 12:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41970-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:12:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13497", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:12:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13497"}, "ts": "2023-07-09 12:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:13:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29353"}, "ts": "2023-07-09 12:13:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25311"}, "ts": "2023-07-09 12:13:59 EDT-0400"}, {"api": "/data/section_download/", "req": {"id": "P18669", "download_type": "protein_section", "section": "expression_tissue", "format": "csv", "compressed": false}, "ts": "2023-07-09 12:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18669", "user": "Undecided", "type": "user", "page": "protein", "message": "csv"}, "ts": "2023-07-09 12:14:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:15:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95155.186.186"}, "ts": "2023-07-09 12:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36972", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36972"}, "ts": "2023-07-09 12:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23528"}, "ts": "2023-07-09 12:16:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80108"}, "ts": "2023-07-09 12:17:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-09 12:17:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01650"}, "ts": "2023-07-09 12:18:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD9"}, "ts": "2023-07-09 12:18:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-09 12:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18077"}, "ts": "2023-07-09 12:18:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29508"}, "ts": "2023-07-09 12:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16665"}, "ts": "2023-07-09 12:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05112"}, "ts": "2023-07-09 12:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6QL63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:19:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6QL63.198.198"}, "ts": "2023-07-09 12:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:19:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H307"}, "ts": "2023-07-09 12:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-09 12:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z7Z3"}, "ts": "2023-07-09 12:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z7Z3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:20:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04636", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:20:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04636"}, "ts": "2023-07-09 12:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00422", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:21:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00422"}, "ts": "2023-07-09 12:21:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ72"}, "ts": "2023-07-09 12:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:24:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6Z0-1"}, "ts": "2023-07-09 12:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6Z0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:24:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15104-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:24:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15104-1.104.104"}, "ts": "2023-07-09 12:24:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7590364", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:24:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7590364", "type": "PubMed"}, "ts": "2023-07-09 12:24:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8V4"}, "ts": "2023-07-09 12:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8V4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:24:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70800WO"}, "ts": "2023-07-09 12:24:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70800WO"}, "ts": "2023-07-09 12:24:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52479.208.208"}, "ts": "2023-07-09 12:25:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52479", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:25:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37275"}, "ts": "2023-07-09 12:25:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XV3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:26:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XV3-1"}, "ts": "2023-07-09 12:26:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXZ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:28:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXZ9"}, "ts": "2023-07-09 12:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:28:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:28:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0L6"}, "ts": "2023-07-09 12:28:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29353", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:29:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20983SP"}, "ts": "2023-07-09 12:29:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25311", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-09 12:30:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:30:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21127"}, "ts": "2023-07-09 12:30:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15465"}, "ts": "2023-07-09 12:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 12:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21768307", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:31:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21768307", "type": "PubMed"}, "ts": "2023-07-09 12:31:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30045946", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:31:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30045946", "type": "PubMed"}, "ts": "2023-07-09 12:31:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30045946", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 12:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23528", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:31:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63096"}, "ts": "2023-07-09 12:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYX4"}, "ts": "2023-07-09 12:32:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54707"}, "ts": "2023-07-09 12:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5ZPR3-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:32:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5ZPR3-1.104.104"}, "ts": "2023-07-09 12:32:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13133"}, "ts": "2023-07-09 12:32:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13133", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:33:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIE1"}, "ts": "2023-07-09 12:33:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:33:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-09 12:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:34:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18077", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:34:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731-1"}, "ts": "2023-07-09 12:35:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16665", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:35:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:35:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83858"}, "ts": "2023-07-09 12:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:35:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-09 12:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-09 12:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULL8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:37:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULL8"}, "ts": "2023-07-09 12:37:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:37:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLN9-1"}, "ts": "2023-07-09 12:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61586", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:38:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61586.34.34"}, "ts": "2023-07-09 12:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KRE0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 12:40:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KRE0"}, "ts": "2023-07-09 12:40:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294"}, "ts": "2023-07-09 12:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70800WO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 12:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44211QA"}, "ts": "2023-07-09 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-09 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70800WO"}, "ts": "2023-07-09 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15715XI"}, "ts": "2023-07-09 12:40:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03799FY"}, "ts": "2023-07-09 12:40:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:41:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17812"}, "ts": "2023-07-09 12:42:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVM2"}, "ts": "2023-07-09 12:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVM2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:43:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000064"}, "ts": "2023-07-09 12:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:44:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "15721257"}, "ts": "2023-07-09 12:44:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 12:44:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:45:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20983SP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 12:45:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI7"}, "ts": "2023-07-09 12:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TN88-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 12:45:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TN88-1"}, "ts": "2023-07-09 12:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:46:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15465", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VTT2"}, "ts": "2023-07-09 12:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:48:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y646"}, "ts": "2023-07-09 12:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y646", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-09 12:49:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:49:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34998"}, "ts": "2023-07-09 12:49:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17548356", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:49:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17548356", "type": "PubMed"}, "ts": "2023-07-09 12:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:49:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P86547-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P86547-1"}, "ts": "2023-07-09 12:49:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96ER3"}, "ts": "2023-07-09 12:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ER3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08AH3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:50:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08AH3.5.5"}, "ts": "2023-07-09 12:50:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31447097", "type": "PubMed"}, "ts": "2023-07-09 12:50:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31447097", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 12:50:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TPD3"}, "ts": "2023-07-09 12:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TPD3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTZ2"}, "ts": "2023-07-09 12:51:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C9JH25"}, "ts": "2023-07-09 12:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JH25", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02401"}, "ts": "2023-07-09 12:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02401", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGK7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33609NS"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23453IV"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84820NF"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82119TF"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71838YU"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-09 12:51:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:51:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70169-1"}, "ts": "2023-07-09 12:51:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70169-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:52:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54975"}, "ts": "2023-07-09 12:52:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g00052mo"}, "ts": "2023-07-09 12:52:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10361"}, "ts": "2023-07-09 12:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27391WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 12:52:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26038"}, "ts": "2023-07-09 12:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10321", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:52:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10321"}, "ts": "2023-07-09 12:52:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-09 12:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g00052mo", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 12:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49238-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49238-1"}, "ts": "2023-07-09 12:53:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70268-1.918.918"}, "ts": "2023-07-09 12:54:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70268-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 12:54:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PSV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35293"}, "ts": "2023-07-09 12:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35293", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PSV4"}, "ts": "2023-07-09 12:55:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR31"}, "ts": "2023-07-09 12:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62000", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62000"}, "ts": "2023-07-09 12:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1C8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1C8"}, "ts": "2023-07-09 12:55:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UE3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 12:56:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZD19", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 12:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZD19"}, "ts": "2023-07-09 12:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75112"}, "ts": "2023-07-09 12:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NF37-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:56:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NF37-1"}, "ts": "2023-07-09 12:56:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-09 12:57:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NE79"}, "ts": "2023-07-09 12:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE79", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:57:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MU8"}, "ts": "2023-07-09 12:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MU8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95376"}, "ts": "2023-07-09 12:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00238"}, "ts": "2023-07-09 12:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95376", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99K28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99K28"}, "ts": "2023-07-09 12:58:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60981-1"}, "ts": "2023-07-09 12:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:58:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30872", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 12:59:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30872"}, "ts": "2023-07-09 12:59:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-09 12:59:59 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 13:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 13:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 13:00:03 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 13:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 13:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 13:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-09 13:00:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULB5"}, "ts": "2023-07-09 13:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5V8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:00:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5V8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:00:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5V8"}, "ts": "2023-07-09 13:00:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5V8"}, "ts": "2023-07-09 13:00:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRK3"}, "ts": "2023-07-09 13:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:00:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA5"}, "ts": "2023-07-09 13:01:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99963-1"}, "ts": "2023-07-09 13:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99963-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0P3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0P3-1"}, "ts": "2023-07-09 13:01:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H422", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H422"}, "ts": "2023-07-09 13:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JG9"}, "ts": "2023-07-09 13:01:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBY5"}, "ts": "2023-07-09 13:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99618"}, "ts": "2023-07-09 13:01:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79379XF"}, "ts": "2023-07-09 13:02:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79379XF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:02:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD43", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:02:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HD43.1106.1106"}, "ts": "2023-07-09 13:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:03:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-09 13:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14222"}, "ts": "2023-07-09 13:05:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H422", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H422"}, "ts": "2023-07-09 13:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPU9"}, "ts": "2023-07-09 13:05:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H422", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:05:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H422"}, "ts": "2023-07-09 13:05:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-09 13:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75487"}, "ts": "2023-07-09 13:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKY5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:07:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKY5-1"}, "ts": "2023-07-09 13:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:08:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-09 13:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A670-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 13:09:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A670-1"}, "ts": "2023-07-09 13:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80700YJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:09:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80700YJ"}, "ts": "2023-07-09 13:09:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12382-1.529.529"}, "ts": "2023-07-09 13:09:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12382-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00805"}, "ts": "2023-07-09 13:09:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:09:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41250-1"}, "ts": "2023-07-09 13:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:10:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61981"}, "ts": "2023-07-09 13:10:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:10:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NNW5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 13:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NNW5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 13:10:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-09 13:11:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37231"}, "ts": "2023-07-09 13:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:11:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60220"}, "ts": "2023-07-09 13:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60220", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:11:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 13:12:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26100231", "type": "PubMed"}, "ts": "2023-07-09 13:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26100231", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 13:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18832586", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 13:12:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18832586", "type": "PubMed"}, "ts": "2023-07-09 13:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 13:13:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81827"}, "ts": "2023-07-09 13:13:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16606617", "type": "PubMed"}, "ts": "2023-07-09 13:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16606617", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 13:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:13:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXK5"}, "ts": "2023-07-09 13:13:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:14:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7N9"}, "ts": "2023-07-09 13:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7N9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:15:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NK8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:15:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96NK8.192.192"}, "ts": "2023-07-09 13:15:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14512", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:16:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14512"}, "ts": "2023-07-09 13:16:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:16:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82463GQ"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-09 13:16:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-09 13:16:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-09 13:16:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-09 13:16:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-09 13:16:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13434-1"}, "ts": "2023-07-09 13:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZSJ9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 13:17:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6ZSJ9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 13:17:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62894", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:17:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62894.559.559"}, "ts": "2023-07-09 13:17:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-09 13:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 13:19:18 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P43121", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 13:19:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DV7"}, "ts": "2023-07-09 13:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DI7"}, "ts": "2023-07-09 13:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94855"}, "ts": "2023-07-09 13:20:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-09 13:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:21:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:21:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-09 13:22:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-09 13:22:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-09 13:22:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:22:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:23:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-09 13:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:24:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969V1"}, "ts": "2023-07-09 13:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969V1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:25:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41250-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 13:26:05 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 13:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H943"}, "ts": "2023-07-09 13:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:26:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-09 13:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:27:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-09 13:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:28:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62849"}, "ts": "2023-07-09 13:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:29:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937"}, "ts": "2023-07-09 13:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71B07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:30:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71B07"}, "ts": "2023-07-09 13:30:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35926TG"}, "ts": "2023-07-09 13:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13434-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:34:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV33"}, "ts": "2023-07-09 13:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25382614", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 13:35:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25382614", "type": "PubMed"}, "ts": "2023-07-09 13:35:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:35:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS98"}, "ts": "2023-07-09 13:35:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22455", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:35:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22455.311.311"}, "ts": "2023-07-09 13:35:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23416.288.288"}, "ts": "2023-07-09 13:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23416", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:36:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWV2"}, "ts": "2023-07-09 13:36:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:36:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4ADV7"}, "ts": "2023-07-09 13:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4ADV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0X9-1"}, "ts": "2023-07-09 13:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0X9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:37:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXA5"}, "ts": "2023-07-09 13:37:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4B8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:37:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H4B8.336.336"}, "ts": "2023-07-09 13:37:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70268-1.918.918"}, "ts": "2023-07-09 13:39:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70268-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:39:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22309.515.515"}, "ts": "2023-07-09 13:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22309", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:40:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43819-1"}, "ts": "2023-07-09 13:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43819-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:41:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-09 13:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1H2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:41:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-09 13:41:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02771"}, "ts": "2023-07-09 13:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10981"}, "ts": "2023-07-09 13:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30711"}, "ts": "2023-07-09 13:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00033MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:43:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556"}, "ts": "2023-07-09 13:44:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61289"}, "ts": "2023-07-09 13:44:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7D4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:45:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7D4"}, "ts": "2023-07-09 13:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:45:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C6C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:45:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C6C1"}, "ts": "2023-07-09 13:45:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-09 13:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:45:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D42"}, "ts": "2023-07-09 13:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35926TG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49764", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:47:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49764"}, "ts": "2023-07-09 13:47:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00185NL"}, "ts": "2023-07-09 13:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00185NL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 13:48:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LC7"}, "ts": "2023-07-09 13:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94766"}, "ts": "2023-07-09 13:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:48:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L58"}, "ts": "2023-07-09 13:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08912", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:51:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08912"}, "ts": "2023-07-09 13:51:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-09 13:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BQM4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:54:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BQM4-1"}, "ts": "2023-07-09 13:54:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-09 13:54:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-09 13:54:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXV0"}, "ts": "2023-07-09 13:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:54:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08722.89.89"}, "ts": "2023-07-09 13:55:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:55:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-09 13:55:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:56:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15797-1"}, "ts": "2023-07-09 13:56:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15797-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:56:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-09 13:56:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:56:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00709"}, "ts": "2023-07-09 13:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00709", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:57:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L592.75.75"}, "ts": "2023-07-09 13:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L592", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 13:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:58:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43007"}, "ts": "2023-07-09 13:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:59:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:59:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z739"}, "ts": "2023-07-09 13:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RXH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:59:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RXH8"}, "ts": "2023-07-09 13:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95999", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 13:59:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95999"}, "ts": "2023-07-09 14:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 14:00:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 14:00:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 14:00:04 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 14:00:05 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 14:00:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 14:00:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:00:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3014347", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:00:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3014347", "type": "PubMed"}, "ts": "2023-07-09 14:00:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9780000", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:00:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9780000", "type": "PubMed"}, "ts": "2023-07-09 14:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACE4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACE4-1"}, "ts": "2023-07-09 14:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZSJ9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 14:02:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6ZSJ9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 14:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JM2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:03:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JM2.740.740"}, "ts": "2023-07-09 14:03:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10425SO"}, "ts": "2023-07-09 14:04:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:04:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP3"}, "ts": "2023-07-09 14:04:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:04:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-09 14:05:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11488"}, "ts": "2023-07-09 14:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UN71"}, "ts": "2023-07-09 14:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UN71", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35555-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:06:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35555-1.2178.2178"}, "ts": "2023-07-09 14:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4ZHG4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:06:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4ZHG4"}, "ts": "2023-07-09 14:06:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUP7"}, "ts": "2023-07-09 14:07:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4V2-1"}, "ts": "2023-07-09 14:07:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4V2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08473", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13987-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:07:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13987-1.43.43"}, "ts": "2023-07-09 14:07:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-09 14:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10761-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12952", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80700YJ"}, "ts": "2023-07-09 14:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80700YJ", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 14:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22234", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22234"}, "ts": "2023-07-09 14:07:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04900-1"}, "ts": "2023-07-09 14:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04900-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:07:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03135-1"}, "ts": "2023-07-09 14:08:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05512", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:08:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05512"}, "ts": "2023-07-09 14:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14789", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:08:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14789.538.538"}, "ts": "2023-07-09 14:08:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-09 14:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:09:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60664.31.31"}, "ts": "2023-07-09 14:09:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2L1.817.817"}, "ts": "2023-07-09 14:10:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2L1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:10:03 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000060", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 14:10:06 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000060", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 14:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000060", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 14:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:10:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15643", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:12:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15643.552.552"}, "ts": "2023-07-09 14:12:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG81-1"}, "ts": "2023-07-09 14:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG81-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXJ1"}, "ts": "2023-07-09 14:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UB35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:13:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UB35"}, "ts": "2023-07-09 14:13:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5RJY4"}, "ts": "2023-07-09 14:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:13:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-09 14:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:14:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02446", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 14:15:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q02446", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 14:15:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-09 14:15:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94768"}, "ts": "2023-07-09 14:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27236336", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:16:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27236336", "type": "PubMed"}, "ts": "2023-07-09 14:16:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-09 14:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30068914", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:17:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30068914", "type": "PubMed"}, "ts": "2023-07-09 14:17:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16650"}, "ts": "2023-07-09 14:18:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-09 14:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5J9-1"}, "ts": "2023-07-09 14:19:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10425SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:20:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12965", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:20:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12965"}, "ts": "2023-07-09 14:20:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19812234", "type": "PubMed"}, "ts": "2023-07-09 14:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19812234", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:21:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000053", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 14:21:27 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000053", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 14:21:27 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000053", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 14:21:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 14:21:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21581"}, "ts": "2023-07-09 14:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:21:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15550-1.313.313"}, "ts": "2023-07-09 14:21:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15550-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:22:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4C0"}, "ts": "2023-07-09 14:22:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:23:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TP1"}, "ts": "2023-07-09 14:23:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TP1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:23:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:23:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63069TR"}, "ts": "2023-07-09 14:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63069TR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R327", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:23:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6R327.1282.1282"}, "ts": "2023-07-09 14:23:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAV3"}, "ts": "2023-07-09 14:24:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01877-1.47.47"}, "ts": "2023-07-09 14:24:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01877-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:24:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01877-1", "user": "Undecided", "type": "error", "page": "Siteview", "message": "Network error. Site Detail api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 14:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17655", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:24:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17655.50.50"}, "ts": "2023-07-09 14:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:24:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZZ6"}, "ts": "2023-07-09 14:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05209", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:24:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-09 14:24:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05209.371.371"}, "ts": "2023-07-09 14:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14514", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:24:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14514"}, "ts": "2023-07-09 14:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14514", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 14:24:49 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O14514", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 14:24:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613"}, "ts": "2023-07-09 14:25:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75462.292.292"}, "ts": "2023-07-09 14:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19745154", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:25:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19745154", "type": "PubMed"}, "ts": "2023-07-09 14:25:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14174"}, "ts": "2023-07-09 14:26:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-09 14:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVV5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:26:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVV5"}, "ts": "2023-07-09 14:26:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92556"}, "ts": "2023-07-09 14:27:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:27:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29322AW"}, "ts": "2023-07-09 14:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29322AW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMR5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:27:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMR5"}, "ts": "2023-07-09 14:27:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987"}, "ts": "2023-07-09 14:27:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56856"}, "ts": "2023-07-09 14:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13987", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27661", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:27:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27661.2.2"}, "ts": "2023-07-09 14:27:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16394", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:28:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16394.496.496"}, "ts": "2023-07-09 14:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:29:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z127"}, "ts": "2023-07-09 14:29:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38606.384.384"}, "ts": "2023-07-09 14:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08473", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:29:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08473"}, "ts": "2023-07-09 14:29:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10761-1"}, "ts": "2023-07-09 14:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38606", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10761-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:29:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0U3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:29:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H0U3.172.172"}, "ts": "2023-07-09 14:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQ10-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:29:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQ10-1"}, "ts": "2023-07-09 14:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:30:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A5YKK6"}, "ts": "2023-07-09 14:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A5YKK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:30:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92673.487.487"}, "ts": "2023-07-09 14:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:31:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "J3QMK1"}, "ts": "2023-07-09 14:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "J3QMK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VE47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:32:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VE47"}, "ts": "2023-07-09 14:32:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570"}, "ts": "2023-07-09 14:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11680", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:32:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11680"}, "ts": "2023-07-09 14:32:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-09 14:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:32:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6KF10"}, "ts": "2023-07-09 14:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6KF10", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:32:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K4J6.360.360"}, "ts": "2023-07-09 14:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4J6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:32:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20333396", "type": "PubMed"}, "ts": "2023-07-09 14:32:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20333396", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:32:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60237"}, "ts": "2023-07-09 14:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:33:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YBV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:33:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YBV0"}, "ts": "2023-07-09 14:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:34:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVH2-1"}, "ts": "2023-07-09 14:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVH2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:34:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10915"}, "ts": "2023-07-09 14:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10915", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82987", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:34:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82987"}, "ts": "2023-07-09 14:34:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93008"}, "ts": "2023-07-09 14:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:35:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP3"}, "ts": "2023-07-09 14:35:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14514"}, "ts": "2023-07-09 14:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14514", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 14:36:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF09"}, "ts": "2023-07-09 14:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF09", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 14:36:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70268-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:36:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70268-1.920.920"}, "ts": "2023-07-09 14:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13315"}, "ts": "2023-07-09 14:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:37:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50454"}, "ts": "2023-07-09 14:38:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-09 14:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19026783", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:38:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19026783", "type": "PubMed"}, "ts": "2023-07-09 14:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1E3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:39:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1E3.14.14"}, "ts": "2023-07-09 14:39:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-09 14:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61666", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:40:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61666"}, "ts": "2023-07-09 14:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYH8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:40:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYH8"}, "ts": "2023-07-09 14:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22768VO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:41:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BWY9-1"}, "ts": "2023-07-09 14:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BWY9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:41:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08174"}, "ts": "2023-07-09 14:41:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UF4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:41:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UF4"}, "ts": "2023-07-09 14:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08834-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:41:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394"}, "ts": "2023-07-09 14:41:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08834-1"}, "ts": "2023-07-09 14:41:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA56"}, "ts": "2023-07-09 14:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:41:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y226"}, "ts": "2023-07-09 14:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15895073", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:42:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15895073", "type": "PubMed"}, "ts": "2023-07-09 14:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54802", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:42:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54802.207.207"}, "ts": "2023-07-09 14:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29370175", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:42:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29370175", "type": "PubMed"}, "ts": "2023-07-09 14:42:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:42:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08357"}, "ts": "2023-07-09 14:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8885868", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:42:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8885868", "type": "PubMed"}, "ts": "2023-07-09 14:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69ZQ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:43:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69ZQ2-1"}, "ts": "2023-07-09 14:43:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N163"}, "ts": "2023-07-09 14:43:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N163", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:43:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00115"}, "ts": "2023-07-09 14:43:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:43:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55083"}, "ts": "2023-07-09 14:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:43:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-09 14:43:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-09 14:43:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-09 14:43:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46687AB"}, "ts": "2023-07-09 14:43:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-09 14:43:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66760KM"}, "ts": "2023-07-09 14:43:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-09 14:43:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-09 14:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56856", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:43:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-09 14:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:44:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:45:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VH5"}, "ts": "2023-07-09 14:45:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:45:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46459"}, "ts": "2023-07-09 14:46:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-09 14:46:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75369"}, "ts": "2023-07-09 14:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 14:47:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9311998"}, "ts": "2023-07-09 14:47:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 14:47:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-09 14:48:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30837", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:48:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30837"}, "ts": "2023-07-09 14:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75152", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:48:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75152.805.805"}, "ts": "2023-07-09 14:48:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10852"}, "ts": "2023-07-09 14:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10852", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92930"}, "ts": "2023-07-09 14:49:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92930", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:49:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25440"}, "ts": "2023-07-09 14:49:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25440", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:49:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q12929", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 14:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12929", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 14:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:50:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08185-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:51:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08185-1.31.31"}, "ts": "2023-07-09 14:51:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04150.42.42"}, "ts": "2023-07-09 14:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04150", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:51:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9ULX9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 14:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 14:51:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-09 14:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38532-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:51:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38532-1.320.320"}, "ts": "2023-07-09 14:51:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V6K6-1"}, "ts": "2023-07-09 14:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V6K6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:52:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O95159", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 14:52:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95159", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 14:52:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15550-1.313.313"}, "ts": "2023-07-09 14:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15550-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:52:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPH5"}, "ts": "2023-07-09 14:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:52:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BP27.67.67"}, "ts": "2023-07-09 14:52:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BP27", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:52:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCS4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:52:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NCS4.136.136"}, "ts": "2023-07-09 14:52:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QD51-1"}, "ts": "2023-07-09 14:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QD51-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13315", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G76610HM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:53:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 14:53:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76610HM"}, "ts": "2023-07-09 14:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:53:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2T1"}, "ts": "2023-07-09 14:53:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:53:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08581-1.405.405"}, "ts": "2023-07-09 14:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JL96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:54:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JL96"}, "ts": "2023-07-09 14:54:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39019"}, "ts": "2023-07-09 14:54:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02858.1100.1100"}, "ts": "2023-07-09 14:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:54:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60573", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:55:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60573.223.223"}, "ts": "2023-07-09 14:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:57:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04900-1.26.26"}, "ts": "2023-07-09 14:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04900-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 14:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08357", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:58:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64093", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64093"}, "ts": "2023-07-09 14:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00115", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:59:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:59:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-09 14:59:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62316", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:59:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62316"}, "ts": "2023-07-09 14:59:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 14:59:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA56"}, "ts": "2023-07-09 14:59:54 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 15:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 15:00:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08855PJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 15:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 15:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 15:00:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08855PJ"}, "ts": "2023-07-09 15:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 15:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 15:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06330"}, "ts": "2023-07-09 15:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX39", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:00:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX39"}, "ts": "2023-07-09 15:00:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275"}, "ts": "2023-07-09 15:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80858MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 15:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:03:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NCS4.136.136"}, "ts": "2023-07-09 15:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19001859", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:03:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19001859", "type": "PubMed"}, "ts": "2023-07-09 15:03:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6QNK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:03:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6QNK2"}, "ts": "2023-07-09 15:03:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-09 15:03:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-09 15:03:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-09 15:03:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12830"}, "ts": "2023-07-09 15:05:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22894897", "type": "PubMed"}, "ts": "2023-07-09 15:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22894897", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25944111", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:06:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25944111", "type": "PubMed"}, "ts": "2023-07-09 15:06:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19420245", "type": "PubMed"}, "ts": "2023-07-09 15:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19420245", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51690", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:07:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51690.491.491"}, "ts": "2023-07-09 15:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:07:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6TCG5-1"}, "ts": "2023-07-09 15:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-09 15:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6TCG5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:08:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-09 15:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:08:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41440"}, "ts": "2023-07-09 15:10:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41440", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:10:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75094"}, "ts": "2023-07-09 15:10:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75094", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:10:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYP7"}, "ts": "2023-07-09 15:11:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43852"}, "ts": "2023-07-09 15:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43852", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:13:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070-1"}, "ts": "2023-07-09 15:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:13:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HD1"}, "ts": "2023-07-09 15:13:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-09 15:13:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:14:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11766"}, "ts": "2023-07-09 15:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:14:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38532-1.320.320"}, "ts": "2023-07-09 15:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38532-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:14:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O95159", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95159", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0GE19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0GE19"}, "ts": "2023-07-09 15:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46098"}, "ts": "2023-07-09 15:14:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:14:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P0X4.246.246"}, "ts": "2023-07-09 15:14:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0X4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:14:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95477"}, "ts": "2023-07-09 15:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:15:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32766"}, "ts": "2023-07-09 15:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CF82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:16:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CF82"}, "ts": "2023-07-09 15:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60663"}, "ts": "2023-07-09 15:16:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y620", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:16:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y620"}, "ts": "2023-07-09 15:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:16:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6M9"}, "ts": "2023-07-09 15:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:16:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:16:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT09"}, "ts": "2023-07-09 15:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:17:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZZ5"}, "ts": "2023-07-09 15:17:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:17:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-09 15:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4N8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:18:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4N8-1"}, "ts": "2023-07-09 15:18:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00846", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:19:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P00846", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00846", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 15:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10070-5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10070-5"}, "ts": "2023-07-09 15:19:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80WT4"}, "ts": "2023-07-09 15:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80WT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:20:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32418"}, "ts": "2023-07-09 15:20:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00295-1"}, "ts": "2023-07-09 15:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00295-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05305", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05305"}, "ts": "2023-07-09 15:21:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:21:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19260141", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:21:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19260141", "type": "PubMed"}, "ts": "2023-07-09 15:21:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:21:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKD1"}, "ts": "2023-07-09 15:21:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15162.69.69"}, "ts": "2023-07-09 15:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15162", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:22:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02751.633.633"}, "ts": "2023-07-09 15:22:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2306472", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:23:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2306472", "type": "PubMed"}, "ts": "2023-07-09 15:23:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95786-1"}, "ts": "2023-07-09 15:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95786-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06744", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:23:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06744"}, "ts": "2023-07-09 15:23:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-09 15:23:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-09 15:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4C8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:23:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N4C8.890.890"}, "ts": "2023-07-09 15:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:24:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19814"}, "ts": "2023-07-09 15:24:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:24:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04900-1.26.26"}, "ts": "2023-07-09 15:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04900-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:24:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PQ6-1"}, "ts": "2023-07-09 15:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PQ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-09 15:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-09 15:25:45 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-09 15:25:46 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 15:25:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 15:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2APT9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 15:26:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2APT9"}, "ts": "2023-07-09 15:26:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53621"}, "ts": "2023-07-09 15:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53621", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:26:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15548568", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:26:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15548568", "type": "PubMed"}, "ts": "2023-07-09 15:26:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46013.705.705"}, "ts": "2023-07-09 15:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:26:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15021LG"}, "ts": "2023-07-09 15:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99426"}, "ts": "2023-07-09 15:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H246", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:27:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H246"}, "ts": "2023-07-09 15:27:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21290RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 15:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32299", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:28:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32299"}, "ts": "2023-07-09 15:28:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99805"}, "ts": "2023-07-09 15:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:29:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-09 15:29:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-09 15:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:30:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25205", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:30:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P25205", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80W57", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80W57"}, "ts": "2023-07-09 15:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16695", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:30:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16695.81.81"}, "ts": "2023-07-09 15:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H8A4"}, "ts": "2023-07-09 15:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H8A4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JP2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:31:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JP2"}, "ts": "2023-07-09 15:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27930960", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:32:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27930960", "type": "PubMed"}, "ts": "2023-07-09 15:32:08 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000060", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 15:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 15:32:10 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000060", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 15:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000060", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 15:32:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11680"}, "ts": "2023-07-09 15:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11680", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:32:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63HM9.245.245"}, "ts": "2023-07-09 15:32:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 15:33:00 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 15:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 15:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46087", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:33:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46087"}, "ts": "2023-07-09 15:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:35:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01597"}, "ts": "2023-07-09 15:35:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V72-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:35:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V72-1"}, "ts": "2023-07-09 15:35:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TIA1.25.25"}, "ts": "2023-07-09 15:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TIA1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:35:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:35:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28301"}, "ts": "2023-07-09 15:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28301", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:35:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TZA2.465.465"}, "ts": "2023-07-09 15:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TZA2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:35:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-09 15:35:52 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000022", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 15:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000022", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 15:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20853", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20853.131.131"}, "ts": "2023-07-09 15:35:56 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000022", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 15:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ET09-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:36:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ET09-1"}, "ts": "2023-07-09 15:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49137", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:36:53 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P49137", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:36:53 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96BR1-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:36:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BR1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:36:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12336", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12336"}, "ts": "2023-07-09 15:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-09 15:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:38:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-09 15:38:29 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000025", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 15:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000025", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 15:38:38 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000025", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 15:38:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18065"}, "ts": "2023-07-09 15:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56749GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 15:39:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:39:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75916", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:40:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75916.515.515"}, "ts": "2023-07-09 15:40:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z353", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 15:40:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z353"}, "ts": "2023-07-09 15:40:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95264.138.138"}, "ts": "2023-07-09 15:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:42:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RK0"}, "ts": "2023-07-09 15:42:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15021LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 15:42:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05387"}, "ts": "2023-07-09 15:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05387", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:42:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06576"}, "ts": "2023-07-09 15:42:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15586"}, "ts": "2023-07-09 15:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15586", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:43:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9399639", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:43:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9399639", "type": "PubMed"}, "ts": "2023-07-09 15:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:44:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XU0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:44:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XU0-1"}, "ts": "2023-07-09 15:44:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26039ES"}, "ts": "2023-07-09 15:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26039ES", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 15:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 15:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XV3-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:45:02 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q91XV3-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:45:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N239.120.120"}, "ts": "2023-07-09 15:45:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N239", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:45:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:45:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11532"}, "ts": "2023-07-09 15:45:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:45:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48723"}, "ts": "2023-07-09 15:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48723", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:45:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-09 15:45:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D98"}, "ts": "2023-07-09 15:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25250574", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:47:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25250574", "type": "PubMed"}, "ts": "2023-07-09 15:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00273", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00273"}, "ts": "2023-07-09 15:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA0"}, "ts": "2023-07-09 15:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:48:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-09 15:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24161", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:50:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24161.153.153"}, "ts": "2023-07-09 15:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15091", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:50:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15091.430.430"}, "ts": "2023-07-09 15:50:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0J6"}, "ts": "2023-07-09 15:50:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60603"}, "ts": "2023-07-09 15:50:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0J6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:50:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11388-1"}, "ts": "2023-07-09 15:51:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30134159", "type": "PubMed"}, "ts": "2023-07-09 15:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30134159", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:51:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04202"}, "ts": "2023-07-09 15:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04202", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:51:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPY2-1"}, "ts": "2023-07-09 15:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPY2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYC3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:52:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QYC3.25.25"}, "ts": "2023-07-09 15:52:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99653-1"}, "ts": "2023-07-09 15:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:52:15 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5G2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:52:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-09 15:52:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P43121", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 15:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 15:52:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-09 15:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHH6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:52:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHH6-1"}, "ts": "2023-07-09 15:52:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUM4-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:52:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUM4-1.177.177"}, "ts": "2023-07-09 15:52:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02311IE"}, "ts": "2023-07-09 15:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:53:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RD7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:53:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60664.62.62"}, "ts": "2023-07-09 15:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:53:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD7"}, "ts": "2023-07-09 15:53:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RD7"}, "ts": "2023-07-09 15:53:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JR98.142.142"}, "ts": "2023-07-09 15:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JR98", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:53:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15654.92.92"}, "ts": "2023-07-09 15:54:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15654", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:54:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15735697", "type": "PubMed"}, "ts": "2023-07-09 15:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15735697", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:54:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:54:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-09 15:54:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QWI6-1"}, "ts": "2023-07-09 15:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QWI6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18065", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13610"}, "ts": "2023-07-09 15:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13610", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:55:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWY5"}, "ts": "2023-07-09 15:56:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:56:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VDU0.564.564"}, "ts": "2023-07-09 15:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDU0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52907"}, "ts": "2023-07-09 15:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR09"}, "ts": "2023-07-09 15:56:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:57:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKY4"}, "ts": "2023-07-09 15:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:57:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15047"}, "ts": "2023-07-09 15:57:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P85037"}, "ts": "2023-07-09 15:57:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12071861", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:58:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12071861", "type": "PubMed"}, "ts": "2023-07-09 15:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15081367", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:58:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15081367", "type": "PubMed"}, "ts": "2023-07-09 15:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KNS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:58:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3KNS6.176.176"}, "ts": "2023-07-09 15:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4V1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15292341", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 15:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4V1-1"}, "ts": "2023-07-09 15:58:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15292341", "type": "PubMed"}, "ts": "2023-07-09 15:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09426-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:59:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09426-1"}, "ts": "2023-07-09 15:59:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25119.69.69"}, "ts": "2023-07-09 15:59:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25119", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 15:59:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q69Z61-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 15:59:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q69Z61-1"}, "ts": "2023-07-09 15:59:54 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 16:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 16:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 16:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 16:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 16:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 16:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70362-1"}, "ts": "2023-07-09 16:00:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BHN3.97.97"}, "ts": "2023-07-09 16:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHN3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70362-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CI71", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CI71"}, "ts": "2023-07-09 16:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12837246", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:02:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12837246", "type": "PubMed"}, "ts": "2023-07-09 16:02:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49225WK"}, "ts": "2023-07-09 16:02:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13611"}, "ts": "2023-07-09 16:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHG6"}, "ts": "2023-07-09 16:02:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHG6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:02:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16558", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:02:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16558"}, "ts": "2023-07-09 16:02:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-09 16:03:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H293", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 16:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 16:03:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H293", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 16:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26638071", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:04:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26638071", "type": "PubMed"}, "ts": "2023-07-09 16:04:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DF46-1"}, "ts": "2023-07-09 16:04:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DF46-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:05:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55769"}, "ts": "2023-07-09 16:05:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11388-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:05:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26247726", "type": "PubMed"}, "ts": "2023-07-09 16:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26247726", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:06:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-09 16:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:06:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:07:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Y2X3"}, "ts": "2023-07-09 16:07:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Y2X3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:07:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZW31-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:07:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZW31-1"}, "ts": "2023-07-09 16:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3SHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:08:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3SHH9"}, "ts": "2023-07-09 16:08:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-09 16:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02311IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:08:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BS35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:09:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BS35"}, "ts": "2023-07-09 16:09:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35956"}, "ts": "2023-07-09 16:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:10:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:10:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12956"}, "ts": "2023-07-09 16:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:10:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60732.176.176"}, "ts": "2023-07-09 16:10:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-09 16:10:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60732", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:10:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSK2-1"}, "ts": "2023-07-09 16:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSK2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:11:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16452"}, "ts": "2023-07-09 16:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99K95-1"}, "ts": "2023-07-09 16:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99K95-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:11:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96DC7.285.285"}, "ts": "2023-07-09 16:11:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DC7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9271117", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:12:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9271117", "type": "PubMed"}, "ts": "2023-07-09 16:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23416", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:13:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23416.288.288"}, "ts": "2023-07-09 16:13:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14CZ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:13:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14CZ7.130.130"}, "ts": "2023-07-09 16:13:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36414FS"}, "ts": "2023-07-09 16:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:13:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQR3"}, "ts": "2023-07-09 16:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:13:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43889", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:13:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43889.94.94"}, "ts": "2023-07-09 16:14:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13506.161.161"}, "ts": "2023-07-09 16:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13506", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:14:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IW41"}, "ts": "2023-07-09 16:14:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92484"}, "ts": "2023-07-09 16:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92484", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:15:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26237645", "type": "PubMed"}, "ts": "2023-07-09 16:15:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26237645", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:15:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7935391", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:16:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7935391", "type": "PubMed"}, "ts": "2023-07-09 16:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96C19", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:16:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96C19.83.83"}, "ts": "2023-07-09 16:16:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49225WK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:18:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20823"}, "ts": "2023-07-09 16:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13611", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08146BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:19:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99PE8.585.585"}, "ts": "2023-07-09 16:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PE8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:19:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H488"}, "ts": "2023-07-09 16:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70362-1"}, "ts": "2023-07-09 16:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05777RN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:20:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05777RN"}, "ts": "2023-07-09 16:20:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70362-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:20:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-09 16:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 16:20:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9ULX9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 16:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-09 16:21:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51841.616.616"}, "ts": "2023-07-09 16:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51841", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51812-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 16:21:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P51812-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 16:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NNW5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 16:22:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NNW5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 16:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UL3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:22:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UL3.313.313"}, "ts": "2023-07-09 16:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:23:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23922714", "type": "PubMed"}, "ts": "2023-07-09 16:23:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2E6"}, "ts": "2023-07-09 16:23:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23922714", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:24:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHH9"}, "ts": "2023-07-09 16:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:24:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07483YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "static", "message": "page access"}, "ts": "2023-07-09 16:25:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95936.26.26"}, "ts": "2023-07-09 16:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95936", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z5L9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:27:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z5L9"}, "ts": "2023-07-09 16:27:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7K6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:28:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7K6"}, "ts": "2023-07-09 16:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20976249", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:28:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20976249", "type": "PubMed"}, "ts": "2023-07-09 16:28:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:29:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-09 16:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:29:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-09 16:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36414FS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15015"}, "ts": "2023-07-09 16:29:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15015", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license.html", "message": "page access"}, "ts": "2023-07-09 16:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15716352", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:30:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15716352", "type": "PubMed"}, "ts": "2023-07-09 16:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:31:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14174"}, "ts": "2023-07-09 16:31:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92625", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:31:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92625"}, "ts": "2023-07-09 16:31:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UW88"}, "ts": "2023-07-09 16:31:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UW88", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:32:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:32:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13727"}, "ts": "2023-07-09 16:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:34:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22455"}, "ts": "2023-07-09 16:34:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:34:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14435.132.132"}, "ts": "2023-07-09 16:34:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:34:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15118"}, "ts": "2023-07-09 16:34:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38432", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:35:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13501"}, "ts": "2023-07-09 16:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:35:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38432.184.184"}, "ts": "2023-07-09 16:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-09 16:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70268-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:36:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70268-1.377.377"}, "ts": "2023-07-09 16:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07358", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:36:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07358"}, "ts": "2023-07-09 16:36:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15012588", "type": "PubMed"}, "ts": "2023-07-09 16:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15012588", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63470-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:37:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01031-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:37:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63470-1"}, "ts": "2023-07-09 16:37:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25445"}, "ts": "2023-07-09 16:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98862DB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:38:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98862DB"}, "ts": "2023-07-09 16:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-09 16:38:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:38:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07071-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:38:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07071-1"}, "ts": "2023-07-09 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54498TF"}, "ts": "2023-07-09 16:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQC6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:39:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQC6"}, "ts": "2023-07-09 16:39:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14410"}, "ts": "2023-07-09 16:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14410", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71069MN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:42:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71069MN"}, "ts": "2023-07-09 16:42:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWV2"}, "ts": "2023-07-09 16:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60716"}, "ts": "2023-07-09 16:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP59"}, "ts": "2023-07-09 16:43:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07113"}, "ts": "2023-07-09 16:44:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:44:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50502"}, "ts": "2023-07-09 16:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQF2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:45:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQF2"}, "ts": "2023-07-09 16:45:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92954-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:46:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92954-1.676.676"}, "ts": "2023-07-09 16:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHK6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHK6"}, "ts": "2023-07-09 16:46:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15104-1"}, "ts": "2023-07-09 16:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04075", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:48:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04075.39.39"}, "ts": "2023-07-09 16:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q059U7"}, "ts": "2023-07-09 16:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q059U7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27947YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 16:49:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27947YN"}, "ts": "2023-07-09 16:49:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7543319", "type": "PubMed"}, "ts": "2023-07-09 16:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7543319", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19329994", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:49:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19329994", "type": "PubMed"}, "ts": "2023-07-09 16:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-09 16:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEZ2-1"}, "ts": "2023-07-09 16:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:50:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14435", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16234-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16234-1"}, "ts": "2023-07-09 16:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZ48"}, "ts": "2023-07-09 16:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZ48", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:51:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Y2X3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:52:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Y2X3"}, "ts": "2023-07-09 16:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLB2"}, "ts": "2023-07-09 16:52:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14733", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:53:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14733.275.275"}, "ts": "2023-07-09 16:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25680266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:53:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25680266", "type": "PubMed"}, "ts": "2023-07-09 16:53:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:53:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5FWU5.85.85"}, "ts": "2023-07-09 16:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FWU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR50", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:53:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR50"}, "ts": "2023-07-09 16:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08727", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 16:54:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08727.35.35"}, "ts": "2023-07-09 16:54:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:54:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61513"}, "ts": "2023-07-09 16:54:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56277-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56277-1"}, "ts": "2023-07-09 16:55:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8872463", "type": "PubMed"}, "ts": "2023-07-09 16:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8872463", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 16:55:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08069"}, "ts": "2023-07-09 16:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 16:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000030", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-09 16:56:20 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000030", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-09 16:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50990-1"}, "ts": "2023-07-09 16:56:21 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000030", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-09 16:56:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VS8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:56:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VS8"}, "ts": "2023-07-09 16:56:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31151"}, "ts": "2023-07-09 16:56:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-09 16:57:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:57:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16875"}, "ts": "2023-07-09 16:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16875", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 16:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58389-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:58:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58389-1"}, "ts": "2023-07-09 16:58:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-09 16:58:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P49137", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 16:58:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49137", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 16:58:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75531"}, "ts": "2023-07-09 16:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:58:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75531"}, "ts": "2023-07-09 16:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:58:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75531"}, "ts": "2023-07-09 16:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:59:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75531"}, "ts": "2023-07-09 16:59:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:59:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75531"}, "ts": "2023-07-09 16:59:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75531"}, "ts": "2023-07-09 16:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:59:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 16:59:33 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 17:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 17:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 17:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 17:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 17:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 17:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07113", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42892", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:00:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42892"}, "ts": "2023-07-09 17:00:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12446846", "type": "PubMed"}, "ts": "2023-07-09 17:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12446846", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:00:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9553048", "type": "PubMed"}, "ts": "2023-07-09 17:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9553048", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:01:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-09 17:02:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-09 17:02:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR81-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:02:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR81-1"}, "ts": "2023-07-09 17:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15104-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08505", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:02:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08505"}, "ts": "2023-07-09 17:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01831", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01831"}, "ts": "2023-07-09 17:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15164"}, "ts": "2023-07-09 17:03:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54132.407.407"}, "ts": "2023-07-09 17:04:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70699", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:04:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70699"}, "ts": "2023-07-09 17:04:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:04:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52272.238.238"}, "ts": "2023-07-09 17:04:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52272", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:04:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10091649", "type": "PubMed"}, "ts": "2023-07-09 17:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10091649", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:05:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "26437631"}, "ts": "2023-07-09 17:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE71", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:06:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NE71.137.137"}, "ts": "2023-07-09 17:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:06:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9U2-1"}, "ts": "2023-07-09 17:06:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9U2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08861-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:07:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08861-1"}, "ts": "2023-07-09 17:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02750"}, "ts": "2023-07-09 17:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0K1"}, "ts": "2023-07-09 17:08:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0K1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q709C8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:09:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q709C8"}, "ts": "2023-07-09 17:09:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67988RO"}, "ts": "2023-07-09 17:09:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:10:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-09 17:10:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:10:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QUL6.569.569"}, "ts": "2023-07-09 17:11:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUL6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:11:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55038-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:11:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55038-1"}, "ts": "2023-07-09 17:11:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53990", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:11:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53990"}, "ts": "2023-07-09 17:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13470", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:11:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13470.502.502"}, "ts": "2023-07-09 17:11:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16627", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:11:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16627"}, "ts": "2023-07-09 17:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50990-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:12:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYV8-1"}, "ts": "2023-07-09 17:12:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYV8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:12:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-09 17:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:12:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12259", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55220VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 17:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KQ7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:14:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KQ7.463.463"}, "ts": "2023-07-09 17:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62484"}, "ts": "2023-07-09 17:15:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 17:17:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 17:18:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70491"}, "ts": "2023-07-09 17:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70491", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:18:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02760"}, "ts": "2023-07-09 17:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02760", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:19:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0D6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:19:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0D6"}, "ts": "2023-07-09 17:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EQ0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 17:19:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96EQ0", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 17:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 17:20:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LXU0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:20:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LXU0-1"}, "ts": "2023-07-09 17:20:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08670"}, "ts": "2023-07-09 17:21:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:21:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5U0"}, "ts": "2023-07-09 17:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5U0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:21:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75608"}, "ts": "2023-07-09 17:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75608", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3Q0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:21:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3Q0"}, "ts": "2023-07-09 17:21:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60894"}, "ts": "2023-07-09 17:22:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:22:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-09 17:22:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-09 17:24:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 17:24:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-09 17:24:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 17:24:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C1Z6"}, "ts": "2023-07-09 17:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C1Z6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13409", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:24:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13409"}, "ts": "2023-07-09 17:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17054726", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:25:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17054726", "type": "PubMed"}, "ts": "2023-07-09 17:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:25:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16871"}, "ts": "2023-07-09 17:25:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67988RO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 17:25:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:25:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-09 17:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12778", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:26:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12778.519.519"}, "ts": "2023-07-09 17:26:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8132774", "type": "PubMed"}, "ts": "2023-07-09 17:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8132774", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30559217", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:29:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30559217", "type": "PubMed"}, "ts": "2023-07-09 17:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWL2"}, "ts": "2023-07-09 17:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWL2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:29:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:30:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09235"}, "ts": "2023-07-09 17:30:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y334.385.385"}, "ts": "2023-07-09 17:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y334", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62484", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZT5-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 17:31:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZT5-1"}, "ts": "2023-07-09 17:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 17:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZ42"}, "ts": "2023-07-09 17:32:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15155"}, "ts": "2023-07-09 17:32:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:32:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19287344", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:32:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19287344", "type": "PubMed"}, "ts": "2023-07-09 17:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12591932", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:32:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12591932", "type": "PubMed"}, "ts": "2023-07-09 17:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P032-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:32:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P032-1"}, "ts": "2023-07-09 17:32:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43556", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:33:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43556"}, "ts": "2023-07-09 17:33:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGN1"}, "ts": "2023-07-09 17:34:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:34:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-09 17:34:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:34:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11362"}, "ts": "2023-07-09 17:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:35:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58418"}, "ts": "2023-07-09 17:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LBC6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:36:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7LBC6.480.480"}, "ts": "2023-07-09 17:36:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19584355", "type": "PubMed"}, "ts": "2023-07-09 17:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19584355", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:36:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-09 17:36:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08670", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:37:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01019"}, "ts": "2023-07-09 17:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:37:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-09 17:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:38:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RI0"}, "ts": "2023-07-09 17:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47774", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:38:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47774"}, "ts": "2023-07-09 17:38:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5L7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:38:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5L7.281.281"}, "ts": "2023-07-09 17:38:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1309971", "type": "PubMed"}, "ts": "2023-07-09 17:39:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1309971", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:39:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19096"}, "ts": "2023-07-09 17:39:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-09 17:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8331657", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:40:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8331657", "type": "PubMed"}, "ts": "2023-07-09 17:40:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:40:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-09 17:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:40:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q496F6"}, "ts": "2023-07-09 17:40:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q496F6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 17:41:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-09 17:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:41:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVK5"}, "ts": "2023-07-09 17:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:42:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HP4-1"}, "ts": "2023-07-09 17:42:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HP4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:42:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:42:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DMU2.44.44"}, "ts": "2023-07-09 17:42:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:42:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03886"}, "ts": "2023-07-09 17:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03886", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKQ9"}, "ts": "2023-07-09 17:42:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKQ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:42:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P2E9"}, "ts": "2023-07-09 17:42:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:42:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:42:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 17:42:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:42:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHI5"}, "ts": "2023-07-09 17:42:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:43:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07954.1058.1058"}, "ts": "2023-07-09 17:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQZ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQZ0"}, "ts": "2023-07-09 17:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSJ8"}, "ts": "2023-07-09 17:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31394-1"}, "ts": "2023-07-09 17:45:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48668.189.189"}, "ts": "2023-07-09 17:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48668", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:46:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "G3V0H7.338.338"}, "ts": "2023-07-09 17:46:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V0H7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQM1"}, "ts": "2023-07-09 17:46:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:47:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17160893", "type": "PubMed"}, "ts": "2023-07-09 17:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17160893", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:47:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JWF2"}, "ts": "2023-07-09 17:47:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-09 17:47:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-09 17:47:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08861-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:48:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08861-1"}, "ts": "2023-07-09 17:48:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11683997", "type": "PubMed"}, "ts": "2023-07-09 17:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11683997", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:48:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14669.85.85"}, "ts": "2023-07-09 17:49:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14669", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:49:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2X7.362.362"}, "ts": "2023-07-09 17:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2X7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H598", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:49:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H598.387.387"}, "ts": "2023-07-09 17:49:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1542691", "type": "PubMed"}, "ts": "2023-07-09 17:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1542691", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y662", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:50:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y662"}, "ts": "2023-07-09 17:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92997", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:50:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92997.697.697"}, "ts": "2023-07-09 17:50:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33215740", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:50:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33215740", "type": "PubMed"}, "ts": "2023-07-09 17:50:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21327084", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 17:51:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21327084", "type": "PubMed"}, "ts": "2023-07-09 17:51:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VF10-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 17:51:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 17:51:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8VF10-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 17:51:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IVL1-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 17:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVL1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 17:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VF10-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 17:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 17:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACN6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 17:52:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACN6"}, "ts": "2023-07-09 17:52:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01903"}, "ts": "2023-07-09 17:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01903", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-09 17:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU1"}, "ts": "2023-07-09 17:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-09 17:52:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13945"}, "ts": "2023-07-09 17:52:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20151"}, "ts": "2023-07-09 17:52:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08254", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08254"}, "ts": "2023-07-09 17:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:52:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34998"}, "ts": "2023-07-09 17:52:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22223"}, "ts": "2023-07-09 17:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2A9"}, "ts": "2023-07-09 17:53:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-09 17:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUX9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:53:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUX9-1"}, "ts": "2023-07-09 17:53:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10163CV"}, "ts": "2023-07-09 17:54:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-09 17:54:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:54:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29350"}, "ts": "2023-07-09 17:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15460"}, "ts": "2023-07-09 17:55:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:56:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61981.59.59"}, "ts": "2023-07-09 17:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61981", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR34-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR34-1"}, "ts": "2023-07-09 17:57:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00959", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 17:58:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00959.380.380"}, "ts": "2023-07-09 17:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1J3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 17:59:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1J3-1"}, "ts": "2023-07-09 17:59:37 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 18:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 18:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 18:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 18:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 18:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 18:00:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11554796", "type": "PubMed"}, "ts": "2023-07-09 18:00:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11554796", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:01:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231-1"}, "ts": "2023-07-09 18:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34971"}, "ts": "2023-07-09 18:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34971", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31394-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:01:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07343"}, "ts": "2023-07-09 18:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07343", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05160", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:02:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05160"}, "ts": "2023-07-09 18:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95786", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:03:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95786.599.599"}, "ts": "2023-07-09 18:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51654"}, "ts": "2023-07-09 18:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52333-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:03:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52333-1"}, "ts": "2023-07-09 18:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64581RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:03:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4L1-1.830.830"}, "ts": "2023-07-09 18:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4L1-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IF00", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:05:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IF00.262.262"}, "ts": "2023-07-09 18:05:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:05:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05513.560.560"}, "ts": "2023-07-09 18:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05513", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:05:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15031.402.402"}, "ts": "2023-07-09 18:05:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15031", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:05:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62717.96.96"}, "ts": "2023-07-09 18:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62717", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:06:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30153.359.359"}, "ts": "2023-07-09 18:06:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30153", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:06:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09028"}, "ts": "2023-07-09 18:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09028", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:06:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-09 18:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y490", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:07:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y490.916.916"}, "ts": "2023-07-09 18:07:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-09 18:08:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48769"}, "ts": "2023-07-09 18:08:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48769", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13257", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:08:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13257.170.170"}, "ts": "2023-07-09 18:08:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17096.21.21"}, "ts": "2023-07-09 18:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17096", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11401424", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:08:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11401424", "type": "PubMed"}, "ts": "2023-07-09 18:08:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-09 18:09:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:09:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23400877", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:10:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23400877", "type": "PubMed"}, "ts": "2023-07-09 18:10:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7N3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 18:10:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5T7N3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 18:10:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:10:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAF7"}, "ts": "2023-07-09 18:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:11:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N472"}, "ts": "2023-07-09 18:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N472", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:12:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55075"}, "ts": "2023-07-09 18:12:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16234-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:12:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16234-1"}, "ts": "2023-07-09 18:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13617", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:12:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13617"}, "ts": "2023-07-09 18:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:13:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-09 18:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29625199", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:13:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29625199", "type": "PubMed"}, "ts": "2023-07-09 18:13:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-09 18:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:14:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0P5P2"}, "ts": "2023-07-09 18:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0P5P2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:14:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01769FS"}, "ts": "2023-07-09 18:14:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01769FS"}, "ts": "2023-07-09 18:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q30201"}, "ts": "2023-07-09 18:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q30201", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MII6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:15:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3MII6"}, "ts": "2023-07-09 18:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:16:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47871"}, "ts": "2023-07-09 18:16:16 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P21754-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 18:16:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21754-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 18:16:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-09 18:16:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XYB7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:17:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6XYB7"}, "ts": "2023-07-09 18:17:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04264"}, "ts": "2023-07-09 18:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24465693", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:17:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24465693", "type": "PubMed"}, "ts": "2023-07-09 18:17:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61769.10.10"}, "ts": "2023-07-09 18:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61769", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:17:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-09 18:17:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60704", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:18:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60704"}, "ts": "2023-07-09 18:18:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DEM7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DEM7-1"}, "ts": "2023-07-09 18:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JX62"}, "ts": "2023-07-09 18:18:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JX62", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:18:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-09 18:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 18:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15652350", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:19:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15652350", "type": "PubMed"}, "ts": "2023-07-09 18:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51654", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:19:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-09 18:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:20:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86XX4"}, "ts": "2023-07-09 18:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI08", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:21:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NI08.810.810"}, "ts": "2023-07-09 18:21:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-09 18:21:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHG2.228.228"}, "ts": "2023-07-09 18:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHG2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:21:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWY3"}, "ts": "2023-07-09 18:21:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWY3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:21:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46462.7.7"}, "ts": "2023-07-09 18:21:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-09 18:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49281", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:21:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49281.500.500"}, "ts": "2023-07-09 18:21:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96A59.44.44"}, "ts": "2023-07-09 18:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A59", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:21:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14738.598.598"}, "ts": "2023-07-09 18:22:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14738", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:22:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-09 18:22:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:22:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35916.1068.1068"}, "ts": "2023-07-09 18:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35916", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:23:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZT9"}, "ts": "2023-07-09 18:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:23:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWJ2"}, "ts": "2023-07-09 18:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:24:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80966KZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55957", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:24:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55957.54.54"}, "ts": "2023-07-09 18:24:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01222"}, "ts": "2023-07-09 18:24:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BW5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:24:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96BW5.282.282"}, "ts": "2023-07-09 18:24:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00519.70.70"}, "ts": "2023-07-09 18:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00519", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13233", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:25:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13233.275.275"}, "ts": "2023-07-09 18:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:25:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35052"}, "ts": "2023-07-09 18:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:26:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPR4"}, "ts": "2023-07-09 18:26:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:27:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22437502", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:27:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22437502", "type": "PubMed"}, "ts": "2023-07-09 18:27:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H4A3.1253.1253"}, "ts": "2023-07-09 18:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49757-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:27:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49757-1"}, "ts": "2023-07-09 18:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H69", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:28:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H69"}, "ts": "2023-07-09 18:28:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49913"}, "ts": "2023-07-09 18:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7779757", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:28:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7779757", "type": "PubMed"}, "ts": "2023-07-09 18:28:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00609"}, "ts": "2023-07-09 18:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00609", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16233", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:28:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16233"}, "ts": "2023-07-09 18:28:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92766.120.120"}, "ts": "2023-07-09 18:28:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:28:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06210"}, "ts": "2023-07-09 18:29:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01769FS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:30:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01769FS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:30:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01769FS"}, "ts": "2023-07-09 18:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58929CB"}, "ts": "2023-07-09 18:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28436QW"}, "ts": "2023-07-09 18:30:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66377OC"}, "ts": "2023-07-09 18:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFH5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:30:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFH5-1"}, "ts": "2023-07-09 18:30:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37802"}, "ts": "2023-07-09 18:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23624502", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:32:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23624502", "type": "PubMed"}, "ts": "2023-07-09 18:32:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17376915", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:32:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17376915", "type": "PubMed"}, "ts": "2023-07-09 18:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04264", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:33:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZWR6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:33:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZWR6.8278.8278"}, "ts": "2023-07-09 18:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWT4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:33:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UWT4.48.48"}, "ts": "2023-07-09 18:33:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070"}, "ts": "2023-07-09 18:33:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2X9"}, "ts": "2023-07-09 18:33:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:33:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06828"}, "ts": "2023-07-09 18:34:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92824"}, "ts": "2023-07-09 18:34:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:34:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92824", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:34:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16882", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:34:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16882"}, "ts": "2023-07-09 18:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05060", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:34:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05060"}, "ts": "2023-07-09 18:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84467IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:34:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 18:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2H3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:35:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P2H3.524.524"}, "ts": "2023-07-09 18:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HDC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HDC9"}, "ts": "2023-07-09 18:35:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16497976", "type": "PubMed"}, "ts": "2023-07-09 18:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16497976", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDG6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:35:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VDG6.576.576"}, "ts": "2023-07-09 18:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56945-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:35:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56945-1"}, "ts": "2023-07-09 18:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00738-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:36:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00738-1.184.184"}, "ts": "2023-07-09 18:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-09 18:36:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:36:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:36:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50135"}, "ts": "2023-07-09 18:36:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00751-1"}, "ts": "2023-07-09 18:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00751-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70531-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:38:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70531-1"}, "ts": "2023-07-09 18:38:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCN4"}, "ts": "2023-07-09 18:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCN4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:38:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10024660", "type": "PubMed"}, "ts": "2023-07-09 18:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10024660", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2A4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:38:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2A4.213.213"}, "ts": "2023-07-09 18:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14157"}, "ts": "2023-07-09 18:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:38:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:39:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47775", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:39:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47775"}, "ts": "2023-07-09 18:39:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-09 18:39:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BQ1"}, "ts": "2023-07-09 18:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35454", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 18:39:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35454"}, "ts": "2023-07-09 18:39:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23396"}, "ts": "2023-07-09 18:40:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VII6.179.179"}, "ts": "2023-07-09 18:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VII6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:40:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11163187", "type": "PubMed"}, "ts": "2023-07-09 18:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11163187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:40:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07699"}, "ts": "2023-07-09 18:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07699", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q5C9"}, "ts": "2023-07-09 18:40:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q5C9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:40:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:40:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43883"}, "ts": "2023-07-09 18:40:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7532814", "type": "PubMed"}, "ts": "2023-07-09 18:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7532814", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:41:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JRQ6-1"}, "ts": "2023-07-09 18:41:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JRQ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:42:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWF2-1"}, "ts": "2023-07-09 18:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWF2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:42:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41002.335.335"}, "ts": "2023-07-09 18:42:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41002", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:42:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10385526", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:42:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10385526", "type": "PubMed"}, "ts": "2023-07-09 18:42:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95340"}, "ts": "2023-07-09 18:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95340", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:43:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHY0"}, "ts": "2023-07-09 18:43:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-09 18:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G61", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:44:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96G61"}, "ts": "2023-07-09 18:44:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8U2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:44:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8U2"}, "ts": "2023-07-09 18:44:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9639672", "type": "PubMed"}, "ts": "2023-07-09 18:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9639672", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07147", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:45:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07147"}, "ts": "2023-07-09 18:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925B4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:45:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925B4"}, "ts": "2023-07-09 18:45:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48147", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:46:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48147.313.313"}, "ts": "2023-07-09 18:46:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:46:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14155.664.664"}, "ts": "2023-07-09 18:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AD99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:47:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AD99-1"}, "ts": "2023-07-09 18:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX45"}, "ts": "2023-07-09 18:50:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:50:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:50:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36357CE"}, "ts": "2023-07-09 18:50:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00211WY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:50:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00211WY"}, "ts": "2023-07-09 18:50:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25100"}, "ts": "2023-07-09 18:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:50:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19448668", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:51:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19448668", "type": "PubMed"}, "ts": "2023-07-09 18:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:51:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6K0P9.334.334"}, "ts": "2023-07-09 18:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6K0P9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:51:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15407YE"}, "ts": "2023-07-09 18:52:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:52:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PR1"}, "ts": "2023-07-09 18:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50135", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:52:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVB3.395.395"}, "ts": "2023-07-09 18:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVB3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98862DB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 18:53:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98862DB"}, "ts": "2023-07-09 18:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:54:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZL4"}, "ts": "2023-07-09 18:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:54:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29323"}, "ts": "2023-07-09 18:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29323", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:54:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5M775.965.965"}, "ts": "2023-07-09 18:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M775", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 18:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Q5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:54:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6Q5-1"}, "ts": "2023-07-09 18:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-09 18:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11142"}, "ts": "2023-07-09 18:55:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23396", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:56:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18670065", "type": "PubMed"}, "ts": "2023-07-09 18:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18670065", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:56:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75569"}, "ts": "2023-07-09 18:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92743-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92743-1"}, "ts": "2023-07-09 18:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75569", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:58:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9930701", "type": "PubMed"}, "ts": "2023-07-09 18:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9930701", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 18:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N4B4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 18:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N4B4"}, "ts": "2023-07-09 18:58:14 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 19:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 19:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 19:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 19:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 19:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 19:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:00:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKT3"}, "ts": "2023-07-09 19:00:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDJ6"}, "ts": "2023-07-09 19:01:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDJ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T7N3"}, "ts": "2023-07-09 19:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7N3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19235"}, "ts": "2023-07-09 19:02:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43312.173.173"}, "ts": "2023-07-09 19:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43312", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:02:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-09 19:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 19:03:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P31943", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 19:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31943", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 19:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08427", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:04:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08427"}, "ts": "2023-07-09 19:04:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:04:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00493"}, "ts": "2023-07-09 19:04:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06733"}, "ts": "2023-07-09 19:05:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34433012", "type": "PubMed"}, "ts": "2023-07-09 19:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34433012", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:05:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NI27", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 19:05:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8NI27", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 19:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02108-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02108-1"}, "ts": "2023-07-09 19:05:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8C7M3.49.49"}, "ts": "2023-07-09 19:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C7M3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 19:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5T2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 19:06:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5T2"}, "ts": "2023-07-09 19:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9831657", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:06:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9831657", "type": "PubMed"}, "ts": "2023-07-09 19:06:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15005709", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:07:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15005709", "type": "PubMed"}, "ts": "2023-07-09 19:07:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2G1.402.402"}, "ts": "2023-07-09 19:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2G1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:07:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15407YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 19:08:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06495"}, "ts": "2023-07-09 19:09:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06495", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 19:11:03 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 19:11:03 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 19:11:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 19:11:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-09 19:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16920712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:11:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16920712", "type": "PubMed"}, "ts": "2023-07-09 19:11:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63142"}, "ts": "2023-07-09 19:13:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:13:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11654-1.1876.1876"}, "ts": "2023-07-09 19:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11654-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:13:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8267877", "type": "PubMed"}, "ts": "2023-07-09 19:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8267877", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZT5-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 19:15:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZT5-1"}, "ts": "2023-07-09 19:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHU4-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:15:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JHU4-1.4216.4216"}, "ts": "2023-07-09 19:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R3T4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:16:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R3T4-1"}, "ts": "2023-07-09 19:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DA59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DA59"}, "ts": "2023-07-09 19:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YZ3"}, "ts": "2023-07-09 19:16:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVB6"}, "ts": "2023-07-09 19:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVB6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:16:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PZA6"}, "ts": "2023-07-09 19:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PZA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:17:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-09 19:17:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:18:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07350"}, "ts": "2023-07-09 19:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9V2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:20:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9V2"}, "ts": "2023-07-09 19:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DEQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 19:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DEQ4"}, "ts": "2023-07-09 19:20:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:21:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16809425", "type": "PubMed"}, "ts": "2023-07-09 19:21:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16809425", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98095", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98095"}, "ts": "2023-07-09 19:21:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2545729", "type": "PubMed"}, "ts": "2023-07-09 19:22:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2545729", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:22:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04921"}, "ts": "2023-07-09 19:22:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:22:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBT3"}, "ts": "2023-07-09 19:22:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:22:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13951", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:24:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13951.40.40"}, "ts": "2023-07-09 19:24:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HA47"}, "ts": "2023-07-09 19:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HA47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:25:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-09 19:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32960270", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:25:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32960270", "type": "PubMed"}, "ts": "2023-07-09 19:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15437", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:26:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15437.313.313"}, "ts": "2023-07-09 19:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55061-1"}, "ts": "2023-07-09 19:26:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15599"}, "ts": "2023-07-09 19:26:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55061-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43820", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:26:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43820.87.87"}, "ts": "2023-07-09 19:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36888", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:27:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36888.323.323"}, "ts": "2023-07-09 19:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2EG98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00912UN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 19:27:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2EG98"}, "ts": "2023-07-09 19:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920Z0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:28:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920Z0"}, "ts": "2023-07-09 19:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3U6B2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:28:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3U6B2"}, "ts": "2023-07-09 19:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:28:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15617512", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:28:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15617512", "type": "PubMed"}, "ts": "2023-07-09 19:28:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48552"}, "ts": "2023-07-09 19:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:29:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13330"}, "ts": "2023-07-09 19:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:29:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13206", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:30:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13206"}, "ts": "2023-07-09 19:30:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUJ7"}, "ts": "2023-07-09 19:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZN8"}, "ts": "2023-07-09 19:31:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:31:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75023"}, "ts": "2023-07-09 19:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:31:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12734330", "type": "PubMed"}, "ts": "2023-07-09 19:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12734330", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A5B4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:32:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1A5B4"}, "ts": "2023-07-09 19:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:33:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35916"}, "ts": "2023-07-09 19:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:33:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61221.371.371"}, "ts": "2023-07-09 19:34:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61221", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:34:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VI38"}, "ts": "2023-07-09 19:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VI38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24190965", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:35:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24190965", "type": "PubMed"}, "ts": "2023-07-09 19:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P51"}, "ts": "2023-07-09 19:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR97-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:36:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR97-1"}, "ts": "2023-07-09 19:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14028", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14028"}, "ts": "2023-07-09 19:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:37:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCM1"}, "ts": "2023-07-09 19:37:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0H5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:37:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0H5.154.154"}, "ts": "2023-07-09 19:37:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-09 19:37:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00911"}, "ts": "2023-07-09 19:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1B9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:38:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R1B9"}, "ts": "2023-07-09 19:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "S4R1E0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:39:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "S4R1E0-1"}, "ts": "2023-07-09 19:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10024883", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:39:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10024883", "type": "PubMed"}, "ts": "2023-07-09 19:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 19:40:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56014GC"}, "ts": "2023-07-09 19:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56014GC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 19:40:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3405210", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 19:40:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3405210", "type": "PubMed"}, "ts": "2023-07-09 19:40:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-09 19:40:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46013"}, "ts": "2023-07-09 19:41:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P6B7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:41:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P6B7-1"}, "ts": "2023-07-09 19:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3A5"}, "ts": "2023-07-09 19:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3A5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:42:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99983"}, "ts": "2023-07-09 19:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:44:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLV9-1"}, "ts": "2023-07-09 19:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLV9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:44:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-09 19:44:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:45:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921V7"}, "ts": "2023-07-09 19:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13798"}, "ts": "2023-07-09 19:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17600", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:47:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17600"}, "ts": "2023-07-09 19:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:48:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75762"}, "ts": "2023-07-09 19:48:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75762", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:48:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-09 19:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:49:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3T8"}, "ts": "2023-07-09 19:49:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3T8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:49:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-09 19:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71RJ2"}, "ts": "2023-07-09 19:51:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8QZV0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:51:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8QZV0-1"}, "ts": "2023-07-09 19:51:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 19:51:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60200IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 19:51:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60200IZ"}, "ts": "2023-07-09 19:51:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N608", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:52:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N608"}, "ts": "2023-07-09 19:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:53:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTT9.229.229"}, "ts": "2023-07-09 19:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTT9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 19:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-09 19:54:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00629"}, "ts": "2023-07-09 19:55:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-09 19:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:55:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-09 19:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 19:57:54 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 19:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 19:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:58:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQ50"}, "ts": "2023-07-09 19:58:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ50", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:58:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 19:59:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RP8"}, "ts": "2023-07-09 19:59:47 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 20:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 20:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 20:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 20:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61282"}, "ts": "2023-07-09 20:00:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61282", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:00:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04652"}, "ts": "2023-07-09 20:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06753", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 20:00:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P06753", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 20:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:01:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 20:01:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35632"}, "ts": "2023-07-09 20:01:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GTS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:01:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6GTS8"}, "ts": "2023-07-09 20:01:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YS7"}, "ts": "2023-07-09 20:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY11"}, "ts": "2023-07-09 20:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:04:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZQ6"}, "ts": "2023-07-09 20:04:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15431"}, "ts": "2023-07-09 20:04:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:05:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKW7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKW7"}, "ts": "2023-07-09 20:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-09 20:05:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-09 20:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13356"}, "ts": "2023-07-09 20:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13356", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:06:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-09 20:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:07:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51512"}, "ts": "2023-07-09 20:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51512", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:07:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10066"}, "ts": "2023-07-09 20:07:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10066", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:07:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52888"}, "ts": "2023-07-09 20:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8548820", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:08:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969E2"}, "ts": "2023-07-09 20:08:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969E2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:08:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8548820", "type": "PubMed"}, "ts": "2023-07-09 20:08:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22121117", "type": "PubMed"}, "ts": "2023-07-09 20:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22121117", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NND4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:09:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NND4"}, "ts": "2023-07-09 20:09:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16851", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:10:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16851"}, "ts": "2023-07-09 20:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:10:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYW1"}, "ts": "2023-07-09 20:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PAL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:11:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PAL1"}, "ts": "2023-07-09 20:11:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00629", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14047PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 20:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20701", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:13:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20701"}, "ts": "2023-07-09 20:13:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-09 20:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:14:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-09 20:14:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:14:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDV7"}, "ts": "2023-07-09 20:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:14:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22837050", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:15:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22837050", "type": "PubMed"}, "ts": "2023-07-09 20:15:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 20:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31118FR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 20:15:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31118FR"}, "ts": "2023-07-09 20:15:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96KV7.732.732"}, "ts": "2023-07-09 20:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KV7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:16:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K3F7"}, "ts": "2023-07-09 20:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K3F7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:16:28 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 20:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "j0te8fhg7lqu0zt1vo58mi90k9yfxtrz", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 20:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "j0te8fhg7lqu0zt1vo58mi90k9yfxtrz", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 20:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:17:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N365-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:17:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N365-1"}, "ts": "2023-07-09 20:17:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225"}, "ts": "2023-07-09 20:18:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5A9"}, "ts": "2023-07-09 20:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15551", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:19:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15551.53.53"}, "ts": "2023-07-09 20:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:19:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15229"}, "ts": "2023-07-09 20:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11279239", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:20:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11279239", "type": "PubMed"}, "ts": "2023-07-09 20:20:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00342"}, "ts": "2023-07-09 20:20:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-09 20:20:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H9R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:20:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H9R7"}, "ts": "2023-07-09 20:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:21:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-09 20:21:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12778-1"}, "ts": "2023-07-09 20:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:22:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-09 20:22:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "K7N621-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:22:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "K7N621-1"}, "ts": "2023-07-09 20:22:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-09 20:23:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-09 20:23:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29460"}, "ts": "2023-07-09 20:23:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYJ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:24:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYJ1-1"}, "ts": "2023-07-09 20:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-09 20:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-09 20:25:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10861283", "type": "PubMed"}, "ts": "2023-07-09 20:25:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10861283", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:25:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25092655", "type": "PubMed"}, "ts": "2023-07-09 20:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25092655", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62995", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:26:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62995"}, "ts": "2023-07-09 20:26:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:26:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07011"}, "ts": "2023-07-09 20:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07011", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:27:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02749"}, "ts": "2023-07-09 20:27:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:27:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94929.462.462"}, "ts": "2023-07-09 20:27:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94929", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:27:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20700-1"}, "ts": "2023-07-09 20:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:28:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:28:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23519706", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:28:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23519706", "type": "PubMed"}, "ts": "2023-07-09 20:28:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU68"}, "ts": "2023-07-09 20:28:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96370VA"}, "ts": "2023-07-09 20:28:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBS9"}, "ts": "2023-07-09 20:29:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:29:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBS9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:29:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-09 20:30:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-09 20:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-09 20:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:30:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17693683", "type": "PubMed"}, "ts": "2023-07-09 20:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17693683", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 20:31:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLI2"}, "ts": "2023-07-09 20:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLI2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 20:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMU2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47862", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:31:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DMU2.92.92"}, "ts": "2023-07-09 20:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47862"}, "ts": "2023-07-09 20:31:56 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 20:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 20:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 20:32:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23528"}, "ts": "2023-07-09 20:32:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23528", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:32:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-09 20:32:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15205"}, "ts": "2023-07-09 20:33:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51580"}, "ts": "2023-07-09 20:33:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:34:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:34:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-09 20:34:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P49902", "cluster_type": "unselected"}, "ts": "2023-07-09 20:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49902", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 20:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49902", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 20:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JII4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:36:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JII4"}, "ts": "2023-07-09 20:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:36:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96EC8.213.213"}, "ts": "2023-07-09 20:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8626647", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:37:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8626647", "type": "PubMed"}, "ts": "2023-07-09 20:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12778-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:37:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-09 20:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18505", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:38:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18505"}, "ts": "2023-07-09 20:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:38:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:38:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18066052", "type": "PubMed"}, "ts": "2023-07-09 20:39:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18066052", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:39:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08721"}, "ts": "2023-07-09 20:39:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04233", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:39:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04233"}, "ts": "2023-07-09 20:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:39:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01705"}, "ts": "2023-07-09 20:39:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01705", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:39:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSQ5"}, "ts": "2023-07-09 20:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSQ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:39:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01033-1"}, "ts": "2023-07-09 20:41:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHY2"}, "ts": "2023-07-09 20:42:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31949"}, "ts": "2023-07-09 20:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:43:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00597"}, "ts": "2023-07-09 20:43:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20700-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 20:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYB5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 20:44:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NYB5", "cluster_type": "unselected"}, "ts": "2023-07-09 20:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYB5", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 20:44:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96370VA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 20:44:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:44:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQB3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:44:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQB3-1"}, "ts": "2023-07-09 20:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25815", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 20:45:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P25815", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 20:45:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25815", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-09 20:45:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:46:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5L3"}, "ts": "2023-07-09 20:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ICH7"}, "ts": "2023-07-09 20:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ICH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9T8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:47:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N9T8.319.319"}, "ts": "2023-07-09 20:47:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:48:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-09 20:48:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14843DJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 20:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93086", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:48:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93086"}, "ts": "2023-07-09 20:48:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63633", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:49:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63633"}, "ts": "2023-07-09 20:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51580", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9VBK1"}, "ts": "2023-07-09 20:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9VBK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:50:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 20:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JN71", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:50:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "C9JN71.153.153"}, "ts": "2023-07-09 20:50:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y371"}, "ts": "2023-07-09 20:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:51:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01215"}, "ts": "2023-07-09 20:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01215", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:51:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-09 20:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28906"}, "ts": "2023-07-09 20:52:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9563949", "type": "PubMed"}, "ts": "2023-07-09 20:52:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9563949", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:52:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9VBK1"}, "ts": "2023-07-09 20:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:53:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9VBK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:53:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-09 20:53:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 20:54:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60568.63.63"}, "ts": "2023-07-09 20:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60568", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 20:54:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01614ZM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 20:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08721", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2C5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:55:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2C5"}, "ts": "2023-07-09 20:55:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6C8"}, "ts": "2023-07-09 20:55:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6C8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:55:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-09 20:55:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9425109", "type": "PubMed"}, "ts": "2023-07-09 20:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9425109", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:56:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08588"}, "ts": "2023-07-09 20:56:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11698662", "type": "PubMed"}, "ts": "2023-07-09 20:57:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11698662", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:57:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-09 20:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:57:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "6808505"}, "ts": "2023-07-09 20:58:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 20:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 20:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 20:58:30 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 21:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 21:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 21:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 21:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 21:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 21:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88379", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:00:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88379.962.962"}, "ts": "2023-07-09 21:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06787", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:00:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06787"}, "ts": "2023-07-09 21:00:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43116"}, "ts": "2023-07-09 21:01:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSI4"}, "ts": "2023-07-09 21:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:01:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13591"}, "ts": "2023-07-09 21:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:01:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAR2"}, "ts": "2023-07-09 21:01:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:01:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:01:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:02:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-09 21:02:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRL6"}, "ts": "2023-07-09 21:02:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRL6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16888721", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:02:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16888721", "type": "PubMed"}, "ts": "2023-07-09 21:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80XD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:03:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80XD8"}, "ts": "2023-07-09 21:03:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ES7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:03:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96ES7"}, "ts": "2023-07-09 21:03:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-09 21:04:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:04:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:05:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTW8"}, "ts": "2023-07-09 21:05:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IK1-1"}, "ts": "2023-07-09 21:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IK1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:06:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94955"}, "ts": "2023-07-09 21:06:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94955", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:06:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98161"}, "ts": "2023-07-09 21:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34810", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:07:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34810"}, "ts": "2023-07-09 21:07:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H808", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:08:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H808.29.29"}, "ts": "2023-07-09 21:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00395TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28906", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:08:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54105", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:08:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54105"}, "ts": "2023-07-09 21:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:08:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01563"}, "ts": "2023-07-09 21:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:08:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23665FB"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45827ZM"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49632WD"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80111QD"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-09 21:08:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:09:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-09 21:10:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L58"}, "ts": "2023-07-09 21:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:11:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75027"}, "ts": "2023-07-09 21:12:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99MB1"}, "ts": "2023-07-09 21:12:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:12:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75569"}, "ts": "2023-07-09 21:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75569", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:12:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q501W4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 21:12:59 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q501W4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 21:12:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29317"}, "ts": "2023-07-09 21:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:13:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VI79", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 21:14:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VI79"}, "ts": "2023-07-09 21:14:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9874200"}, "ts": "2023-07-09 21:14:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H295", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:14:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H295.15.15"}, "ts": "2023-07-09 21:14:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-09 21:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-09 21:16:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75037"}, "ts": "2023-07-09 21:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:17:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15153"}, "ts": "2023-07-09 21:17:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H808.29.29"}, "ts": "2023-07-09 21:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:18:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49788"}, "ts": "2023-07-09 21:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49788", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23863VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:18:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MTJ3"}, "ts": "2023-07-09 21:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MTJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02763"}, "ts": "2023-07-09 21:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02763", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:22:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11115RO"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20425TQ"}, "ts": "2023-07-09 21:22:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22140GZ"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27322BI"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27947YN"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32926LW"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36131WL"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40926MX"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41044JW"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41882MT"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44211QA"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44753VC"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59626AS"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66088HZ"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94917XT"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95678HJ"}, "ts": "2023-07-09 21:22:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54682XF"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59536GA"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60033FS"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78644BR"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72797UR"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85144OK"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86752LQ"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92081HT"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94854LT"}, "ts": "2023-07-09 21:22:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82388RB"}, "ts": "2023-07-09 21:22:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-09 21:23:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-09 21:23:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-09 21:23:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-09 21:23:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36670VW"}, "ts": "2023-07-09 21:23:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:23:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50120TH"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51941GC"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62165AG"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72309KR"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69834CE"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73028DK"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67506FN"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83213GG"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16543415", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-09 21:23:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16543415", "type": "PubMed"}, "ts": "2023-07-09 21:23:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95977AE"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99679NM"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07799LX"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28937TW"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05933EN"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31153XO"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31665QC"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34617SM"}, "ts": "2023-07-09 21:23:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39446WN"}, "ts": "2023-07-09 21:23:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37818NZ"}, "ts": "2023-07-09 21:23:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53959KE"}, "ts": "2023-07-09 21:23:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47737VJ"}, "ts": "2023-07-09 21:23:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-09 21:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18495105", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:24:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18495105", "type": "PubMed"}, "ts": "2023-07-09 21:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS7-1"}, "ts": "2023-07-09 21:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:24:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-09 21:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17936", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:24:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17936"}, "ts": "2023-07-09 21:24:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-09 21:24:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:24:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N122"}, "ts": "2023-07-09 21:25:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15437", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:25:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15437.592.592"}, "ts": "2023-07-09 21:25:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-09 21:25:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-09 21:25:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70570"}, "ts": "2023-07-09 21:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:25:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-09 21:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54289"}, "ts": "2023-07-09 21:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22310AV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:27:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61224"}, "ts": "2023-07-09 21:27:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H792"}, "ts": "2023-07-09 21:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:27:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:29:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DZ1"}, "ts": "2023-07-09 21:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880"}, "ts": "2023-07-09 21:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10716"}, "ts": "2023-07-09 21:29:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13410", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:29:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13410"}, "ts": "2023-07-09 21:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:30:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-09 21:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPC1-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 21:31:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPC1-1"}, "ts": "2023-07-09 21:31:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VV63"}, "ts": "2023-07-09 21:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:31:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18938DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:32:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63424"}, "ts": "2023-07-09 21:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:32:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NF89"}, "ts": "2023-07-09 21:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NF89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:32:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:32:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HA77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:32:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HA77"}, "ts": "2023-07-09 21:32:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01717"}, "ts": "2023-07-09 21:32:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01717", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:32:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-09 21:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:33:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9389648", "type": "PubMed"}, "ts": "2023-07-09 21:33:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9389648", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:33:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 21:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEZ2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 21:33:10 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8NEZ2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 21:33:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:33:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75143", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:33:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75143"}, "ts": "2023-07-09 21:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:34:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49765"}, "ts": "2023-07-09 21:34:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58307", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:35:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58307"}, "ts": "2023-07-09 21:35:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDB8"}, "ts": "2023-07-09 21:35:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "221835", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:35:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "221835", "type": "PubMed"}, "ts": "2023-07-09 21:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-09 21:36:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UW1"}, "ts": "2023-07-09 21:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-09 21:37:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54821"}, "ts": "2023-07-09 21:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61586-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:37:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61586-1"}, "ts": "2023-07-09 21:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 21:37:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CPQ1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 21:37:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CPQ1"}, "ts": "2023-07-09 21:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08257"}, "ts": "2023-07-09 21:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08257", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82388RB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:38:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y487"}, "ts": "2023-07-09 21:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:38:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2U8"}, "ts": "2023-07-09 21:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2U8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:39:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43900.8.8"}, "ts": "2023-07-09 21:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43900", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:39:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1Y3"}, "ts": "2023-07-09 21:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:39:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHY0"}, "ts": "2023-07-09 21:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:40:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19958IL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:40:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGJ0"}, "ts": "2023-07-09 21:40:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:40:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:41:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-09 21:41:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8U9-1"}, "ts": "2023-07-09 21:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8U9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:41:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUC6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:42:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IUC6-1"}, "ts": "2023-07-09 21:42:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91023GB"}, "ts": "2023-07-09 21:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU72"}, "ts": "2023-07-09 21:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ZCN5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:42:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ZCN5"}, "ts": "2023-07-09 21:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:42:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96M94.32.32"}, "ts": "2023-07-09 21:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96M94", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ3"}, "ts": "2023-07-09 21:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-09 21:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 21:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 21:44:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y6N9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 21:44:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-09 21:44:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-09 21:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:45:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-09 21:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15939795", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:45:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15939795", "type": "PubMed"}, "ts": "2023-07-09 21:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75899", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:46:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75899.796.796"}, "ts": "2023-07-09 21:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969D9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:46:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969D9-1"}, "ts": "2023-07-09 21:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70J99", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:47:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q70J99.150.150"}, "ts": "2023-07-09 21:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:48:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZVK1"}, "ts": "2023-07-09 21:48:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZVK1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05586", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:48:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05586.523.523"}, "ts": "2023-07-09 21:48:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13131", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:48:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZVD7-1"}, "ts": "2023-07-09 21:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZVD7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:49:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JC9"}, "ts": "2023-07-09 21:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:49:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17959601", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:50:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17959601", "type": "PubMed"}, "ts": "2023-07-09 21:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:50:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYW1"}, "ts": "2023-07-09 21:50:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZL0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:50:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8JZL0-1"}, "ts": "2023-07-09 21:50:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-09 21:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01106", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:50:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91542NW"}, "ts": "2023-07-09 21:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01106"}, "ts": "2023-07-09 21:50:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-09 21:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:52:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55774"}, "ts": "2023-07-09 21:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55774", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 21:52:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRK6.351.351"}, "ts": "2023-07-09 21:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54821", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:53:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515"}, "ts": "2023-07-09 21:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07759-1"}, "ts": "2023-07-09 21:54:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9187667", "type": "PubMed"}, "ts": "2023-07-09 21:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9187667", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:54:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A428"}, "ts": "2023-07-09 21:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A428", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:55:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ84"}, "ts": "2023-07-09 21:55:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14108"}, "ts": "2023-07-09 21:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:56:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20358602", "type": "PubMed"}, "ts": "2023-07-09 21:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20358602", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:56:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15924"}, "ts": "2023-07-09 21:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CJ9"}, "ts": "2023-07-09 21:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-09 21:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26337389", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 21:57:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26337389", "type": "PubMed"}, "ts": "2023-07-09 21:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:57:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18564.419.419"}, "ts": "2023-07-09 21:57:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15121"}, "ts": "2023-07-09 21:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HA47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:57:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HA47"}, "ts": "2023-07-09 21:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91023GB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 21:58:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:58:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:58:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15391"}, "ts": "2023-07-09 21:59:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5W0Q7"}, "ts": "2023-07-09 21:59:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5W0Q7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:59:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-09 21:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:59:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PPN4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 21:59:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PPN4-1"}, "ts": "2023-07-09 21:59:57 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 22:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYM1-1"}, "ts": "2023-07-09 22:00:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYM1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:00:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 22:00:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 22:00:07 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 22:00:08 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 22:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 22:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:00:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00144"}, "ts": "2023-07-09 22:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20930", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:02:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20930"}, "ts": "2023-07-09 22:02:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8MVW0.66.66"}, "ts": "2023-07-09 22:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MVW0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 22:05:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M385"}, "ts": "2023-07-09 22:06:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M385", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:06:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:06:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-09 22:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:06:50 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 22:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:07:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01303"}, "ts": "2023-07-09 22:07:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01303"}, "ts": "2023-07-09 22:07:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:08:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-09 22:08:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-09 22:08:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-09 22:09:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-09 22:09:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23222639", "type": "PubMed"}, "ts": "2023-07-09 22:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23222639", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 22:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23222639", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-09 22:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07759-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 22:10:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13283.143.143"}, "ts": "2023-07-09 22:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13283", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 22:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15924", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:12:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18564", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 22:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:13:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6L1"}, "ts": "2023-07-09 22:14:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:14:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14543-1"}, "ts": "2023-07-09 22:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:15:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63142"}, "ts": "2023-07-09 22:15:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g29068fm"}, "ts": "2023-07-09 22:15:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15123", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 22:16:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15123.227.227"}, "ts": "2023-07-09 22:16:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZX02"}, "ts": "2023-07-09 22:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZX02", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 22:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95396", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:16:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95396"}, "ts": "2023-07-09 22:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:16:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-09 22:16:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:17:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42553JB"}, "ts": "2023-07-09 22:17:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2J0"}, "ts": "2023-07-09 22:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2J0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56545", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56545"}, "ts": "2023-07-09 22:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:18:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51164"}, "ts": "2023-07-09 22:18:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9234708", "type": "PubMed"}, "ts": "2023-07-09 22:19:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9234708", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 22:19:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50406", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 22:20:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50406.107.107"}, "ts": "2023-07-09 22:20:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BIS8"}, "ts": "2023-07-09 22:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BIS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:20:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00519"}, "ts": "2023-07-09 22:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CHZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CHZ8"}, "ts": "2023-07-09 22:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-09 22:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:21:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-09 22:21:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-09 22:22:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-09 22:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-09 22:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:23:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4Q2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:23:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:23:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75116"}, "ts": "2023-07-09 22:23:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:23:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11488"}, "ts": "2023-07-09 22:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:24:37 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5JWF2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 22:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 22:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:25:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51608"}, "ts": "2023-07-09 22:25:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51608", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:25:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 22:25:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56524-1"}, "ts": "2023-07-09 22:25:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:26:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NU22"}, "ts": "2023-07-09 22:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NU22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:26:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73028DK"}, "ts": "2023-07-09 22:26:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91473PK"}, "ts": "2023-07-09 22:26:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06330RB"}, "ts": "2023-07-09 22:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:27:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63167"}, "ts": "2023-07-09 22:27:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63167", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:27:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35555"}, "ts": "2023-07-09 22:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:27:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35555", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:27:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:29:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-09 22:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:30:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AA3"}, "ts": "2023-07-09 22:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15910", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:31:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15910"}, "ts": "2023-07-09 22:31:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 22:32:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18313027", "type": "PubMed"}, "ts": "2023-07-09 22:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18313027", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 22:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05423", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:33:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05423"}, "ts": "2023-07-09 22:33:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-09 22:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07075"}, "ts": "2023-07-09 22:36:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein_search.html", "message": "page access"}, "ts": "2023-07-09 22:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42553JB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 22:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35611-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:36:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35611-1"}, "ts": "2023-07-09 22:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TC12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:36:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TC12"}, "ts": "2023-07-09 22:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:37:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-09 22:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 22:38:42 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "LACTB"}, "ts": "2023-07-09 22:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 22:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=LACTB"}, "ts": "2023-07-09 22:38:43 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "082102ac759d8119a8214697b3c43e90", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-09 22:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "082102ac759d8119a8214697b3c43e90", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-09 22:38:45 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-09 22:38:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83111-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:38:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83111-1"}, "ts": "2023-07-09 22:38:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 22:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:40:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-09 22:40:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBF8.294.294"}, "ts": "2023-07-09 22:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBF8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 22:41:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTL9"}, "ts": "2023-07-09 22:41:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56524-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:41:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X52"}, "ts": "2023-07-09 22:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2C8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2C8-1"}, "ts": "2023-07-09 22:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:43:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12931"}, "ts": "2023-07-09 22:43:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUI6"}, "ts": "2023-07-09 22:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78509"}, "ts": "2023-07-09 22:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:43:47 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 22:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "j0te8fhg7lqu0zt1vo58mi90k9yfxtrz", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:44:08 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 22:44:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "j0te8fhg7lqu0zt1vo58mi90k9yfxtrz", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:44:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09242-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:44:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09242-1"}, "ts": "2023-07-09 22:44:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-09 22:44:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-09 22:44:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-09 22:44:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 22:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:44:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14392"}, "ts": "2023-07-09 22:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14392", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:44:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-09 22:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91ZZ5"}, "ts": "2023-07-09 22:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZZ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:46:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-09 22:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95445-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:46:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95445-1"}, "ts": "2023-07-09 22:46:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02655"}, "ts": "2023-07-09 22:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:48:23 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 22:48:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:48:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:48:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A3"}, "ts": "2023-07-09 22:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18313027", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 22:49:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18313027", "type": "PubMed"}, "ts": "2023-07-09 22:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:49:14 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 22:49:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-09 22:49:23 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-09 22:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-09 22:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-09 22:49:24 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-09 22:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-09 22:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:49:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-09 22:49:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:50:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51682", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:50:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51682"}, "ts": "2023-07-09 22:50:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"MYRLMSAVTARAAAPGGLASSCGRRGVHQRAGLPPLGHGWVGGLGLGLGLALGVKLAGGLRGAAPAQSPA\\nAPDPEASPLAEPPQEQSLAPWSPQTPAPPCSRCFARAIESSRDLLHRIKDEVGAPGIVVGVSVDGKEVWS\\nEGLGYADVENRVPCKPETVMRIASISKSLTMVALAKLWEAGKLDLDIPVQHYVPEFPEKEYEGEKVSVTT\\nRLLISHLSGIRHYEKDIKKVKEEKAYKALKMMKENVAFEQEKEGKSNEKNDFTKFKTEQENEAKCRNSKP\\nGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLLAAIVERASGCKYLDYMQKI\\nFHDLDMLTTVQEENEPVIYNRARFYVYNKKKRLVNTPYVDNSYKWAGGGFLSTVGDLLKFGNAMLYGYQV\\nGLFKNSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAV\\nGASSVLLVLPEELDTETINNKVPPRGIIVSIICNMQSVGLNSTALKIALEFDKDRSD\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-09 22:50:37 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "MYRLMSAVTARAAAPGGLASSCGRRGVHQRAGLPPLGHGWVGGLGLGLGLALGVKLAGGLRGAAPAQSPA\nAPDPEASPLAEPPQEQSLAPWSPQTPAPPCSRCFARAIESSRDLLHRIKDEVGAPGIVVGVSVDGKEVWS\nEGLGYADVENRVPCKPETVMRIASISKSLTMVALAKLWEAGKLDLDIPVQHYVPEFPEKEYEGEKVSVTT\nRLLISHLSGIRHYEKDIKKVKEEKAYKALKMMKENVAFEQEKEGKSNEKNDFTKFKTEQENEAKCRNSKP\nGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLLAAIVERASGCKYLDYMQKI\nFHDLDMLTTVQEENEPVIYNRARFYVYNKKKRLVNTPYVDNSYKWAGGGFLSTVGDLLKFGNAMLYGYQV\nGLFKNSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAV\nGASSVLLVLPEELDTETINNKVPPRGIIVSIICNMQSVGLNSTALKIALEFDKDRSD", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-09 22:50:38 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 17}, "ts": "2023-07-09 22:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">17", "user": "Undecided", "type": "user", "page": "blast", "message": "Blast Search query=17"}, "ts": "2023-07-09 22:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17", "user": "Undecided", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-09 22:50:40 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 17}, "ts": "2023-07-09 22:50:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17", "user": "Undecided", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P83111-1, Q9EP89-1, D3ZFJ6-1, A8MY62-1"}, "ts": "2023-07-09 22:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-09 22:50:55 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-09 22:50:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:51:14 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 22:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 22:51:14 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 22:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:51:38 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(10)", "term_category": "glycan"}, "ts": "2023-07-09 22:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 22:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">e31bb28f1cd234f2e821757fea61e557", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(10)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 22:51:56 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:51:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92188CK"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27310MQ"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24769QK"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66728LX"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62768NK"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22122FL"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82207VX"}, "ts": "2023-07-09 22:51:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70681VG"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76408BJ"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73896IF"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38901YC"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51419BH"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32684AI"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34821YB"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12775RU"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90107JW"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25942LR"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35841YO"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80661YI"}, "ts": "2023-07-09 22:51:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 22:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:52:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72626YH"}, "ts": "2023-07-09 22:52:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61001HU"}, "ts": "2023-07-09 22:52:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17547KJ"}, "ts": "2023-07-09 22:52:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17536AW"}, "ts": "2023-07-09 22:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:52:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-09 22:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48047"}, "ts": "2023-07-09 22:53:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:54:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2B4"}, "ts": "2023-07-09 22:54:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2B4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 22:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5NCE8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 22:55:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5NCE8"}, "ts": "2023-07-09 22:55:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:55:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQW4"}, "ts": "2023-07-09 22:55:42 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 22:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:56:16 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 22:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 22:56:23 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(12)", "term_category": "glycan"}, "ts": "2023-07-09 22:56:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e31bb28f1cd234f2e821757fea61e557>a57af85e68ce82a70e99b91266587268", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(12)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 22:56:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a57af85e68ce82a70e99b91266587268", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:56:23 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a57af85e68ce82a70e99b91266587268", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:56:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35774GX"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87784HD"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57930PW"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91219PM"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79916GF"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05454SP"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80767XX"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72079JG"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76979BI"}, "ts": "2023-07-09 22:56:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42439GB"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73234BV"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61456PF"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49961MS"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67118IN"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85141ZP"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25391SS"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26474XX"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83417GO"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44210FS"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05421OW"}, "ts": "2023-07-09 22:56:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60282.176.176"}, "ts": "2023-07-09 22:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:57:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a57af85e68ce82a70e99b91266587268", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:57:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a57af85e68ce82a70e99b91266587268", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:57:29 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 22:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:57:30 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "a57af85e68ce82a70e99b91266587268", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a57af85e68ce82a70e99b91266587268", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 22:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a57af85e68ce82a70e99b91266587268", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 22:57:35 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(2)", "term_category": "glycan"}, "ts": "2023-07-09 22:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "a57af85e68ce82a70e99b91266587268>6b68cf156a0e4418169d9c917033b999", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(2)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 22:57:35 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12396GB"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49854OS"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22573RC"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77477NL"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94514IB"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94217FB"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41245OZ"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43059PA"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32072NY"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21672LC"}, "ts": "2023-07-09 22:57:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42466VF"}, "ts": "2023-07-09 22:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81541IU"}, "ts": "2023-07-09 22:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03717EM"}, "ts": "2023-07-09 22:57:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19521BV"}, "ts": "2023-07-09 22:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:57:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 22:57:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59970QL"}, "ts": "2023-07-09 22:57:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:57:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_data", "operator": "OR", "selected": ["Glycosylation"]}]}, "ts": "2023-07-09 22:57:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ffzkhsjbctnfnh3zfu8lu6u6tvf0et8c", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-09 22:58:16 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-09 22:58:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "ffzkhsjbctnfnh3zfu8lu6u6tvf0et8c", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-09 22:58:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-09 22:58:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-09 22:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:59:12 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 22:59:12 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:59:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 22:59:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-09 22:59:19 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(2)Fuc(1)", "term_category": "glycan"}, "ts": "2023-07-09 22:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6b68cf156a0e4418169d9c917033b999", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 22:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6b68cf156a0e4418169d9c917033b999>3af76d975f752674d58603c7787b956a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(2)Fuc(1)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 22:59:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3af76d975f752674d58603c7787b956a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3af76d975f752674d58603c7787b956a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:59:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26903VB"}, "ts": "2023-07-09 22:59:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36944VG"}, "ts": "2023-07-09 22:59:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71784JC"}, "ts": "2023-07-09 22:59:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24803MV"}, "ts": "2023-07-09 22:59:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16607BW"}, "ts": "2023-07-09 22:59:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3af76d975f752674d58603c7787b956a", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 22:59:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3af76d975f752674d58603c7787b956a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 22:59:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16520"}, "ts": "2023-07-09 22:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:59:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:59:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16520"}, "ts": "2023-07-09 22:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 22:59:51 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 22:59:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 22:59:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "3af76d975f752674d58603c7787b956a", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 22:59:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3af76d975f752674d58603c7787b956a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 22:59:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16520"}, "ts": "2023-07-09 22:59:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:00:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-09 23:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-09 23:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-09 23:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-09 23:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-09 23:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-09 23:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16520"}, "ts": "2023-07-09 23:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 23:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3af76d975f752674d58603c7787b956a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Structure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"HexNAc(3)Hex(3)Fuc(1)\\n\",\"align\":\"wholeglycan\"}}"}, "ts": "2023-07-09 23:00:28 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "HexNAc(3)Hex(3)Fuc(1)\n", "align": "wholeglycan"}}}, "ts": "2023-07-09 23:00:28 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 18}, "ts": "2023-07-09 23:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "error", "page": "glycan-search", "message": "No results. Structure Search query=18 Unable to parse"}, "ts": "2023-07-09 23:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3af76d975f752674d58603c7787b956a", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:00:35 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(3)Fuc(1)", "term_category": "glycan"}, "ts": "2023-07-09 23:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3af76d975f752674d58603c7787b956a>78ae074a065ebd766878d60e88ed75c4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(3)Fuc(1)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:00:36 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86286CX"}, "ts": "2023-07-09 23:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65537UV"}, "ts": "2023-07-09 23:00:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36379GD"}, "ts": "2023-07-09 23:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:00:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 23:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:00:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-09 23:00:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8A5-1"}, "ts": "2023-07-09 23:00:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8A5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:00:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25520XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 23:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:02:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-09 23:02:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:03:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7KZ85"}, "ts": "2023-07-09 23:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KZ85", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:04:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52789"}, "ts": "2023-07-09 23:05:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81088WT"}, "ts": "2023-07-09 23:06:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275"}, "ts": "2023-07-09 23:06:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNN8"}, "ts": "2023-07-09 23:06:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:06:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63069TR"}, "ts": "2023-07-09 23:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63069TR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 23:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 23:08:27 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 23:08:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 23:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:08:33 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(4)", "term_category": "glycan"}, "ts": "2023-07-09 23:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "78ae074a065ebd766878d60e88ed75c4>0613dc1cccb887acb105b6b8e78ba878", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(4)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0613dc1cccb887acb105b6b8e78ba878", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:08:33 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0613dc1cccb887acb105b6b8e78ba878", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:08:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09724ZC"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32156ZV"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56014GC"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84552CD"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55982TK"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039DE"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08011QI"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02402FF"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77964WB"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93975QL"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47909JD"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89738LW"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81269JJ"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06371NP"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40915GX"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21411GO"}, "ts": "2023-07-09 23:08:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97023FS"}, "ts": "2023-07-09 23:08:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56972PM"}, "ts": "2023-07-09 23:08:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22351RY"}, "ts": "2023-07-09 23:08:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81906GK"}, "ts": "2023-07-09 23:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:09:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15541", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 23:09:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 23:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15541", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 23:09:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11308"}, "ts": "2023-07-09 23:10:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11308"}, "ts": "2023-07-09 23:10:12 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 23:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 23:10:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "0613dc1cccb887acb105b6b8e78ba878", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0613dc1cccb887acb105b6b8e78ba878", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 23:10:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60943"}, "ts": "2023-07-09 23:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0613dc1cccb887acb105b6b8e78ba878", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:10:40 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(3)Hex(2)", "term_category": "glycan"}, "ts": "2023-07-09 23:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "0613dc1cccb887acb105b6b8e78ba878>ac6f7a847af07a335f66262d9e80fd43", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(3)Hex(2)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:10:41 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:10:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-09 23:10:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69500TM"}, "ts": "2023-07-09 23:10:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39203UC"}, "ts": "2023-07-09 23:10:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13260JU"}, "ts": "2023-07-09 23:10:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70125XL"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37653KL"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07932PU"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03670RH"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38684VZ"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27726WH"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33350UC"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48856VC"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07575HR"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53031QB"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22516UQ"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85282JA"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26724PP"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12035CL"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31317XB"}, "ts": "2023-07-09 23:10:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:11:03 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 23:11:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23511"}, "ts": "2023-07-09 23:11:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77597MJ"}, "ts": "2023-07-09 23:11:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-09 23:11:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29166US"}, "ts": "2023-07-09 23:11:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98007XA"}, "ts": "2023-07-09 23:11:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89720WL"}, "ts": "2023-07-09 23:11:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32910OR"}, "ts": "2023-07-09 23:11:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:11:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_data", "operator": "OR", "selected": ["Glycosylation"]}]}, "ts": "2023-07-09 23:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Y288", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:12:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Y288"}, "ts": "2023-07-09 23:12:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:13:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGD2"}, "ts": "2023-07-09 23:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 23:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV08", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 23:13:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV08"}, "ts": "2023-07-09 23:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF46"}, "ts": "2023-07-09 23:13:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92954-1.485.485"}, "ts": "2023-07-09 23:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92954-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82979-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:14:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82979-1"}, "ts": "2023-07-09 23:14:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:14:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13405", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:14:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13405.44.44"}, "ts": "2023-07-09 23:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 23:14:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-09 23:14:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:15:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-09 23:15:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28065"}, "ts": "2023-07-09 23:15:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21588"}, "ts": "2023-07-09 23:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZWS8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:16:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZWS8-1"}, "ts": "2023-07-09 23:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 23:16:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29655793", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 23:16:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29655793", "type": "PubMed"}, "ts": "2023-07-09 23:16:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:17:32 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 23:17:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:17:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-09 23:17:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q17RW2"}, "ts": "2023-07-09 23:18:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17RW2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:18:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:18:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54766"}, "ts": "2023-07-09 23:18:53 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 23:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 23:19:09 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 23:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:19:18 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(8)Hex(9)NeuAc(1)", "term_category": "glycan"}, "ts": "2023-07-09 23:19:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "ac6f7a847af07a335f66262d9e80fd43>847b15d61a2e83a053177252ff40dcca", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(8)Hex(9)NeuAc(1)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:19:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:19:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86414TE"}, "ts": "2023-07-09 23:19:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52802XR"}, "ts": "2023-07-09 23:19:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94831VI"}, "ts": "2023-07-09 23:19:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86942VM"}, "ts": "2023-07-09 23:19:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01525UQ"}, "ts": "2023-07-09 23:19:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89652IH"}, "ts": "2023-07-09 23:19:22 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 23:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:19:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30221QT"}, "ts": "2023-07-09 23:19:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75677VK"}, "ts": "2023-07-09 23:19:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:19:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-09 23:19:24 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 23:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 23:20:00 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 23:20:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "847b15d61a2e83a053177252ff40dcca", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:20:07 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(8)Hex(6)", "term_category": "glycan"}, "ts": "2023-07-09 23:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "847b15d61a2e83a053177252ff40dcca>d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(8)Hex(6)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:20:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:20:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86408JD"}, "ts": "2023-07-09 23:20:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61632YI"}, "ts": "2023-07-09 23:20:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14659NX"}, "ts": "2023-07-09 23:20:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67829KL"}, "ts": "2023-07-09 23:20:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91158SA"}, "ts": "2023-07-09 23:20:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69554DK"}, "ts": "2023-07-09 23:20:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80743YX"}, "ts": "2023-07-09 23:20:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25910LL"}, "ts": "2023-07-09 23:20:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63976XX"}, "ts": "2023-07-09 23:20:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:20:11 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 23:20:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-09 23:20:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:20:15 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-09 23:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:20:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26012"}, "ts": "2023-07-09 23:20:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26012", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:20:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F6QVZ8"}, "ts": "2023-07-09 23:20:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F6QVZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "error", "page": "glycan-search", "message": "Network error. search_init api call. Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.0.0 Safari/537.36"}, "ts": "2023-07-09 23:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52789", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:21:16 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 23:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 23:21:25 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 23:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 23:21:26 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(8)Hex(11)", "term_category": "glycan"}, "ts": "2023-07-09 23:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(8)Hex(11)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:21:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54840"}, "ts": "2023-07-09 23:21:33 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(8)Hex(11)", "term_category": "glycan"}, "ts": "2023-07-09 23:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "No results. Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(8)Hex(11)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:21:48 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(7)Hex(6)", "term_category": "glycan"}, "ts": "2023-07-09 23:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d3b1b03044b99516831cb2f15e20adce>724a606ba8f7b5b57c2a38b7cbc85761", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(7)Hex(6)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:21:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:21:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31532GK"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23484GM"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47058MH"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33785ND"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91623TN"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43549OX"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27290LL"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93542VJ"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36042WR"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10835DD"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77174TF"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56408DR"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93446UA"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50343XZ"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70439DD"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44027TT"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90712YJ"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75318VB"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62232KJ"}, "ts": "2023-07-09 23:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08486RO"}, "ts": "2023-07-09 23:21:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:21:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-09 23:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57250WI"}, "ts": "2023-07-09 23:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40065EM"}, "ts": "2023-07-09 23:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54499BT"}, "ts": "2023-07-09 23:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76630AE"}, "ts": "2023-07-09 23:21:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47220NG"}, "ts": "2023-07-09 23:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:21:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-09 23:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55992JL"}, "ts": "2023-07-09 23:21:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10670CL"}, "ts": "2023-07-09 23:21:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBL8-1"}, "ts": "2023-07-09 23:23:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBL8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:23:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:24:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75462.364.364"}, "ts": "2023-07-09 23:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75462", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7588067", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 23:24:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7588067", "type": "PubMed"}, "ts": "2023-07-09 23:24:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-09 23:25:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4D7"}, "ts": "2023-07-09 23:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4D7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:25:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1A5B4"}, "ts": "2023-07-09 23:25:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1A5B4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:25:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99856.119.119"}, "ts": "2023-07-09 23:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99856", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:26:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-09 23:26:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20823"}, "ts": "2023-07-09 23:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:27:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20930"}, "ts": "2023-07-09 23:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20930", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:30:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VV63.471.471"}, "ts": "2023-07-09 23:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2U2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:31:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2U2"}, "ts": "2023-07-09 23:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:31:07 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 23:31:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:31:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:31:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZN1"}, "ts": "2023-07-09 23:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-09 23:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 23:31:23 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "LACTB"}, "ts": "2023-07-09 23:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 23:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=LACTB"}, "ts": "2023-07-09 23:31:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b3efa959a5238c7a058b06e6ac3432e7", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-09 23:31:25 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-09 23:31:25 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "b3efa959a5238c7a058b06e6ac3432e7", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-09 23:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83111-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:31:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83111-1"}, "ts": "2023-07-09 23:31:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:31:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28065", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:31:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-09 23:31:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWR7"}, "ts": "2023-07-09 23:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWR7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:32:37 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 23:32:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07947.204.204"}, "ts": "2023-07-09 23:32:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07947", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:33:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75151"}, "ts": "2023-07-09 23:33:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99983"}, "ts": "2023-07-09 23:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:34:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82576YO"}, "ts": "2023-07-09 23:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06213", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N1Z9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:36:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N1Z9-1"}, "ts": "2023-07-09 23:36:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60237"}, "ts": "2023-07-09 23:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96F05", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:38:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96F05"}, "ts": "2023-07-09 23:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:38:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 23:38:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52209"}, "ts": "2023-07-09 23:38:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-09 23:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 23:39:00 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "LACTB"}, "ts": "2023-07-09 23:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 23:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=LACTB"}, "ts": "2023-07-09 23:39:00 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-09 23:39:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "40e2aab985bbd996aef18181bcbc8130", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-09 23:39:02 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "40e2aab985bbd996aef18181bcbc8130", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-09 23:39:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83111-1"}, "ts": "2023-07-09 23:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83111-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:39:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 23:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9Z9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:41:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N9Z9.57.57"}, "ts": "2023-07-09 23:41:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-09 23:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:42:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11395409", "type": "PubMed"}, "ts": "2023-07-09 23:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11395409", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-09 23:45:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYG9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:45:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYG9-1"}, "ts": "2023-07-09 23:45:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25815", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 23:45:38 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P25815", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 23:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25815", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-09 23:45:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86VM9.166.166"}, "ts": "2023-07-09 23:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VM9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6VZZ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6VZZ7"}, "ts": "2023-07-09 23:45:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-09 23:46:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-09 23:46:46 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 23:46:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:46:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "home", "message": "Performing Global Search"}, "ts": "2023-07-09 23:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 23:47:01 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "LACTB"}, "ts": "2023-07-09 23:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-09 23:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LACTB", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=LACTB"}, "ts": "2023-07-09 23:47:02 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "82cbe36a40d9cbd964d4a6debb562352", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-09 23:47:03 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-09 23:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "82cbe36a40d9cbd964d4a6debb562352", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-09 23:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83111-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:47:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83111-1"}, "ts": "2023-07-09 23:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-09 23:47:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-09 23:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:48:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRB3"}, "ts": "2023-07-09 23:48:02 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-09 23:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-09 23:48:43 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-09 23:48:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEP9"}, "ts": "2023-07-09 23:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:48:51 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "HexNAc(2)Hex(5)Fuc(1)", "term_category": "glycan"}, "ts": "2023-07-09 23:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-09 23:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "724a606ba8f7b5b57c2a38b7cbc85761>5fbceb7a8cc6bdcb4cb857113a2215c0", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"HexNAc(2)Hex(5)Fuc(1)\",\"term_category\":\"glycan\"}"}, "ts": "2023-07-09 23:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5fbceb7a8cc6bdcb4cb857113a2215c0", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:48:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5fbceb7a8cc6bdcb4cb857113a2215c0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-09 23:48:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50282JC"}, "ts": "2023-07-09 23:48:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "5fbceb7a8cc6bdcb4cb857113a2215c0", "user": "Undecided", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-09 23:48:55 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "5fbceb7a8cc6bdcb4cb857113a2215c0", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-09 23:48:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16109"}, "ts": "2023-07-09 23:49:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97769"}, "ts": "2023-07-09 23:49:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97769", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-09 23:49:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZVD3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:49:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZVD3-1"}, "ts": "2023-07-09 23:49:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-09 23:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82576YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-09 23:51:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17535", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:51:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17535"}, "ts": "2023-07-09 23:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:51:29 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-09 23:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-09 23:51:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05996"}, "ts": "2023-07-09 23:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:51:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZY8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-09 23:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF41-1"}, "ts": "2023-07-09 23:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF41-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16630-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:52:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16630-1"}, "ts": "2023-07-09 23:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:52:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-09 23:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14141-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:53:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14141-1"}, "ts": "2023-07-09 23:53:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-09 23:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XHY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:54:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XHY1"}, "ts": "2023-07-09 23:54:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5JWF2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-09 23:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JWF2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-09 23:54:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:54:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29350"}, "ts": "2023-07-09 23:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-09 23:57:37 EDT-0400"}]