[{"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 00:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 00:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 00:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 00:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 00:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 00:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P34820.235.235"}, "ts": "2023-07-07 00:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34820", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:00:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08211"}, "ts": "2023-07-07 00:00:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98171", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:00:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98171"}, "ts": "2023-07-07 00:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q148V7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:00:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q148V7-1"}, "ts": "2023-07-07 00:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LT7"}, "ts": "2023-07-07 00:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LT7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:01:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:01:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5X1"}, "ts": "2023-07-07 00:01:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 00:01:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 00:01:55 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 00:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07527DV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:02:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07527DV"}, "ts": "2023-07-07 00:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56269QK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:02:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56269QK"}, "ts": "2023-07-07 00:02:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLJ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:02:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLJ4-1"}, "ts": "2023-07-07 00:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10958799", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:02:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10958799", "type": "PubMed"}, "ts": "2023-07-07 00:02:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXT4"}, "ts": "2023-07-07 00:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78436BB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:03:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78436BB"}, "ts": "2023-07-07 00:03:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80746IL"}, "ts": "2023-07-07 00:03:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969W1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:04:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969W1"}, "ts": "2023-07-07 00:04:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "feedback", "message": "page access"}, "ts": "2023-07-07 00:04:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "feedback", "message": "page access"}, "ts": "2023-07-07 00:04:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59632"}, "ts": "2023-07-07 00:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:05:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A9G6-1"}, "ts": "2023-07-07 00:05:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A9G6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00027JG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:06:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00027JG"}, "ts": "2023-07-07 00:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRD8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:06:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRD8.40.40"}, "ts": "2023-07-07 00:06:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-07 00:06:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-07 00:06:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2328727", "type": "PubMed"}, "ts": "2023-07-07 00:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2328727", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NWY9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:07:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NWY9"}, "ts": "2023-07-07 00:07:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R613-1"}, "ts": "2023-07-07 00:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R613-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:08:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17959782", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:08:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17959782", "type": "PubMed"}, "ts": "2023-07-07 00:08:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10070"}, "ts": "2023-07-07 00:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:09:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99MK2-1"}, "ts": "2023-07-07 00:09:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MK2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:09:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:10:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULH4"}, "ts": "2023-07-07 00:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WZ0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:10:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86WZ0"}, "ts": "2023-07-07 00:10:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01031.265.265"}, "ts": "2023-07-07 00:10:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01031", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:10:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVR8-1"}, "ts": "2023-07-07 00:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVR8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PTA2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:10:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PTA2-1"}, "ts": "2023-07-07 00:10:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03591"}, "ts": "2023-07-07 00:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03591", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:10:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6AYC5.250.250"}, "ts": "2023-07-07 00:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYC5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75665", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:11:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75665.440.440"}, "ts": "2023-07-07 00:11:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 00:11:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14410", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 00:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14410", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 00:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZSY8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:11:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZSY8-1"}, "ts": "2023-07-07 00:11:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20816-1"}, "ts": "2023-07-07 00:12:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R991-1"}, "ts": "2023-07-07 00:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R991-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:12:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13304", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:12:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13304"}, "ts": "2023-07-07 00:12:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R652-1"}, "ts": "2023-07-07 00:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R652-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00450", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:12:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00450"}, "ts": "2023-07-07 00:12:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZX09-1"}, "ts": "2023-07-07 00:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZX09-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:12:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2VEC9"}, "ts": "2023-07-07 00:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2VEC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHI5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:13:15 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O15372", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 00:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15372", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 00:13:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHI5"}, "ts": "2023-07-07 00:13:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05164"}, "ts": "2023-07-07 00:13:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:13:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00613.127.127"}, "ts": "2023-07-07 00:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55196"}, "ts": "2023-07-07 00:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1E3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:15:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1E3"}, "ts": "2023-07-07 00:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22894"}, "ts": "2023-07-07 00:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AH0"}, "ts": "2023-07-07 00:16:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MA2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:16:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99MA2-1"}, "ts": "2023-07-07 00:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K260-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:16:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K260-1"}, "ts": "2023-07-07 00:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20844753", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:16:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20844753", "type": "PubMed"}, "ts": "2023-07-07 00:16:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75592IR"}, "ts": "2023-07-07 00:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75592IR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C025", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:16:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C025"}, "ts": "2023-07-07 00:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BPW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:17:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BPW8"}, "ts": "2023-07-07 00:17:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6I4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:17:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6I4"}, "ts": "2023-07-07 00:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:18:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUM9"}, "ts": "2023-07-07 00:18:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61966PH"}, "ts": "2023-07-07 00:18:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61966PH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:18:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02252"}, "ts": "2023-07-07 00:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03445UI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:19:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03445UI"}, "ts": "2023-07-07 00:19:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17600"}, "ts": "2023-07-07 00:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17600", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:19:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R402-1"}, "ts": "2023-07-07 00:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R402-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:20:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15375", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:20:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15375.527.527"}, "ts": "2023-07-07 00:20:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V6I6-1"}, "ts": "2023-07-07 00:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V6I6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:21:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P43251.119.119"}, "ts": "2023-07-07 00:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43251", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:21:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P53985.56.56"}, "ts": "2023-07-07 00:21:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53985", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:21:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUF5-1"}, "ts": "2023-07-07 00:21:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUF5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:21:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYH2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:21:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYH2-1"}, "ts": "2023-07-07 00:21:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10070"}, "ts": "2023-07-07 00:21:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60842"}, "ts": "2023-07-07 00:22:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60842", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHR0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:22:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHR0-1"}, "ts": "2023-07-07 00:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:22:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12313PD"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23984SE"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-07 00:23:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33609NS"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UVW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UVW9"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82119TF"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84820NF"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92062TF"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25079LO"}, "ts": "2023-07-07 00:23:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-07 00:23:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-07 00:23:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-07 00:23:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-07 00:23:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11279.183.183"}, "ts": "2023-07-07 00:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:23:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31022885", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:23:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31022885", "type": "PubMed"}, "ts": "2023-07-07 00:23:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULC0"}, "ts": "2023-07-07 00:23:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:23:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92844.192.192"}, "ts": "2023-07-07 00:24:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92844", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:24:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09857WN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:25:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09857WN"}, "ts": "2023-07-07 00:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:25:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TL0"}, "ts": "2023-07-07 00:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TL0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:25:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26018251", "type": "PubMed"}, "ts": "2023-07-07 00:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26018251", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13326"}, "ts": "2023-07-07 00:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13326", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60701", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:25:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60701.67.67"}, "ts": "2023-07-07 00:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYQ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:26:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYQ5.123.123"}, "ts": "2023-07-07 00:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:26:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5K6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:26:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5K6.458.458"}, "ts": "2023-07-07 00:26:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30559", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:26:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30559"}, "ts": "2023-07-07 00:26:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWW6.396.396"}, "ts": "2023-07-07 00:27:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:27:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65466VT"}, "ts": "2023-07-07 00:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65466VT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K828-1"}, "ts": "2023-07-07 00:28:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K828-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:28:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18347PA"}, "ts": "2023-07-07 00:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18347PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:28:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09801NJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:28:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09801NJ"}, "ts": "2023-07-07 00:28:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31388-1"}, "ts": "2023-07-07 00:28:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31388-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:28:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02198VW"}, "ts": "2023-07-07 00:28:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02198VW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:28:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JV56-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:28:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JV56-1"}, "ts": "2023-07-07 00:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LU46-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:29:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LU46-1"}, "ts": "2023-07-07 00:29:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:29:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55287.486.486"}, "ts": "2023-07-07 00:29:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04233.208.208"}, "ts": "2023-07-07 00:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04233", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:29:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80355WT"}, "ts": "2023-07-07 00:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80355WT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58660-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68146NX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:31:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68146NX"}, "ts": "2023-07-07 00:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15018WW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:31:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15018WW"}, "ts": "2023-07-07 00:31:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V089"}, "ts": "2023-07-07 00:31:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V089", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:31:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5CZC0-1"}, "ts": "2023-07-07 00:31:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5CZC0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:31:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UG50"}, "ts": "2023-07-07 00:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UG50", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26641", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:31:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26641"}, "ts": "2023-07-07 00:31:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01815-1"}, "ts": "2023-07-07 00:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01815-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:31:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43251"}, "ts": "2023-07-07 00:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43251", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:32:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68380FU"}, "ts": "2023-07-07 00:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68380FU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:32:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30939-1"}, "ts": "2023-07-07 00:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30939-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11438-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:32:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11438-1"}, "ts": "2023-07-07 00:32:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34981"}, "ts": "2023-07-07 00:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34981", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16254", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16254"}, "ts": "2023-07-07 00:33:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8945478", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:33:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8945478", "type": "PubMed"}, "ts": "2023-07-07 00:33:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19793862", "type": "PubMed"}, "ts": "2023-07-07 00:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19793862", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NYC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:34:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6NYC8.203.203"}, "ts": "2023-07-07 00:34:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:34:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14643"}, "ts": "2023-07-07 00:34:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13905.281.281"}, "ts": "2023-07-07 00:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13905", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:34:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9024696", "type": "PubMed"}, "ts": "2023-07-07 00:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9024696", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:34:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZP97"}, "ts": "2023-07-07 00:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZP97", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493"}, "ts": "2023-07-07 00:35:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q85ZW9"}, "ts": "2023-07-07 00:36:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q85ZW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:36:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62507"}, "ts": "2023-07-07 00:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:36:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IFH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:36:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IFH4"}, "ts": "2023-07-07 00:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95838", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:36:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95838"}, "ts": "2023-07-07 00:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LQM8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:36:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LQM8"}, "ts": "2023-07-07 00:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:36:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83555-1"}, "ts": "2023-07-07 00:36:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70531"}, "ts": "2023-07-07 00:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51787", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51787"}, "ts": "2023-07-07 00:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LQM8", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 00:36:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43916"}, "ts": "2023-07-07 00:37:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96P16"}, "ts": "2023-07-07 00:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P16", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:37:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95727.49.49"}, "ts": "2023-07-07 00:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95727", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K133-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:38:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K133-1"}, "ts": "2023-07-07 00:38:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16363"}, "ts": "2023-07-07 00:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:39:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LVL2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:39:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LVL2-1"}, "ts": "2023-07-07 00:39:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24743736", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:39:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24743736", "type": "PubMed"}, "ts": "2023-07-07 00:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:40:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62968"}, "ts": "2023-07-07 00:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:40:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88622CQ"}, "ts": "2023-07-07 00:40:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88622CQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:40:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12797", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:40:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12797"}, "ts": "2023-07-07 00:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17274955", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:40:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17274955", "type": "PubMed"}, "ts": "2023-07-07 00:40:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79245YF"}, "ts": "2023-07-07 00:41:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 00:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13007", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 00:41:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13007", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 00:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UNA4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:41:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UNA4-1"}, "ts": "2023-07-07 00:41:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q86X95", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 00:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:42:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GP6"}, "ts": "2023-07-07 00:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X95", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 00:42:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L5A3"}, "ts": "2023-07-07 00:42:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L5A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:42:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15116.58.58"}, "ts": "2023-07-07 00:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15116", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31641", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31641"}, "ts": "2023-07-07 00:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08195"}, "ts": "2023-07-07 00:43:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CHI8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:44:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CHI8-1"}, "ts": "2023-07-07 00:44:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12956", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:44:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12956.306.306"}, "ts": "2023-07-07 00:44:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05397.5.5"}, "ts": "2023-07-07 00:45:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05397", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:45:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:45:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13158"}, "ts": "2023-07-07 00:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11412116", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:45:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11412116", "type": "PubMed"}, "ts": "2023-07-07 00:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDX5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:45:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDX5.272.272"}, "ts": "2023-07-07 00:45:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02809"}, "ts": "2023-07-07 00:46:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02809", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:46:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PGN3"}, "ts": "2023-07-07 00:46:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGN3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:46:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24102721", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:46:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24102721", "type": "PubMed"}, "ts": "2023-07-07 00:46:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:46:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15155"}, "ts": "2023-07-07 00:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:47:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08913-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:47:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08913-1"}, "ts": "2023-07-07 00:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09470", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:47:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09470.700.700"}, "ts": "2023-07-07 00:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R159-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:47:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29083"}, "ts": "2023-07-07 00:47:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R159-1"}, "ts": "2023-07-07 00:47:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27281218", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:47:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27281218", "type": "PubMed"}, "ts": "2023-07-07 00:47:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1Z1-1"}, "ts": "2023-07-07 00:47:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1Z1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 00:47:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 00:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 00:47:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62744-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62744-1"}, "ts": "2023-07-07 00:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ND0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96ND0"}, "ts": "2023-07-07 00:48:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19798WM"}, "ts": "2023-07-07 00:49:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19798WM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:49:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33778"}, "ts": "2023-07-07 00:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:49:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJQ1.53.53"}, "ts": "2023-07-07 00:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:49:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1884998", "type": "PubMed"}, "ts": "2023-07-07 00:49:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1884998", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:49:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28655772", "type": "PubMed"}, "ts": "2023-07-07 00:49:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28655772", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:49:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-07 00:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:49:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15379550", "type": "PubMed"}, "ts": "2023-07-07 00:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15379550", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:50:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20061", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:50:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20061"}, "ts": "2023-07-07 00:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9C4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9C4-1"}, "ts": "2023-07-07 00:50:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03135-1"}, "ts": "2023-07-07 00:51:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23897824", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:51:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23897824", "type": "PubMed"}, "ts": "2023-07-07 00:51:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55700PF"}, "ts": "2023-07-07 00:52:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55700PF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:52:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19010891", "type": "PubMed"}, "ts": "2023-07-07 00:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19010891", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYE7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:52:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYE7"}, "ts": "2023-07-07 00:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:52:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33151", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:52:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33151.776.776"}, "ts": "2023-07-07 00:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7M8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:53:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C7M8-1"}, "ts": "2023-07-07 00:53:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R669-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R669-1"}, "ts": "2023-07-07 00:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34948083", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 00:54:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34948083", "type": "PubMed"}, "ts": "2023-07-07 00:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34948083", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 00:54:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1L4"}, "ts": "2023-07-07 00:54:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1L4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80W87", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:55:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80W87"}, "ts": "2023-07-07 00:55:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P28"}, "ts": "2023-07-07 00:55:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P290", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:55:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P290"}, "ts": "2023-07-07 00:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75900", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:56:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75900.123.123"}, "ts": "2023-07-07 00:56:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LVR0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:56:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LVR0-1"}, "ts": "2023-07-07 00:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-07 00:57:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.1559.1559"}, "ts": "2023-07-07 00:58:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 00:58:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20391ZE"}, "ts": "2023-07-07 00:58:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20391ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 00:58:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUC8-1"}, "ts": "2023-07-07 00:58:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUC8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39087-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:59:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39087-1"}, "ts": "2023-07-07 00:59:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6P531", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 00:59:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P531", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 00:59:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LZ94-1"}, "ts": "2023-07-07 00:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LZ94-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDW5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 00:59:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDW5"}, "ts": "2023-07-07 00:59:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54698"}, "ts": "2023-07-07 00:59:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:59:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54698", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 00:59:53 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 01:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 01:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 01:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 01:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 01:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 01:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BMJ8-1"}, "ts": "2023-07-07 01:00:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDR0.348.348"}, "ts": "2023-07-07 01:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5C1"}, "ts": "2023-07-07 01:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0M6"}, "ts": "2023-07-07 01:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0M6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70193"}, "ts": "2023-07-07 01:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70193", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQP0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:01:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PQP0-1"}, "ts": "2023-07-07 01:01:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:01:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13133"}, "ts": "2023-07-07 01:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13133", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:01:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41222-1.78.78"}, "ts": "2023-07-07 01:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41222-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:01:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60449", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:02:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60449.137.137"}, "ts": "2023-07-07 01:02:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O89001"}, "ts": "2023-07-07 01:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:02:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-07 01:03:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32152BH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:03:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00030HB"}, "ts": "2023-07-07 01:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00030HB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:03:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32152BH"}, "ts": "2023-07-07 01:03:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PCD5.17.17"}, "ts": "2023-07-07 01:03:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16150-1.137.137"}, "ts": "2023-07-07 01:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10613842", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:03:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10613842", "type": "PubMed"}, "ts": "2023-07-07 01:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2W2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:04:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2W2.605.605"}, "ts": "2023-07-07 01:04:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1N7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:04:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1N7"}, "ts": "2023-07-07 01:04:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:04:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58173"}, "ts": "2023-07-07 01:04:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:04:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14940"}, "ts": "2023-07-07 01:04:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:05:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3A3"}, "ts": "2023-07-07 01:05:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35632"}, "ts": "2023-07-07 01:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10449921", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:07:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10449921", "type": "PubMed"}, "ts": "2023-07-07 01:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15477", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:07:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15477.938.938"}, "ts": "2023-07-07 01:07:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16410", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:07:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16410"}, "ts": "2023-07-07 01:07:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03135-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BZ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:07:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96BZ9.139.139"}, "ts": "2023-07-07 01:07:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q149M0"}, "ts": "2023-07-07 01:07:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q149M0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:07:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0VDD8"}, "ts": "2023-07-07 01:07:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VDD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R0F3"}, "ts": "2023-07-07 01:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R0F3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L8W6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:08:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L8W6.233.233"}, "ts": "2023-07-07 01:08:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11707436", "type": "PubMed"}, "ts": "2023-07-07 01:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11707436", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:08:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0K2S4Q6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:09:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0K2S4Q6"}, "ts": "2023-07-07 01:09:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32396872", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:09:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGQ6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 01:09:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32396872", "type": "PubMed"}, "ts": "2023-07-07 01:09:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8BGQ6", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 01:09:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22387015", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:09:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22387015", "type": "PubMed"}, "ts": "2023-07-07 01:09:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4U0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:10:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R4U0.933.933"}, "ts": "2023-07-07 01:10:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15526"}, "ts": "2023-07-07 01:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15526", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3P9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:10:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3P9-1"}, "ts": "2023-07-07 01:10:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0P6"}, "ts": "2023-07-07 01:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:11:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17603038", "type": "PubMed"}, "ts": "2023-07-07 01:11:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17603038", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M277-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:12:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M277-1"}, "ts": "2023-07-07 01:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35305", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:12:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 01:12:30 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q68CJ9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 01:12:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CJ9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 01:12:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35305"}, "ts": "2023-07-07 01:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61459JW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:13:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61459JW"}, "ts": "2023-07-07 01:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B7SBD2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:13:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B7SBD2-1"}, "ts": "2023-07-07 01:13:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7R8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:13:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7R8-1"}, "ts": "2023-07-07 01:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1850323", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:13:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1850323", "type": "PubMed"}, "ts": "2023-07-07 01:13:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:14:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10888"}, "ts": "2023-07-07 01:14:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921I1"}, "ts": "2023-07-07 01:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921I1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75503", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:14:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75503"}, "ts": "2023-07-07 01:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q11201"}, "ts": "2023-07-07 01:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11201", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11246467", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:15:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11246467", "type": "PubMed"}, "ts": "2023-07-07 01:15:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22888"}, "ts": "2023-07-07 01:15:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14CW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14CW9"}, "ts": "2023-07-07 01:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07866", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:15:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q07866.112.112"}, "ts": "2023-07-07 01:15:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69905"}, "ts": "2023-07-07 01:15:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10102268", "type": "PubMed"}, "ts": "2023-07-07 01:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10102268", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9A1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:16:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9A1"}, "ts": "2023-07-07 01:16:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-07 01:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:16:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31544HA"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-07 01:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41247ZX"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46503DX"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37868ZX"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42358LZ"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45495MK"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59626AS"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71146HJ"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-07 01:16:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM33", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:16:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM33"}, "ts": "2023-07-07 01:16:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:17:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTA9"}, "ts": "2023-07-07 01:17:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P57776.147.147"}, "ts": "2023-07-07 01:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57776", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:17:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CDV6"}, "ts": "2023-07-07 01:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CDV6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JZL7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:18:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JZL7-1"}, "ts": "2023-07-07 01:18:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AC33-1"}, "ts": "2023-07-07 01:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AC33-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:18:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CCG1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:19:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CCG1"}, "ts": "2023-07-07 01:19:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:19:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6C8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:19:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N6C8.140.140"}, "ts": "2023-07-07 01:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95777", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:19:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95777.47.47"}, "ts": "2023-07-07 01:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:19:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDS4"}, "ts": "2023-07-07 01:19:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01160.75.75"}, "ts": "2023-07-07 01:19:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01160", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:19:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3U7"}, "ts": "2023-07-07 01:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3U7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:20:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18938DW"}, "ts": "2023-07-07 01:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JI13", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:21:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JI13"}, "ts": "2023-07-07 01:21:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50454"}, "ts": "2023-07-07 01:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64239ON", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:22:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64239ON"}, "ts": "2023-07-07 01:22:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35632", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:22:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9748258", "type": "PubMed"}, "ts": "2023-07-07 01:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9748258", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43822", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:22:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43822.177.177"}, "ts": "2023-07-07 01:22:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUN7"}, "ts": "2023-07-07 01:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUN7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:23:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5I0.405.405"}, "ts": "2023-07-07 01:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5I0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:24:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94814YD"}, "ts": "2023-07-07 01:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13535", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:24:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13535.1139.1139"}, "ts": "2023-07-07 01:24:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92574"}, "ts": "2023-07-07 01:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:24:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:24:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NXT6"}, "ts": "2023-07-07 01:24:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NXT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:24:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K212-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:24:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K212-1"}, "ts": "2023-07-07 01:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AY3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:25:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96AY3.70.70"}, "ts": "2023-07-07 01:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC84", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:26:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HC84.145.145"}, "ts": "2023-07-07 01:26:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WV92.486.486"}, "ts": "2023-07-07 01:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV92", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:26:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19790060", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:26:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19790060", "type": "PubMed"}, "ts": "2023-07-07 01:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7C1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:26:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7C1"}, "ts": "2023-07-07 01:26:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99824ER"}, "ts": "2023-07-07 01:27:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99824ER", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:27:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFG4"}, "ts": "2023-07-07 01:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFG4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:27:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C6S7-1"}, "ts": "2023-07-07 01:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C6S7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:27:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18428"}, "ts": "2023-07-07 01:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:27:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35556.513.513"}, "ts": "2023-07-07 01:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35556", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:27:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZL04-1"}, "ts": "2023-07-07 01:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZL04-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:27:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55291"}, "ts": "2023-07-07 01:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55291", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:28:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5"}, "ts": "2023-07-07 01:28:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05707", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:28:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05707.330.330"}, "ts": "2023-07-07 01:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:28:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:29:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16769"}, "ts": "2023-07-07 01:29:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10976108", "type": "PubMed"}, "ts": "2023-07-07 01:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10976108", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:30:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19483RZ"}, "ts": "2023-07-07 01:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19483RZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34512667", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:31:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34512667", "type": "PubMed"}, "ts": "2023-07-07 01:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69905", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:31:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35228", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:31:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35228"}, "ts": "2023-07-07 01:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14003", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:31:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14003.217.217"}, "ts": "2023-07-07 01:31:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34925", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:31:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34925"}, "ts": "2023-07-07 01:31:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TB61-1"}, "ts": "2023-07-07 01:31:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TB61-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:32:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGL9.31.31"}, "ts": "2023-07-07 01:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:32:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:32:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12860.504.504"}, "ts": "2023-07-07 01:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZFT1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:32:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZFT1-1"}, "ts": "2023-07-07 01:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LY63-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:33:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LY63-1"}, "ts": "2023-07-07 01:33:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-07 01:33:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99965.674.674"}, "ts": "2023-07-07 01:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99965", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N184", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:33:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N184"}, "ts": "2023-07-07 01:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08709", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:33:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08709"}, "ts": "2023-07-07 01:33:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZSZ1-1"}, "ts": "2023-07-07 01:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZSZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:36:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y365"}, "ts": "2023-07-07 01:36:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y365", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:36:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q695P6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q695P6-1"}, "ts": "2023-07-07 01:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V0I2-1"}, "ts": "2023-07-07 01:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V0I2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:36:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DT39"}, "ts": "2023-07-07 01:36:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DT39", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:36:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18938DW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:36:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88509-1"}, "ts": "2023-07-07 01:37:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88509-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:37:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7Q0"}, "ts": "2023-07-07 01:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7Q0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:37:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60936"}, "ts": "2023-07-07 01:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60936", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50454", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:37:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29940176", "type": "PubMed"}, "ts": "2023-07-07 01:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29940176", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99819", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:38:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99819"}, "ts": "2023-07-07 01:38:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-07 01:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0X4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0X4"}, "ts": "2023-07-07 01:38:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9Z9"}, "ts": "2023-07-07 01:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9Z9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYK9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:40:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QYK9-1"}, "ts": "2023-07-07 01:40:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16704KR"}, "ts": "2023-07-07 01:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G16704KR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 01:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:40:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41240"}, "ts": "2023-07-07 01:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18491BK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:40:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18491BK"}, "ts": "2023-07-07 01:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV78-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV78-1"}, "ts": "2023-07-07 01:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:41:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19525.101.101"}, "ts": "2023-07-07 01:41:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXX7.767.767"}, "ts": "2023-07-07 01:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:41:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-07 01:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97765", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:42:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97765"}, "ts": "2023-07-07 01:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y653-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 01:43:19 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y653-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 01:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZQ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:43:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZQ8"}, "ts": "2023-07-07 01:43:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13796", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:43:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13796.111.111"}, "ts": "2023-07-07 01:43:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H173.73.73"}, "ts": "2023-07-07 01:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H173", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:43:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10071"}, "ts": "2023-07-07 01:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXK5"}, "ts": "2023-07-07 01:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DFV3-1"}, "ts": "2023-07-07 01:43:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DFV3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:43:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61461RA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:43:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61461RA"}, "ts": "2023-07-07 01:43:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J1G0"}, "ts": "2023-07-07 01:43:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J1G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92621", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:43:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92621"}, "ts": "2023-07-07 01:43:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13535.1139.1139"}, "ts": "2023-07-07 01:44:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13535", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:44:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34552126", "type": "PubMed"}, "ts": "2023-07-07 01:44:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34552126", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:44:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34552126", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 01:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17948", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:45:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17948.251.251"}, "ts": "2023-07-07 01:45:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5N1"}, "ts": "2023-07-07 01:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5N1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12372285", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:45:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12372285", "type": "PubMed"}, "ts": "2023-07-07 01:45:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXY9-1"}, "ts": "2023-07-07 01:46:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXY9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:46:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33774131", "type": "PubMed"}, "ts": "2023-07-07 01:46:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00893FE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:46:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00893FE"}, "ts": "2023-07-07 01:46:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33774131", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:46:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33774131", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 01:46:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01912KI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:46:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01912KI"}, "ts": "2023-07-07 01:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0P678"}, "ts": "2023-07-07 01:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0P678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:47:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UX04.295.295"}, "ts": "2023-07-07 01:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX04", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35021072", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:47:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35021072", "type": "PubMed"}, "ts": "2023-07-07 01:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62054DD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:47:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62054DD"}, "ts": "2023-07-07 01:47:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22396657", "type": "PubMed"}, "ts": "2023-07-07 01:47:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22396657", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:47:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06907.122.122"}, "ts": "2023-07-07 01:47:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06907", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8943050", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:48:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8943050", "type": "PubMed"}, "ts": "2023-07-07 01:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16472755", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:48:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16472755", "type": "PubMed"}, "ts": "2023-07-07 01:48:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80193TN"}, "ts": "2023-07-07 01:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80193TN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:48:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4P7-1"}, "ts": "2023-07-07 01:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4P7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:48:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5D1E8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:48:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5D1E8"}, "ts": "2023-07-07 01:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12050673", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:49:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12050673", "type": "PubMed"}, "ts": "2023-07-07 01:49:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35918"}, "ts": "2023-07-07 01:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35918", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:49:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16851.13.13"}, "ts": "2023-07-07 01:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:49:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2PPJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:49:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2PPJ7"}, "ts": "2023-07-07 01:49:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16851", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BQU6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 01:50:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8BQU6", "cluster_type": "unselected"}, "ts": "2023-07-07 01:50:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BQU6", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 01:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61398", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:51:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61398"}, "ts": "2023-07-07 01:51:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYW6"}, "ts": "2023-07-07 01:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYW6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:51:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13185.99.99"}, "ts": "2023-07-07 01:51:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13185", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:51:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S96"}, "ts": "2023-07-07 01:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S96", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 01:52:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20033"}, "ts": "2023-07-07 01:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20033", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:52:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76009"}, "ts": "2023-07-07 01:52:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76009", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UI32-1"}, "ts": "2023-07-07 01:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI32-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:52:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58236FD"}, "ts": "2023-07-07 01:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58236FD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:52:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q924Z4.19.19"}, "ts": "2023-07-07 01:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924Z4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:52:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZPW1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:52:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZPW1-1"}, "ts": "2023-07-07 01:52:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15153"}, "ts": "2023-07-07 01:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:53:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:53:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:53:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09429"}, "ts": "2023-07-07 01:53:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4L1"}, "ts": "2023-07-07 01:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14839", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14839"}, "ts": "2023-07-07 01:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKD3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKD3-1"}, "ts": "2023-07-07 01:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N2G4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:54:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N2G4"}, "ts": "2023-07-07 01:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:54:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYV4.597.597"}, "ts": "2023-07-07 01:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52799", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:54:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52799"}, "ts": "2023-07-07 01:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0-1"}, "ts": "2023-07-07 01:55:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31914633", "type": "PubMed"}, "ts": "2023-07-07 01:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31914633", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:55:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96HA1.958.958"}, "ts": "2023-07-07 01:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HA1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:56:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2277079", "type": "PubMed"}, "ts": "2023-07-07 01:56:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2277079", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:56:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-07 01:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R785-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:56:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R785-1"}, "ts": "2023-07-07 01:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G38121JC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:56:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38121JC"}, "ts": "2023-07-07 01:56:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIW4"}, "ts": "2023-07-07 01:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIW4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30419", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:56:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30419"}, "ts": "2023-07-07 01:56:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30835"}, "ts": "2023-07-07 01:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:57:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P07858.144.144"}, "ts": "2023-07-07 01:57:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:57:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:57:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PH6"}, "ts": "2023-07-07 01:57:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1C0.127.127"}, "ts": "2023-07-07 01:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1C0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25547114", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 01:58:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25547114", "type": "PubMed"}, "ts": "2023-07-07 01:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:58:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWQ0"}, "ts": "2023-07-07 01:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12866", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:58:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12866"}, "ts": "2023-07-07 01:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98728LU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 01:58:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98728LU"}, "ts": "2023-07-07 01:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:59:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPV9.719.719"}, "ts": "2023-07-07 01:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:59:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:59:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-07 01:59:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:59:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VB7"}, "ts": "2023-07-07 01:59:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBS9.963.963"}, "ts": "2023-07-07 01:59:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBS9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 01:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R5D4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 01:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R5D4-1"}, "ts": "2023-07-07 01:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35520"}, "ts": "2023-07-07 01:59:55 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 02:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 02:00:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51956", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 02:00:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51956"}, "ts": "2023-07-07 02:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 02:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97687", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:00:04 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 02:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97687"}, "ts": "2023-07-07 02:00:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 02:00:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZUU3"}, "ts": "2023-07-07 02:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZUU3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51580", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:00:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51580.138.138"}, "ts": "2023-07-07 02:00:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46531"}, "ts": "2023-07-07 02:00:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54652-1"}, "ts": "2023-07-07 02:00:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYH2"}, "ts": "2023-07-07 02:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYH2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27645", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:00:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27645.171.171"}, "ts": "2023-07-07 02:00:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13811NF"}, "ts": "2023-07-07 02:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13811NF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:00:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08752"}, "ts": "2023-07-07 02:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08752", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:00:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMX0"}, "ts": "2023-07-07 02:00:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00050MO"}, "ts": "2023-07-07 02:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00050MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54890", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54890"}, "ts": "2023-07-07 02:00:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35367"}, "ts": "2023-07-07 02:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35367", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R1S7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:01:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9R1S7.341.341"}, "ts": "2023-07-07 02:01:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275-1"}, "ts": "2023-07-07 02:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61554", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:01:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61554"}, "ts": "2023-07-07 02:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7779757", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:01:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7779757", "type": "PubMed"}, "ts": "2023-07-07 02:01:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8K2U0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:01:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8K2U0.829.829"}, "ts": "2023-07-07 02:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:02:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.3840.3840"}, "ts": "2023-07-07 02:02:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-07 02:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:02:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X29"}, "ts": "2023-07-07 02:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:03:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan_list.html", "message": "page access"}, "ts": "2023-07-07 02:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56706", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:04:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56706"}, "ts": "2023-07-07 02:04:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BMU0"}, "ts": "2023-07-07 02:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BMU0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:04:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75376.539.539"}, "ts": "2023-07-07 02:04:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75376", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:04:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6L5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:05:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H6L5.66.66"}, "ts": "2023-07-07 02:05:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06280"}, "ts": "2023-07-07 02:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99026RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:05:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99026RX"}, "ts": "2023-07-07 02:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:05:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTX7"}, "ts": "2023-07-07 02:05:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23263164", "type": "PubMed"}, "ts": "2023-07-07 02:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23263164", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:05:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18146"}, "ts": "2023-07-07 02:06:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "h33ypufjpu2cnvcvxrrm1pfu43umrp2c", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18146", "user": "h33ypufjpu2cnvcvxrrm1pfu43umrp2c", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09651", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:06:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09651.363.363"}, "ts": "2023-07-07 02:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3U7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:06:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H3U7.86.86"}, "ts": "2023-07-07 02:06:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-07 02:06:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 02:06:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:06:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96A83.70.70"}, "ts": "2023-07-07 02:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13449", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:07:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13449"}, "ts": "2023-07-07 02:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:07:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BXN1.51.51"}, "ts": "2023-07-07 02:07:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O76024.661.661"}, "ts": "2023-07-07 02:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76024", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:07:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66961JH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:08:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66961JH"}, "ts": "2023-07-07 02:08:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92945", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7G2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:09:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7G2-1"}, "ts": "2023-07-07 02:09:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92945.144.144"}, "ts": "2023-07-07 02:09:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14194", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:10:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14194.495.495"}, "ts": "2023-07-07 02:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90755YG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:10:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90755YG"}, "ts": "2023-07-07 02:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96C86", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:11:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96C86"}, "ts": "2023-07-07 02:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:11:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFX4"}, "ts": "2023-07-07 02:11:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80WM9"}, "ts": "2023-07-07 02:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80WM9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:11:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q15942", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 02:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 02:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0B8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:11:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0B8"}, "ts": "2023-07-07 02:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G66154CH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:11:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66154CH"}, "ts": "2023-07-07 02:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TME0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:12:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7TME0.363.363"}, "ts": "2023-07-07 02:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:12:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75317"}, "ts": "2023-07-07 02:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:12:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:12:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZW8"}, "ts": "2023-07-07 02:12:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95980", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:12:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95980.444.444"}, "ts": "2023-07-07 02:12:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25446-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:13:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25446-1"}, "ts": "2023-07-07 02:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZK29-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:13:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZK29-1"}, "ts": "2023-07-07 02:13:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60279", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:13:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60279.277.277"}, "ts": "2023-07-07 02:13:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02463"}, "ts": "2023-07-07 02:13:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02463", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:13:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-07 02:13:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X19", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:14:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86X19.13.13"}, "ts": "2023-07-07 02:14:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12778-1"}, "ts": "2023-07-07 02:14:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54838-1"}, "ts": "2023-07-07 02:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:15:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41146"}, "ts": "2023-07-07 02:15:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7P1"}, "ts": "2023-07-07 02:15:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7P1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUM0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:15:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUM0"}, "ts": "2023-07-07 02:15:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41146", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:15:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:15:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPB0"}, "ts": "2023-07-07 02:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:15:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-07 02:15:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:15:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVR3-1"}, "ts": "2023-07-07 02:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54652-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:16:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-07 02:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ZAV0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:17:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ZAV0"}, "ts": "2023-07-07 02:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 02:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33681", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:17:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33681.192.192"}, "ts": "2023-07-07 02:17:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19075PM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:17:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19075PM"}, "ts": "2023-07-07 02:17:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:18:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05532"}, "ts": "2023-07-07 02:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P99028-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:18:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P99028-1"}, "ts": "2023-07-07 02:18:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29517484", "type": "PubMed"}, "ts": "2023-07-07 02:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29517484", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:18:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVA2"}, "ts": "2023-07-07 02:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "H1UBN0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:19:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "H1UBN0-1"}, "ts": "2023-07-07 02:19:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAZ5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:19:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAZ5-1"}, "ts": "2023-07-07 02:19:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01920", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:19:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01920"}, "ts": "2023-07-07 02:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16288", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:20:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16288.267.267"}, "ts": "2023-07-07 02:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68588WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:20:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68588WQ"}, "ts": "2023-07-07 02:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY27", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:20:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY27"}, "ts": "2023-07-07 02:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0Q6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:20:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0Q6-1"}, "ts": "2023-07-07 02:20:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-07 02:20:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00824LK"}, "ts": "2023-07-07 02:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00824LK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:20:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9QAT4"}, "ts": "2023-07-07 02:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9QAT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:20:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61186MM"}, "ts": "2023-07-07 02:21:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61186MM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:21:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-07 02:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:21:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34925", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:21:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34925"}, "ts": "2023-07-07 02:21:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53R41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:21:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53R41"}, "ts": "2023-07-07 02:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:21:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NRY5.87.87"}, "ts": "2023-07-07 02:21:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09167-1"}, "ts": "2023-07-07 02:21:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09167-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:21:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15831496", "type": "PubMed"}, "ts": "2023-07-07 02:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15831496", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:21:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1Y3-1"}, "ts": "2023-07-07 02:21:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1Y3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:22:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86Y22"}, "ts": "2023-07-07 02:22:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:22:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-07 02:22:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96G74.128.128"}, "ts": "2023-07-07 02:23:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:23:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFW9"}, "ts": "2023-07-07 02:23:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G44754DF"}, "ts": "2023-07-07 02:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G44754DF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:24:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20042", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:24:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20042"}, "ts": "2023-07-07 02:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06104DC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:24:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06104DC"}, "ts": "2023-07-07 02:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22705208", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:24:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22705208", "type": "PubMed"}, "ts": "2023-07-07 02:24:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT22-1"}, "ts": "2023-07-07 02:24:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT22-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:25:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13303-1"}, "ts": "2023-07-07 02:25:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13303-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ABZ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:25:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ABZ4-1"}, "ts": "2023-07-07 02:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:25:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7D3"}, "ts": "2023-07-07 02:25:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7D3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:25:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16442"}, "ts": "2023-07-07 02:25:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:25:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:25:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27752QD"}, "ts": "2023-07-07 02:25:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27752QD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:25:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95800DS"}, "ts": "2023-07-07 02:25:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95393JS"}, "ts": "2023-07-07 02:25:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99448WD"}, "ts": "2023-07-07 02:25:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97765TT"}, "ts": "2023-07-07 02:25:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96338EK"}, "ts": "2023-07-07 02:25:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98030BR"}, "ts": "2023-07-07 02:25:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99034SV"}, "ts": "2023-07-07 02:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05546WG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:25:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05546WG"}, "ts": "2023-07-07 02:25:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98540DJ"}, "ts": "2023-07-07 02:25:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99853JR"}, "ts": "2023-07-07 02:25:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99651QK"}, "ts": "2023-07-07 02:25:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98903TR"}, "ts": "2023-07-07 02:25:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98419CX"}, "ts": "2023-07-07 02:25:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99981ST"}, "ts": "2023-07-07 02:26:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99420ZQ"}, "ts": "2023-07-07 02:26:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95994EE"}, "ts": "2023-07-07 02:26:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96223WK"}, "ts": "2023-07-07 02:26:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96886RU"}, "ts": "2023-07-07 02:26:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98552UD"}, "ts": "2023-07-07 02:26:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98732ZL"}, "ts": "2023-07-07 02:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QD16-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:26:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QD16-1"}, "ts": "2023-07-07 02:26:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61978-1"}, "ts": "2023-07-07 02:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61978-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:26:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16655"}, "ts": "2023-07-07 02:26:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49401CB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:26:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49401CB"}, "ts": "2023-07-07 02:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2971663", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:26:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2971663", "type": "PubMed"}, "ts": "2023-07-07 02:26:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T7B8.366.366"}, "ts": "2023-07-07 02:26:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7B8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:26:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPG1"}, "ts": "2023-07-07 02:27:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62823"}, "ts": "2023-07-07 02:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15334068", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:27:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15334068", "type": "PubMed"}, "ts": "2023-07-07 02:27:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15123686", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:27:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15123686", "type": "PubMed"}, "ts": "2023-07-07 02:27:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-07 02:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:27:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54001"}, "ts": "2023-07-07 02:28:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:28:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZV70-1"}, "ts": "2023-07-07 02:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZV70-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:28:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:28:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCZ2"}, "ts": "2023-07-07 02:28:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18827", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:28:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18827.220.220"}, "ts": "2023-07-07 02:28:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:28:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-07 02:29:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13838"}, "ts": "2023-07-07 02:29:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13838", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:29:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T4B2"}, "ts": "2023-07-07 02:29:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4B2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:29:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:29:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-07 02:29:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYV9.521.521"}, "ts": "2023-07-07 02:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYV9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A576-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:29:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A576-1"}, "ts": "2023-07-07 02:29:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99615", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:29:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99615.393.393"}, "ts": "2023-07-07 02:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49194", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:30:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49194"}, "ts": "2023-07-07 02:30:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7LBC6.366.366"}, "ts": "2023-07-07 02:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LBC6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:30:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:30:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6B4"}, "ts": "2023-07-07 02:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6B4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1H2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:30:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09668"}, "ts": "2023-07-07 02:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09668", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:31:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3T1H2"}, "ts": "2023-07-07 02:31:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90037CR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:31:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90037CR"}, "ts": "2023-07-07 02:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03700LH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:31:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03700LH"}, "ts": "2023-07-07 02:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G28233ME", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:31:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G28233ME"}, "ts": "2023-07-07 02:31:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02786.55.55"}, "ts": "2023-07-07 02:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34795YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:31:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34795YW"}, "ts": "2023-07-07 02:31:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20012OO"}, "ts": "2023-07-07 02:32:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20012OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:32:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:32:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2P0.734.734"}, "ts": "2023-07-07 02:32:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78386"}, "ts": "2023-07-07 02:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2P0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51689", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:33:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51689.554.554"}, "ts": "2023-07-07 02:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62511-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:33:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62511-1"}, "ts": "2023-07-07 02:33:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2M2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:33:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2M2.304.304"}, "ts": "2023-07-07 02:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35407", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:34:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35407"}, "ts": "2023-07-07 02:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:34:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLY0-1"}, "ts": "2023-07-07 02:34:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLY0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:34:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35918"}, "ts": "2023-07-07 02:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35918", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:34:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:35:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:35:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35637"}, "ts": "2023-07-07 02:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYG8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:35:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYG8-1"}, "ts": "2023-07-07 02:35:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98082"}, "ts": "2023-07-07 02:35:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 02:35:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13987-1"}, "ts": "2023-07-07 02:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15399", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:36:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15399"}, "ts": "2023-07-07 02:36:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34884742", "type": "PubMed"}, "ts": "2023-07-07 02:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34884742", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 02:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60935", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 02:36:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q60935", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 02:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:36:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:36:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47883"}, "ts": "2023-07-07 02:36:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:36:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYK5"}, "ts": "2023-07-07 02:36:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29749642", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:37:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29749642", "type": "PubMed"}, "ts": "2023-07-07 02:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29749642", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 02:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25759474", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:37:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25759474", "type": "PubMed"}, "ts": "2023-07-07 02:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04066", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:37:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04066.382.382"}, "ts": "2023-07-07 02:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDQ1-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 02:38:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8TDQ1-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 02:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53ET0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:38:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q53ET0.37.37"}, "ts": "2023-07-07 02:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00788-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:38:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00788-1"}, "ts": "2023-07-07 02:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02109YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:38:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02109YE"}, "ts": "2023-07-07 02:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60981-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2Z9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:39:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31444371", "type": "PubMed"}, "ts": "2023-07-07 02:39:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31444371", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6W7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:39:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6W7-1"}, "ts": "2023-07-07 02:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25015291", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:40:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25015291", "type": "PubMed"}, "ts": "2023-07-07 02:40:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43660.97.97"}, "ts": "2023-07-07 02:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43660", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:40:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7923647", "type": "PubMed"}, "ts": "2023-07-07 02:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7923647", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:40:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVC3-1"}, "ts": "2023-07-07 02:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVC3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:40:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34036390", "type": "PubMed"}, "ts": "2023-07-07 02:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34036390", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49959-1"}, "ts": "2023-07-07 02:41:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49959-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:41:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7V8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:41:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7V8-1"}, "ts": "2023-07-07 02:41:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VF76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:41:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VF76"}, "ts": "2023-07-07 02:41:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-07 02:41:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 02:41:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05112"}, "ts": "2023-07-07 02:42:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:42:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZR2"}, "ts": "2023-07-07 02:42:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07443RM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:42:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07443RM"}, "ts": "2023-07-07 02:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65889KE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:42:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65889KE"}, "ts": "2023-07-07 02:42:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZQQ6"}, "ts": "2023-07-07 02:43:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZQQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:43:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BMS2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:43:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BMS2"}, "ts": "2023-07-07 02:43:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25550423", "type": "PubMed"}, "ts": "2023-07-07 02:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25550423", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15061"}, "ts": "2023-07-07 02:43:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02649"}, "ts": "2023-07-07 02:43:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PV3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PV3-1"}, "ts": "2023-07-07 02:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35579", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:44:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35579"}, "ts": "2023-07-07 02:44:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8095446", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:44:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8095446", "type": "PubMed"}, "ts": "2023-07-07 02:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8095446", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 02:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW61-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:44:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW61-1"}, "ts": "2023-07-07 02:44:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12873", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:45:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12873.713.713"}, "ts": "2023-07-07 02:45:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QZQ1.655.655"}, "ts": "2023-07-07 02:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:45:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13164"}, "ts": "2023-07-07 02:45:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:45:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TU7"}, "ts": "2023-07-07 02:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86TU7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2S5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:45:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2S5-1"}, "ts": "2023-07-07 02:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KZF4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:45:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7KZF4.240.240"}, "ts": "2023-07-07 02:45:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51623PN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:46:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51623PN"}, "ts": "2023-07-07 02:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWZ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:46:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWZ3.434.434"}, "ts": "2023-07-07 02:46:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14174"}, "ts": "2023-07-07 02:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2N7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:47:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2N7.254.254"}, "ts": "2023-07-07 02:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55407TJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:47:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55407TJ"}, "ts": "2023-07-07 02:47:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PXP3"}, "ts": "2023-07-07 02:47:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PXP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:47:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25940.323.323"}, "ts": "2023-07-07 02:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25940", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:47:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18584GW"}, "ts": "2023-07-07 02:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18584GW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:48:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2283997", "type": "PubMed"}, "ts": "2023-07-07 02:48:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2283997", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C5K0-1"}, "ts": "2023-07-07 02:48:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEW2-1"}, "ts": "2023-07-07 02:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C5K0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:48:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEW2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:48:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00169.165.165"}, "ts": "2023-07-07 02:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00169", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60721", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:48:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60721.968.968"}, "ts": "2023-07-07 02:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15365", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:49:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15365"}, "ts": "2023-07-07 02:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9U9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:49:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9U9"}, "ts": "2023-07-07 02:49:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 02:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXB9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 02:49:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9QXB9", "cluster_type": "unselected"}, "ts": "2023-07-07 02:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXB9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 02:49:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61362"}, "ts": "2023-07-07 02:50:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ACI0-1"}, "ts": "2023-07-07 02:50:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ACI0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:50:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:50:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZJ1.224.224"}, "ts": "2023-07-07 02:50:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZJ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:50:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:51:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16303"}, "ts": "2023-07-07 02:51:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G79365EN"}, "ts": "2023-07-07 02:51:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G79365EN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:51:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AD85-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:51:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AD85-1"}, "ts": "2023-07-07 02:51:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:51:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00536FZ"}, "ts": "2023-07-07 02:52:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00536FZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:52:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22681.601.601"}, "ts": "2023-07-07 02:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88188", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:52:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88188"}, "ts": "2023-07-07 02:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22681", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:52:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07214-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:52:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07214-1"}, "ts": "2023-07-07 02:52:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:52:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCC7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:52:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCC7"}, "ts": "2023-07-07 02:52:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50148.101.101"}, "ts": "2023-07-07 02:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50148", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00982QD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:52:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00982QD"}, "ts": "2023-07-07 02:53:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:53:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-07 02:53:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94437IW"}, "ts": "2023-07-07 02:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94761"}, "ts": "2023-07-07 02:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94761", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AE96-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:54:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AE96-1"}, "ts": "2023-07-07 02:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17693412", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:54:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17693412", "type": "PubMed"}, "ts": "2023-07-07 02:54:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z3E1.212.212"}, "ts": "2023-07-07 02:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3E1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J237", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:55:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J237"}, "ts": "2023-07-07 02:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:55:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70677"}, "ts": "2023-07-07 02:55:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70677", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQT6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:55:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14669"}, "ts": "2023-07-07 02:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14669", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:55:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQT6"}, "ts": "2023-07-07 02:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X05", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 02:56:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X05"}, "ts": "2023-07-07 02:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00887EN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:56:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00887EN"}, "ts": "2023-07-07 02:56:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31388144", "type": "PubMed"}, "ts": "2023-07-07 02:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31388144", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:56:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX12"}, "ts": "2023-07-07 02:57:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:57:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533"}, "ts": "2023-07-07 02:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75665", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:57:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75665.478.478"}, "ts": "2023-07-07 02:57:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10825435", "type": "PubMed"}, "ts": "2023-07-07 02:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10825435", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:57:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769"}, "ts": "2023-07-07 02:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18160VJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:57:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18160VJ"}, "ts": "2023-07-07 02:57:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 02:57:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:58:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-07 02:58:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:58:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-07 02:58:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04626-1"}, "ts": "2023-07-07 02:58:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04626-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:58:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:58:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZS7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 02:58:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QZS7.1115.1115"}, "ts": "2023-07-07 02:58:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20696164", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 02:59:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20696164", "type": "PubMed"}, "ts": "2023-07-07 02:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62925-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:59:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62925-1"}, "ts": "2023-07-07 02:59:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCT8-1"}, "ts": "2023-07-07 02:59:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCT8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:59:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 02:59:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19096"}, "ts": "2023-07-07 02:59:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 02:59:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 03:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 03:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 03:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 03:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 03:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 03:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25024"}, "ts": "2023-07-07 03:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25024", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:00:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61327-1"}, "ts": "2023-07-07 03:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61327-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16767080", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:00:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16767080", "type": "PubMed"}, "ts": "2023-07-07 03:00:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32296175", "type": "PubMed"}, "ts": "2023-07-07 03:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32296175", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:00:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15294", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:00:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15294.117.117"}, "ts": "2023-07-07 03:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12899", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:00:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12899.117.117"}, "ts": "2023-07-07 03:00:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHF0.43.43"}, "ts": "2023-07-07 03:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHF0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0S9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:01:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0S9"}, "ts": "2023-07-07 03:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZT4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:01:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZT4"}, "ts": "2023-07-07 03:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KNY5"}, "ts": "2023-07-07 03:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KNY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14110OQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:02:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14110OQ"}, "ts": "2023-07-07 03:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:02:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43761FR"}, "ts": "2023-07-07 03:03:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43761FR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:03:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49186-1"}, "ts": "2023-07-07 03:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49186-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:03:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R519-1"}, "ts": "2023-07-07 03:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R519-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:03:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24407421", "type": "PubMed"}, "ts": "2023-07-07 03:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24407421", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:03:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHN8-1"}, "ts": "2023-07-07 03:03:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHN8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WYP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:03:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WYP3"}, "ts": "2023-07-07 03:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15797711", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:04:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15797711", "type": "PubMed"}, "ts": "2023-07-07 03:04:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15765EV"}, "ts": "2023-07-07 03:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15765EV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FWT9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:04:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FWT9-1"}, "ts": "2023-07-07 03:04:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H013", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:04:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H013.454.454"}, "ts": "2023-07-07 03:04:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55769", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:05:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55769"}, "ts": "2023-07-07 03:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:05:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IWL2.214.214"}, "ts": "2023-07-07 03:05:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09871"}, "ts": "2023-07-07 03:05:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11120601", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:06:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11120601", "type": "PubMed"}, "ts": "2023-07-07 03:06:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1311279"}, "ts": "2023-07-07 03:06:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 03:06:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N6P7.80.80"}, "ts": "2023-07-07 03:06:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6P7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:06:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFH3"}, "ts": "2023-07-07 03:07:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFH3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04004-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:07:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04004-1"}, "ts": "2023-07-07 03:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:07:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5Q5.697.697"}, "ts": "2023-07-07 03:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Q5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:07:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10515-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:08:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10515-1"}, "ts": "2023-07-07 03:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESE1"}, "ts": "2023-07-07 03:08:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21845-1"}, "ts": "2023-07-07 03:08:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21845-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:08:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCE3.479.479"}, "ts": "2023-07-07 03:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCE3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:08:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M1L9-1"}, "ts": "2023-07-07 03:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M1L9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30729", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:09:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30729"}, "ts": "2023-07-07 03:09:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGE9.306.306"}, "ts": "2023-07-07 03:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGE9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95342", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:09:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95342.165.165"}, "ts": "2023-07-07 03:09:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M4N5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:09:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M4N5"}, "ts": "2023-07-07 03:09:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13901"}, "ts": "2023-07-07 03:10:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13901", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M1W4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:10:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M1W4-1"}, "ts": "2023-07-07 03:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBQ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:10:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBQ1-1"}, "ts": "2023-07-07 03:10:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-07 03:11:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25662902", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:11:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25662902", "type": "PubMed"}, "ts": "2023-07-07 03:11:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06400"}, "ts": "2023-07-07 03:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06400", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21802-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:11:40 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P21802-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 03:11:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX06", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:11:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX06"}, "ts": "2023-07-07 03:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G51591NI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:11:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G51591NI"}, "ts": "2023-07-07 03:11:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-07 03:12:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKB5"}, "ts": "2023-07-07 03:12:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:12:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10820KD"}, "ts": "2023-07-07 03:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10820KD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75757LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:12:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75757LG"}, "ts": "2023-07-07 03:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18374MW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:12:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18374MW"}, "ts": "2023-07-07 03:12:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27645.171.171"}, "ts": "2023-07-07 03:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27645", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:12:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "2898948"}, "ts": "2023-07-07 03:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:13:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68CZ1"}, "ts": "2023-07-07 03:13:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8317498", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:13:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8317498", "type": "PubMed"}, "ts": "2023-07-07 03:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G89941FZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:14:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G89941FZ"}, "ts": "2023-07-07 03:14:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55001"}, "ts": "2023-07-07 03:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2IBD1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:14:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2IBD1-1"}, "ts": "2023-07-07 03:14:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-07 03:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5TVM2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:14:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5TVM2"}, "ts": "2023-07-07 03:14:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33786605", "type": "PubMed"}, "ts": "2023-07-07 03:15:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33786605", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:15:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3YTS9"}, "ts": "2023-07-07 03:15:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YTS9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:15:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31006324", "type": "PubMed"}, "ts": "2023-07-07 03:15:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31006324", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31006324", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 03:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:15:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q91ZN7-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 03:15:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZN7-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:15:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33887099", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:16:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33887099", "type": "PubMed"}, "ts": "2023-07-07 03:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33887099", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 03:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00702NP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:16:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00702NP"}, "ts": "2023-07-07 03:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35604-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:16:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35604-1"}, "ts": "2023-07-07 03:16:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:16:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-07 03:17:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K198", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:17:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K198"}, "ts": "2023-07-07 03:17:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "J3QMD1-1"}, "ts": "2023-07-07 03:18:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "J3QMD1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:18:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVH1"}, "ts": "2023-07-07 03:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:18:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY40", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QY40"}, "ts": "2023-07-07 03:18:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12393632", "type": "PubMed"}, "ts": "2023-07-07 03:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12393632", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:18:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35221"}, "ts": "2023-07-07 03:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35221", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63041", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:19:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63041"}, "ts": "2023-07-07 03:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15520", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:19:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15520.51.51"}, "ts": "2023-07-07 03:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06187-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:20:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06187-1.551.551"}, "ts": "2023-07-07 03:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KLY3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:21:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KLY3-1"}, "ts": "2023-07-07 03:21:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:21:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01279"}, "ts": "2023-07-07 03:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25271165", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:21:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25271165", "type": "PubMed"}, "ts": "2023-07-07 03:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09871", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15349"}, "ts": "2023-07-07 03:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15349", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:21:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-07 03:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS00-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS00-1"}, "ts": "2023-07-07 03:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9169472", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:22:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9169472", "type": "PubMed"}, "ts": "2023-07-07 03:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:23:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35112.167.167"}, "ts": "2023-07-07 03:23:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q473-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:23:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Q473-1"}, "ts": "2023-07-07 03:23:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RCD3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:23:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RCD3-1"}, "ts": "2023-07-07 03:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QWV4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:24:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QWV4-1"}, "ts": "2023-07-07 03:24:12 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P28653-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 03:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:24:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:24:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-07 03:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16990797", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:24:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16990797", "type": "PubMed"}, "ts": "2023-07-07 03:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y345", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:24:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y345"}, "ts": "2023-07-07 03:24:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62424"}, "ts": "2023-07-07 03:25:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJH3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:25:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJH3"}, "ts": "2023-07-07 03:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DTL9"}, "ts": "2023-07-07 03:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DTL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZFA8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:27:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZFA8-1"}, "ts": "2023-07-07 03:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08582", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:27:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2EG98"}, "ts": "2023-07-07 03:27:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08582"}, "ts": "2023-07-07 03:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2EG98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:28:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:28:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02649"}, "ts": "2023-07-07 03:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:28:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:28:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01100"}, "ts": "2023-07-07 03:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18181", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:28:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18181.70.70"}, "ts": "2023-07-07 03:28:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:28:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16655"}, "ts": "2023-07-07 03:28:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L8C5.278.278"}, "ts": "2023-07-07 03:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L8C5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:29:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91904RU"}, "ts": "2023-07-07 03:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91904RU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:29:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08678"}, "ts": "2023-07-07 03:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08678", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULD9"}, "ts": "2023-07-07 03:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0YIR8-1"}, "ts": "2023-07-07 03:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0YIR8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:30:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53192FL"}, "ts": "2023-07-07 03:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53192FL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBU8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:30:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBU8-1"}, "ts": "2023-07-07 03:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05002AF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:31:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05002AF"}, "ts": "2023-07-07 03:31:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:31:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15153"}, "ts": "2023-07-07 03:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K8B9-1"}, "ts": "2023-07-07 03:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K8B9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:31:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4W6"}, "ts": "2023-07-07 03:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4W6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60765", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:33:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60765.484.484"}, "ts": "2023-07-07 03:33:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40933"}, "ts": "2023-07-07 03:34:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T890", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:34:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T890"}, "ts": "2023-07-07 03:34:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-07 03:34:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:34:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17681131", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:34:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17681131", "type": "PubMed"}, "ts": "2023-07-07 03:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:34:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2NL51-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:35:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2NL51-1"}, "ts": "2023-07-07 03:35:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32772918", "type": "PubMed"}, "ts": "2023-07-07 03:35:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32772918", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:35:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10720-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:35:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10720-1"}, "ts": "2023-07-07 03:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11859133", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:35:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11859133", "type": "PubMed"}, "ts": "2023-07-07 03:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03167", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:35:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03167.459.459"}, "ts": "2023-07-07 03:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11161"}, "ts": "2023-07-07 03:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:36:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17355969", "type": "PubMed"}, "ts": "2023-07-07 03:36:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17355969", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07359"}, "ts": "2023-07-07 03:36:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00519"}, "ts": "2023-07-07 03:36:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00519"}, "ts": "2023-07-07 03:36:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ74"}, "ts": "2023-07-07 03:36:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ74", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:36:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54757-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:36:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54757-1"}, "ts": "2023-07-07 03:36:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PDB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:36:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PDB4"}, "ts": "2023-07-07 03:36:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPN1"}, "ts": "2023-07-07 03:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:37:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13018"}, "ts": "2023-07-07 03:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:37:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4R8"}, "ts": "2023-07-07 03:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86357DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:38:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99872BC"}, "ts": "2023-07-07 03:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z553", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:39:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z553.251.251"}, "ts": "2023-07-07 03:39:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R629-1"}, "ts": "2023-07-07 03:39:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R629-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:39:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:40:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS56"}, "ts": "2023-07-07 03:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:40:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34741"}, "ts": "2023-07-07 03:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34741", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Z0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:40:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5Z0"}, "ts": "2023-07-07 03:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYE1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:40:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYE1"}, "ts": "2023-07-07 03:40:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C0T7"}, "ts": "2023-07-07 03:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C0T7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62424", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9603440", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:41:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9603440", "type": "PubMed"}, "ts": "2023-07-07 03:41:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26046517", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:41:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26046517", "type": "PubMed"}, "ts": "2023-07-07 03:41:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53602"}, "ts": "2023-07-07 03:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6M0"}, "ts": "2023-07-07 03:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6M0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18559VR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:41:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18559VR"}, "ts": "2023-07-07 03:41:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6GTS8.5.5"}, "ts": "2023-07-07 03:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6GTS8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:41:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01594", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:41:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01594"}, "ts": "2023-07-07 03:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28482-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:42:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28482-1"}, "ts": "2023-07-07 03:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:42:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15306"}, "ts": "2023-07-07 03:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AX52"}, "ts": "2023-07-07 03:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AX52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:42:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DG50-1"}, "ts": "2023-07-07 03:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DG50-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:42:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNI0-1"}, "ts": "2023-07-07 03:42:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNI0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:43:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14987PW"}, "ts": "2023-07-07 03:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14987PW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:43:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86T13"}, "ts": "2023-07-07 03:43:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T13", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:43:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09055-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:43:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09055-1"}, "ts": "2023-07-07 03:43:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHD0"}, "ts": "2023-07-07 03:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:43:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5K2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:43:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5K2.159.159"}, "ts": "2023-07-07 03:43:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TH1"}, "ts": "2023-07-07 03:43:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41594"}, "ts": "2023-07-07 03:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41594", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:44:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-07 03:44:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ES66-1"}, "ts": "2023-07-07 03:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ES66-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:44:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:44:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWT9"}, "ts": "2023-07-07 03:44:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q792Y9"}, "ts": "2023-07-07 03:44:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q792Y9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:44:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3MIW9"}, "ts": "2023-07-07 03:45:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MIW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14651-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHF1"}, "ts": "2023-07-07 03:45:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14651-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 03:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHF1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:45:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8198703", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:46:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8198703", "type": "PubMed"}, "ts": "2023-07-07 03:46:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16729043", "type": "PubMed"}, "ts": "2023-07-07 03:46:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K3B3-1"}, "ts": "2023-07-07 03:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K3B3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:46:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZNI0"}, "ts": "2023-07-07 03:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZNI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:46:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13530"}, "ts": "2023-07-07 03:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13530", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:47:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83161QT"}, "ts": "2023-07-07 03:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07006BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:48:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07006BT"}, "ts": "2023-07-07 03:48:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12519745", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:48:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12519745", "type": "PubMed"}, "ts": "2023-07-07 03:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G46387UV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:48:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46387UV"}, "ts": "2023-07-07 03:48:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10779507", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:48:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10779507", "type": "PubMed"}, "ts": "2023-07-07 03:48:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05784-1"}, "ts": "2023-07-07 03:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05784-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:48:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06312"}, "ts": "2023-07-07 03:49:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09958", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:49:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09958.314.314"}, "ts": "2023-07-07 03:49:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06312", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:49:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43157"}, "ts": "2023-07-07 03:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36406", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:49:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36406"}, "ts": "2023-07-07 03:49:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18687677", "type": "PubMed"}, "ts": "2023-07-07 03:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18687677", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:50:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JP2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:50:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JP2.766.766"}, "ts": "2023-07-07 03:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40933", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:50:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43820", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:50:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43820"}, "ts": "2023-07-07 03:50:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55867TY"}, "ts": "2023-07-07 03:50:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55867TY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:50:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:51:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:51:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43846XE"}, "ts": "2023-07-07 03:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43846XE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWM5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:51:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6UWM5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 03:51:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWA0"}, "ts": "2023-07-07 03:51:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXJ9"}, "ts": "2023-07-07 03:52:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7Q8-1"}, "ts": "2023-07-07 03:52:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7Q8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:52:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Y1.532.532"}, "ts": "2023-07-07 03:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13018", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UJB0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:53:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UJB0"}, "ts": "2023-07-07 03:53:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3SXD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:53:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3SXD1"}, "ts": "2023-07-07 03:53:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-07 03:53:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76N32"}, "ts": "2023-07-07 03:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:53:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76N32", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:53:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31864703", "type": "PubMed"}, "ts": "2023-07-07 03:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31864703", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:53:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:53:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36896"}, "ts": "2023-07-07 03:53:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36896", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:53:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Q0N0"}, "ts": "2023-07-07 03:54:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q0N0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:54:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-07 03:54:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04120EG"}, "ts": "2023-07-07 03:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04120EG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:54:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NVR5.461.461"}, "ts": "2023-07-07 03:54:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90101BB"}, "ts": "2023-07-07 03:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90101BB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VGT4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0VGT4"}, "ts": "2023-07-07 03:54:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6KAS7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:54:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6KAS7.1048.1048"}, "ts": "2023-07-07 03:54:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99KY4"}, "ts": "2023-07-07 03:55:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99KY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27555325", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:55:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27555325", "type": "PubMed"}, "ts": "2023-07-07 03:55:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27555325", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 03:55:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17456551", "type": "PubMed"}, "ts": "2023-07-07 03:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17456551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:55:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91WD0"}, "ts": "2023-07-07 03:55:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91WD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6J0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:56:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6J0-1"}, "ts": "2023-07-07 03:56:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:56:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z2W7.485.485"}, "ts": "2023-07-07 03:56:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47867", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:56:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47867"}, "ts": "2023-07-07 03:56:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5A9"}, "ts": "2023-07-07 03:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:57:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:57:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4B4"}, "ts": "2023-07-07 03:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4B4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:57:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53602", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:57:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29756996", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:57:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29756996", "type": "PubMed"}, "ts": "2023-07-07 03:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29756996", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 03:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:57:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6U2D6"}, "ts": "2023-07-07 03:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6U2D6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V7N0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:57:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V7N0-1"}, "ts": "2023-07-07 03:57:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10601278", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:57:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10601278", "type": "PubMed"}, "ts": "2023-07-07 03:57:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31345573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:58:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31345573", "type": "PubMed"}, "ts": "2023-07-07 03:58:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98030BR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:58:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98030BR"}, "ts": "2023-07-07 03:58:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:58:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-07 03:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60706", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 03:58:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60706"}, "ts": "2023-07-07 03:58:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N608", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:58:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N608"}, "ts": "2023-07-07 03:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55258", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:59:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55258.185.185"}, "ts": "2023-07-07 03:59:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P16112-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 03:59:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16112-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:59:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35442"}, "ts": "2023-07-07 03:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03137", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:59:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03137.408.408"}, "ts": "2023-07-07 03:59:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12531530", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 03:59:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12531530", "type": "PubMed"}, "ts": "2023-07-07 03:59:14 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q61827", "cluster_type": "unselected"}, "ts": "2023-07-07 03:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61827", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 03:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61827", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 03:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75509", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 03:59:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75509.495.495"}, "ts": "2023-07-07 03:59:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6M3"}, "ts": "2023-07-07 03:59:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6M3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:59:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 03:59:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:59:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-07 03:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62182OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 03:59:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49750"}, "ts": "2023-07-07 03:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 04:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 04:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 04:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 04:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 04:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 04:00:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-07 04:00:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-07 04:00:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64017CW"}, "ts": "2023-07-07 04:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23510", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:01:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23510"}, "ts": "2023-07-07 04:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R601-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:01:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R601-1"}, "ts": "2023-07-07 04:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99490", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99490"}, "ts": "2023-07-07 04:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00PI9"}, "ts": "2023-07-07 04:01:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00PI9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5MYX0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5MYX0"}, "ts": "2023-07-07 04:02:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61171.11.11"}, "ts": "2023-07-07 04:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61171", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:02:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96BY7", "cluster_type": "unselected"}, "ts": "2023-07-07 04:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BY7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 04:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BY7", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 04:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33939927", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:02:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33939927", "type": "PubMed"}, "ts": "2023-07-07 04:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5L3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:03:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5L3"}, "ts": "2023-07-07 04:03:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83161QT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:03:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00045MO"}, "ts": "2023-07-07 04:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00045MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01729-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:04:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01729-1"}, "ts": "2023-07-07 04:04:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12931"}, "ts": "2023-07-07 04:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12931", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:04:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00731-1"}, "ts": "2023-07-07 04:04:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00731-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:04:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63208", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:04:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63208"}, "ts": "2023-07-07 04:04:50 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UMQ3", "cluster_type": "unselected"}, "ts": "2023-07-07 04:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMQ3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 04:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMQ3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 04:04:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63787FE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:05:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63787FE"}, "ts": "2023-07-07 04:05:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0JN28-1"}, "ts": "2023-07-07 04:06:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0JN28-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:06:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9Q0"}, "ts": "2023-07-07 04:06:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9Q0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:06:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98739YW"}, "ts": "2023-07-07 04:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98739YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:06:38 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 04:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 04:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 04:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810B6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:07:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q810B6"}, "ts": "2023-07-07 04:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00175", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:07:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00175"}, "ts": "2023-07-07 04:07:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88967"}, "ts": "2023-07-07 04:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88967", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48775", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:08:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48775"}, "ts": "2023-07-07 04:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFH8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:08:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFH8-1"}, "ts": "2023-07-07 04:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MG84-1"}, "ts": "2023-07-07 04:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MG84-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:08:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49744-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:08:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49744-1"}, "ts": "2023-07-07 04:08:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33611-1"}, "ts": "2023-07-07 04:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33611-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CYI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:08:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CYI4"}, "ts": "2023-07-07 04:08:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-07 04:08:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:08:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78509"}, "ts": "2023-07-07 04:08:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23260140", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:08:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23260140", "type": "PubMed"}, "ts": "2023-07-07 04:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BV94"}, "ts": "2023-07-07 04:08:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BV94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:09:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NUQ8.155.155"}, "ts": "2023-07-07 04:09:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:09:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12642668", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:09:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12642668", "type": "PubMed"}, "ts": "2023-07-07 04:09:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19352412", "type": "PubMed"}, "ts": "2023-07-07 04:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19352412", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:10:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17435174", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:10:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17435174", "type": "PubMed"}, "ts": "2023-07-07 04:10:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70419", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:10:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70419"}, "ts": "2023-07-07 04:10:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNB5-1"}, "ts": "2023-07-07 04:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RSG7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:10:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RSG7-1"}, "ts": "2023-07-07 04:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNB5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:10:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-07 04:10:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11880646", "type": "PubMed"}, "ts": "2023-07-07 04:10:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH53"}, "ts": "2023-07-07 04:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:11:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX7-1"}, "ts": "2023-07-07 04:11:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:11:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K182"}, "ts": "2023-07-07 04:11:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K182", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:11:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16204-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16204-1"}, "ts": "2023-07-07 04:11:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P22079", "cluster_type": "unselected"}, "ts": "2023-07-07 04:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22079", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 04:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22079", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 04:11:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T5N4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:12:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T5N4"}, "ts": "2023-07-07 04:12:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V9G5-1"}, "ts": "2023-07-07 04:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V9G5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:12:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q68CZ2.748.748"}, "ts": "2023-07-07 04:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68CZ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:12:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22531"}, "ts": "2023-07-07 04:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22288-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:12:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22288-1"}, "ts": "2023-07-07 04:12:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P273"}, "ts": "2023-07-07 04:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P273", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:12:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9500680"}, "ts": "2023-07-07 04:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 04:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2KB60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:12:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2KB60"}, "ts": "2023-07-07 04:12:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54826"}, "ts": "2023-07-07 04:13:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54826", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:13:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42719PT"}, "ts": "2023-07-07 04:13:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42719PT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:13:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88809"}, "ts": "2023-07-07 04:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88809", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:14:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72587UU"}, "ts": "2023-07-07 04:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72587UU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26375259", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:14:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26375259", "type": "PubMed"}, "ts": "2023-07-07 04:14:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75882.331.331"}, "ts": "2023-07-07 04:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75882", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:14:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VC0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:14:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VC0"}, "ts": "2023-07-07 04:14:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-07 04:14:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41138-1"}, "ts": "2023-07-07 04:15:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41138-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:15:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35442", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:15:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37239FO"}, "ts": "2023-07-07 04:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37239FO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:16:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:16:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:16:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.447.447"}, "ts": "2023-07-07 04:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:16:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14766.908.908"}, "ts": "2023-07-07 04:16:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N7H5"}, "ts": "2023-07-07 04:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N7H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-07 04:16:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEP3"}, "ts": "2023-07-07 04:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00740-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:17:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00740-1"}, "ts": "2023-07-07 04:17:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40926"}, "ts": "2023-07-07 04:17:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40926", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:17:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R935-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:17:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R935-1"}, "ts": "2023-07-07 04:17:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V8M6-1"}, "ts": "2023-07-07 04:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V8M6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:17:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28481.308.308"}, "ts": "2023-07-07 04:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:17:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15509", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:18:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15509"}, "ts": "2023-07-07 04:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:18:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5C1"}, "ts": "2023-07-07 04:18:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WY64"}, "ts": "2023-07-07 04:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WY64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40121"}, "ts": "2023-07-07 04:19:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1581307", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:19:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1581307", "type": "PubMed"}, "ts": "2023-07-07 04:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6I8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:20:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6I8"}, "ts": "2023-07-07 04:20:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P62869.84.84"}, "ts": "2023-07-07 04:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62869", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6RVG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:20:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6RVG2"}, "ts": "2023-07-07 04:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31004701", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:20:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31004701", "type": "PubMed"}, "ts": "2023-07-07 04:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:21:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16650"}, "ts": "2023-07-07 04:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A1B8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:21:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8VE96.366.366"}, "ts": "2023-07-07 04:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A1B8-1"}, "ts": "2023-07-07 04:21:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VE96", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:21:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92945"}, "ts": "2023-07-07 04:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11940666", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:22:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11940666", "type": "PubMed"}, "ts": "2023-07-07 04:22:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60881"}, "ts": "2023-07-07 04:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60881", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:22:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27658AJ"}, "ts": "2023-07-07 04:22:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27658AJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09538AR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:22:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09538AR"}, "ts": "2023-07-07 04:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WW32"}, "ts": "2023-07-07 04:23:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WW32", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:23:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55070-1"}, "ts": "2023-07-07 04:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5J4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:23:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-07 04:23:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5J4.111.111"}, "ts": "2023-07-07 04:24:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:24:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:24:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-07 04:24:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857"}, "ts": "2023-07-07 04:24:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0D2"}, "ts": "2023-07-07 04:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:24:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P30511.96.96"}, "ts": "2023-07-07 04:24:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30511", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:24:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4J7-1"}, "ts": "2023-07-07 04:24:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4J7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10921882", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:25:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10921882", "type": "PubMed"}, "ts": "2023-07-07 04:25:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6X4"}, "ts": "2023-07-07 04:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6X4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:25:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4R8"}, "ts": "2023-07-07 04:25:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40145"}, "ts": "2023-07-07 04:25:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40145", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:26:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9694964", "type": "PubMed"}, "ts": "2023-07-07 04:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9694964", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:26:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13315"}, "ts": "2023-07-07 04:26:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3A1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:26:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3A1"}, "ts": "2023-07-07 04:26:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3A1", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 04:26:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20610818", "type": "PubMed"}, "ts": "2023-07-07 04:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20610818", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:26:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZGG1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:26:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZGG1"}, "ts": "2023-07-07 04:26:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43405"}, "ts": "2023-07-07 04:27:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:27:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04114CX"}, "ts": "2023-07-07 04:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04114CX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:27:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-07 04:27:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-07 04:28:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQX3"}, "ts": "2023-07-07 04:28:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:28:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02413.498.498"}, "ts": "2023-07-07 04:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02413", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:28:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3T6"}, "ts": "2023-07-07 04:28:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3T6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12729736", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:28:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12729736", "type": "PubMed"}, "ts": "2023-07-07 04:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81239UY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:29:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81239UY"}, "ts": "2023-07-07 04:29:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWT3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:30:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BWT3.498.498"}, "ts": "2023-07-07 04:30:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V9N0"}, "ts": "2023-07-07 04:30:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V9N0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:30:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:30:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IW19"}, "ts": "2023-07-07 04:30:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98106", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:30:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98106"}, "ts": "2023-07-07 04:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35580-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:30:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35580-1"}, "ts": "2023-07-07 04:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13530", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:31:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13530"}, "ts": "2023-07-07 04:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00048MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:31:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00048MO"}, "ts": "2023-07-07 04:31:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23515.7.7"}, "ts": "2023-07-07 04:31:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23515", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:31:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50850NI"}, "ts": "2023-07-07 04:32:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01583", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75096", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:33:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75096.1086.1086"}, "ts": "2023-07-07 04:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFW9"}, "ts": "2023-07-07 04:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:33:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570"}, "ts": "2023-07-07 04:34:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6U7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:34:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6U7.347.347"}, "ts": "2023-07-07 04:34:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29322"}, "ts": "2023-07-07 04:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22033", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:35:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22033"}, "ts": "2023-07-07 04:35:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29322"}, "ts": "2023-07-07 04:35:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54727-1"}, "ts": "2023-07-07 04:35:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54727-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:35:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8K7"}, "ts": "2023-07-07 04:35:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8K7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:35:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEW8"}, "ts": "2023-07-07 04:35:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42166"}, "ts": "2023-07-07 04:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42166", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:35:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63776KU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:35:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63776KU"}, "ts": "2023-07-07 04:35:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06131JN"}, "ts": "2023-07-07 04:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06131JN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-07 04:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:36:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88792"}, "ts": "2023-07-07 04:36:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PDI5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:36:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PDI5.1165.1165"}, "ts": "2023-07-07 04:36:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WU20.365.365"}, "ts": "2023-07-07 04:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WU20", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-07 04:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30176151", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:37:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30176151", "type": "PubMed"}, "ts": "2023-07-07 04:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K4R8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K4R8"}, "ts": "2023-07-07 04:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:37:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937"}, "ts": "2023-07-07 04:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4L0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:37:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4L0"}, "ts": "2023-07-07 04:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3H5"}, "ts": "2023-07-07 04:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3H5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:37:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3H5"}, "ts": "2023-07-07 04:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5X3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:38:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5X3"}, "ts": "2023-07-07 04:38:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63871ZT"}, "ts": "2023-07-07 04:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63871ZT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08069"}, "ts": "2023-07-07 04:38:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9490702", "type": "PubMed"}, "ts": "2023-07-07 04:38:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9490702", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:38:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1379666", "type": "PubMed"}, "ts": "2023-07-07 04:39:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1379666", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:39:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A7TZF0"}, "ts": "2023-07-07 04:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A7TZF0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:39:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26842564", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:39:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26842564", "type": "PubMed"}, "ts": "2023-07-07 04:39:40 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 04:39:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 04:39:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 04:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 04:39:57 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 04:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 04:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q67ET1-1"}, "ts": "2023-07-07 04:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q67ET1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:40:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9E7-1"}, "ts": "2023-07-07 04:40:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9E7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:40:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14625.62.62"}, "ts": "2023-07-07 04:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14625", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:40:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67036DM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:40:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67036DM"}, "ts": "2023-07-07 04:40:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18583"}, "ts": "2023-07-07 04:40:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18583", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92804", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:40:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92804.231.231"}, "ts": "2023-07-07 04:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:40:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00420UH"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02886BB"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03382KH"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05642HQ"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09197ZW"}, "ts": "2023-07-07 04:40:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09528DL"}, "ts": "2023-07-07 04:40:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-07 04:40:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10339FR"}, "ts": "2023-07-07 04:40:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-07 04:40:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-07 04:40:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11254FL"}, "ts": "2023-07-07 04:40:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01650EU"}, "ts": "2023-07-07 04:40:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23453IV"}, "ts": "2023-07-07 04:40:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-07 04:40:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02815KT"}, "ts": "2023-07-07 04:40:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-07 04:40:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41247ZX"}, "ts": "2023-07-07 04:40:54 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "integrin alpha v", "term_category": "any"}, "ts": "2023-07-07 04:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 04:41:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-07 04:41:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-07 04:41:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25637MV"}, "ts": "2023-07-07 04:41:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-07 04:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1Y3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:41:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Z1Y3.692.692"}, "ts": "2023-07-07 04:41:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q9D5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:41:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q9D5"}, "ts": "2023-07-07 04:41:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LXV3-1"}, "ts": "2023-07-07 04:41:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LXV3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">77ad206ea22bd411769eb9dad65b261b", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"integrin alpha v\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 04:41:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-07 04:41:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09619"}, "ts": "2023-07-07 04:41:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "77ad206ea22bd411769eb9dad65b261b", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "77ad206ea22bd411769eb9dad65b261b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q501J6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09619", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94854LT"}, "ts": "2023-07-07 04:41:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q501J6"}, "ts": "2023-07-07 04:41:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y698"}, "ts": "2023-07-07 04:41:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y698", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:41:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41968"}, "ts": "2023-07-07 04:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13315", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAR8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:42:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAR8-1"}, "ts": "2023-07-07 04:42:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21484435", "type": "PubMed"}, "ts": "2023-07-07 04:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21484435", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21484435", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 04:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15632147", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:42:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15632147", "type": "PubMed"}, "ts": "2023-07-07 04:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05030-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:42:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05030-1"}, "ts": "2023-07-07 04:42:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N1G0"}, "ts": "2023-07-07 04:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N1G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63118-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:43:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63118-1"}, "ts": "2023-07-07 04:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45120SG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:43:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45120SG"}, "ts": "2023-07-07 04:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28310", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:43:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28310"}, "ts": "2023-07-07 04:43:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84489FR"}, "ts": "2023-07-07 04:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84489FR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26403SG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:43:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26403SG"}, "ts": "2023-07-07 04:43:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHW0"}, "ts": "2023-07-07 04:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:43:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N423"}, "ts": "2023-07-07 04:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N423", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:43:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29059378", "type": "PubMed"}, "ts": "2023-07-07 04:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29059378", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLB4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:44:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JLB4.2085.2085"}, "ts": "2023-07-07 04:44:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:44:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02563"}, "ts": "2023-07-07 04:44:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01108"}, "ts": "2023-07-07 04:44:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:44:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01614ZM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:44:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18614015", "type": "PubMed"}, "ts": "2023-07-07 04:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18614015", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXN2"}, "ts": "2023-07-07 04:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60412"}, "ts": "2023-07-07 04:44:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60412", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:44:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKU9"}, "ts": "2023-07-07 04:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:44:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NCM1"}, "ts": "2023-07-07 04:45:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NCM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:45:07 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9R117-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 04:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56385"}, "ts": "2023-07-07 04:46:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11891802", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R117-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 04:46:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11891802", "type": "PubMed"}, "ts": "2023-07-07 04:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56385", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:46:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80XN0"}, "ts": "2023-07-07 04:46:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50402"}, "ts": "2023-07-07 04:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50402", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80XN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:46:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91Y03-1"}, "ts": "2023-07-07 04:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91Y03-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N271", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:46:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N271"}, "ts": "2023-07-07 04:46:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9R0T8.172.172"}, "ts": "2023-07-07 04:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0T8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:46:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-07 04:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:46:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q0B5-1"}, "ts": "2023-07-07 04:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q0B5-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:47:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IV38"}, "ts": "2023-07-07 04:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV38", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:47:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29066024", "type": "PubMed"}, "ts": "2023-07-07 04:47:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29066024", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:47:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01954BU"}, "ts": "2023-07-07 04:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01954BU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:47:57 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P55344", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 04:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55344", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 04:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:48:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R2P8"}, "ts": "2023-07-07 04:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50850NI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:48:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:48:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHV7"}, "ts": "2023-07-07 04:48:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15812"}, "ts": "2023-07-07 04:49:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:50:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81315DD"}, "ts": "2023-07-07 04:50:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16204.92.92"}, "ts": "2023-07-07 04:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16204", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:50:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TPX4"}, "ts": "2023-07-07 04:50:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TPX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:50:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 04:50:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29322", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:50:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 04:51:04 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 04:51:04 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "77ad206ea22bd411769eb9dad65b261b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 04:51:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "77ad206ea22bd411769eb9dad65b261b", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Search modification initiated"}, "ts": "2023-07-07 04:51:05 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "itgav", "term_category": "any"}, "ts": "2023-07-07 04:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "77ad206ea22bd411769eb9dad65b261b", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 04:51:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "77ad206ea22bd411769eb9dad65b261b>d7708fc43d458ff542dd11159da74ec5", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"itgav\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 04:51:11 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 04:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "d7708fc43d458ff542dd11159da74ec5", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 04:51:12 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "d7708fc43d458ff542dd11159da74ec5", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 04:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10361"}, "ts": "2023-07-07 04:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7681434", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:51:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7681434", "type": "PubMed"}, "ts": "2023-07-07 04:51:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R752-1"}, "ts": "2023-07-07 04:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R752-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:51:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756-1"}, "ts": "2023-07-07 04:51:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03574QJ"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12313PD"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23984SE"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33609NS"}, "ts": "2023-07-07 04:51:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66621EA"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72735IY"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82119TF"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83229XP"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84820NF"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92062TF"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25079LO"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46524LG"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80920RR"}, "ts": "2023-07-07 04:51:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32948671", "type": "PubMed"}, "ts": "2023-07-07 04:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32948671", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32948671", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 04:51:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5VV63.486.486"}, "ts": "2023-07-07 04:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:52:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51688"}, "ts": "2023-07-07 04:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:52:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00168.79.79"}, "ts": "2023-07-07 04:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00168", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16572-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:53:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16572-1"}, "ts": "2023-07-07 04:53:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03987", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:53:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P03987.179.179"}, "ts": "2023-07-07 04:53:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15465"}, "ts": "2023-07-07 04:53:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 04:53:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14142", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 04:53:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14142", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 04:53:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99997WS"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99992LL"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99981ST"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99980WG"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99969SS"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954ZJ"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99956MJ"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99954GW"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99952ON"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99950SF"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99943EE"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99935CU"}, "ts": "2023-07-07 04:53:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99927HL"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99897FQ"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99896CG"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99891PR"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99883ZA"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99873PN"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99876AH"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99866WK"}, "ts": "2023-07-07 04:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVB4"}, "ts": "2023-07-07 04:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:54:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15287948", "type": "PubMed"}, "ts": "2023-07-07 04:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15287948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:54:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32744506", "type": "PubMed"}, "ts": "2023-07-07 04:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08069", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32744506", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 04:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:54:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-07 04:54:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZND9-1"}, "ts": "2023-07-07 04:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZND9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08727", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:55:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08727"}, "ts": "2023-07-07 04:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32986TN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:55:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32986TN"}, "ts": "2023-07-07 04:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95777"}, "ts": "2023-07-07 04:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95777", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:55:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZT4-1"}, "ts": "2023-07-07 04:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZT4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:56:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4G3-1"}, "ts": "2023-07-07 04:56:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4G3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:56:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZL1"}, "ts": "2023-07-07 04:56:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NAN2"}, "ts": "2023-07-07 04:57:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:57:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-07 04:57:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25637MV"}, "ts": "2023-07-07 04:57:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993"}, "ts": "2023-07-07 04:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:57:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75899.668.668"}, "ts": "2023-07-07 04:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75899", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 04:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0ZFS4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:57:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0ZFS4"}, "ts": "2023-07-07 04:57:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RA79-1"}, "ts": "2023-07-07 04:57:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RA79-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:57:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20618-1"}, "ts": "2023-07-07 04:57:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20618-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:57:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06131VP"}, "ts": "2023-07-07 04:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06131VP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VG96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VG96"}, "ts": "2023-07-07 04:57:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-07 04:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02496"}, "ts": "2023-07-07 04:58:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02496", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18650BV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 04:58:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18650BV"}, "ts": "2023-07-07 04:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D823", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 04:59:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D823"}, "ts": "2023-07-07 04:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96IY4"}, "ts": "2023-07-07 04:59:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96IY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 04:59:56 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 05:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 05:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 05:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 05:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 05:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 05:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43173.113.113"}, "ts": "2023-07-07 05:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43173", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:01:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06795XH"}, "ts": "2023-07-07 05:01:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06795XH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68FQ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:01:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68FQ7-1"}, "ts": "2023-07-07 05:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:01:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBS4-1"}, "ts": "2023-07-07 05:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBS4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:01:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQ60"}, "ts": "2023-07-07 05:02:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:02:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23415232", "type": "PubMed"}, "ts": "2023-07-07 05:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23415232", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:02:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZC3"}, "ts": "2023-07-07 05:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:02:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CG8"}, "ts": "2023-07-07 05:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16176980", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:02:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16176980", "type": "PubMed"}, "ts": "2023-07-07 05:02:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18541534", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:02:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18541534", "type": "PubMed"}, "ts": "2023-07-07 05:02:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 05:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16858409", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:03:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16858409", "type": "PubMed"}, "ts": "2023-07-07 05:03:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-07 05:04:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08722"}, "ts": "2023-07-07 05:04:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:04:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EPU5.141.141"}, "ts": "2023-07-07 05:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61937QU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:04:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61937QU"}, "ts": "2023-07-07 05:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81315DD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:05:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A809-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJ47-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:06:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJ47-1"}, "ts": "2023-07-07 05:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:06:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBJ4"}, "ts": "2023-07-07 05:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93579XB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:06:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93579XB"}, "ts": "2023-07-07 05:06:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34822AT"}, "ts": "2023-07-07 05:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34822AT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49023", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:06:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49023.31.31"}, "ts": "2023-07-07 05:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:06:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:06:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ95"}, "ts": "2023-07-07 05:06:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14707133", "type": "PubMed"}, "ts": "2023-07-07 05:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14707133", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10361", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:07:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8CG47-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG47-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:07:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LXD8-1"}, "ts": "2023-07-07 05:07:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LXD8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:07:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-07 05:07:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P67809.178.178"}, "ts": "2023-07-07 05:08:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P67809", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:08:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92889-1"}, "ts": "2023-07-07 05:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92889-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05154-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:08:36 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P05154-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70367-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70367-1"}, "ts": "2023-07-07 05:09:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15465", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12109.212.212"}, "ts": "2023-07-07 05:09:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12109", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:09:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZJ3"}, "ts": "2023-07-07 05:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20700-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20700-1"}, "ts": "2023-07-07 05:09:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHL4"}, "ts": "2023-07-07 05:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88576"}, "ts": "2023-07-07 05:09:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88576", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:09:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9671468", "type": "PubMed"}, "ts": "2023-07-07 05:09:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BMS2"}, "ts": "2023-07-07 05:09:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BMS2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:09:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9671468", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:09:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB03-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:10:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB03-1"}, "ts": "2023-07-07 05:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57738", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:10:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57738"}, "ts": "2023-07-07 05:10:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYS2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYS2"}, "ts": "2023-07-07 05:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EY8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:12:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96EY8.134.134"}, "ts": "2023-07-07 05:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98720VL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:12:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98720VL"}, "ts": "2023-07-07 05:12:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q62956", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62956", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R536-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:12:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R536-1"}, "ts": "2023-07-07 05:12:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBW0"}, "ts": "2023-07-07 05:12:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08905", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:12:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08905"}, "ts": "2023-07-07 05:12:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7506095", "type": "PubMed"}, "ts": "2023-07-07 05:13:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7506095", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWJ2"}, "ts": "2023-07-07 05:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:14:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RDM7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:15:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RDM7-1"}, "ts": "2023-07-07 05:15:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76K27-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:15:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76K27-1"}, "ts": "2023-07-07 05:15:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63118"}, "ts": "2023-07-07 05:15:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56001PU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:15:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56001PU"}, "ts": "2023-07-07 05:15:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:15:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-07 05:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56524-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:17:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56524-1"}, "ts": "2023-07-07 05:17:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-07 05:17:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y478-1"}, "ts": "2023-07-07 05:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y478-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:18:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12110"}, "ts": "2023-07-07 05:18:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12110", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:18:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49368", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:18:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P49368", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NE31"}, "ts": "2023-07-07 05:19:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NE31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:19:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG31"}, "ts": "2023-07-07 05:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14088", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:19:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14088.145.145"}, "ts": "2023-07-07 05:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32305", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:19:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P32305", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08722", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:20:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-07 05:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12966036", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:20:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12966036", "type": "PubMed"}, "ts": "2023-07-07 05:20:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00435KX"}, "ts": "2023-07-07 05:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00435KX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08174", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:21:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08174.711.711"}, "ts": "2023-07-07 05:21:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L576", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:21:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7L576.672.672"}, "ts": "2023-07-07 05:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06481", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:21:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q06481", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:21:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QY96.594.594"}, "ts": "2023-07-07 05:21:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY96", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:21:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68431"}, "ts": "2023-07-07 05:21:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H497.61.61"}, "ts": "2023-07-07 05:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:22:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75112.375.375"}, "ts": "2023-07-07 05:22:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI58", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:22:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:22:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LI58"}, "ts": "2023-07-07 05:22:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02452-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:22:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02452-1"}, "ts": "2023-07-07 05:22:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BSJ6.144.144"}, "ts": "2023-07-07 05:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSJ6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:23:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BY67.101.101"}, "ts": "2023-07-07 05:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY67", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:23:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01729-1"}, "ts": "2023-07-07 05:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01729-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89090", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:23:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O89090"}, "ts": "2023-07-07 05:23:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZFE9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:24:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P91"}, "ts": "2023-07-07 05:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLY9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLY9-1"}, "ts": "2023-07-07 05:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V8M6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:24:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V8M6-1"}, "ts": "2023-07-07 05:24:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JZC3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:25:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JZC3-1"}, "ts": "2023-07-07 05:25:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34004386", "type": "PubMed"}, "ts": "2023-07-07 05:25:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34004386", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:25:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A096MKE9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:25:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A096MKE9"}, "ts": "2023-07-07 05:25:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75757LG"}, "ts": "2023-07-07 05:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75757LG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:25:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX12", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:25:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IX12.806.806"}, "ts": "2023-07-07 05:25:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32766"}, "ts": "2023-07-07 05:25:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:25:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97769"}, "ts": "2023-07-07 05:25:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q641X3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:25:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q641X3"}, "ts": "2023-07-07 05:25:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23229.822.822"}, "ts": "2023-07-07 05:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23229", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:25:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEU8"}, "ts": "2023-07-07 05:26:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22711"}, "ts": "2023-07-07 05:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEU8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:26:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGW6-1"}, "ts": "2023-07-07 05:26:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGW6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:26:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94888"}, "ts": "2023-07-07 05:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94888", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:26:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWQ8.99.99"}, "ts": "2023-07-07 05:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:26:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R452-1"}, "ts": "2023-07-07 05:27:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R452-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:27:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25944903", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:27:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25944903", "type": "PubMed"}, "ts": "2023-07-07 05:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25944903", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 05:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60543", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:28:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60543"}, "ts": "2023-07-07 05:28:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2D1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:28:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2D1"}, "ts": "2023-07-07 05:28:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BVW3"}, "ts": "2023-07-07 05:28:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:28:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75054", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:29:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75054.700.700"}, "ts": "2023-07-07 05:29:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6R7.1830.1830"}, "ts": "2023-07-07 05:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:29:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-07 05:29:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23458", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:29:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23458"}, "ts": "2023-07-07 05:29:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52747", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:29:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52747.208.208"}, "ts": "2023-07-07 05:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:29:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13451"}, "ts": "2023-07-07 05:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:30:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56817", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:30:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56817"}, "ts": "2023-07-07 05:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N370", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:30:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N370.278.278"}, "ts": "2023-07-07 05:30:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02799CL"}, "ts": "2023-07-07 05:31:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02799CL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:31:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06187", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:31:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06187"}, "ts": "2023-07-07 05:31:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08699-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:31:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08699-1"}, "ts": "2023-07-07 05:31:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92954-1.892.892"}, "ts": "2023-07-07 05:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:32:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12793SR"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38663NM"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51413EV"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59626AS"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75850OP"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56284ZY"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05933EN"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91365ZQ"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-07 05:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08110WX"}, "ts": "2023-07-07 05:32:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZS1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:32:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZS1"}, "ts": "2023-07-07 05:32:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08575.1001.1001"}, "ts": "2023-07-07 05:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:33:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56749GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:33:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:33:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23771"}, "ts": "2023-07-07 05:33:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 05:34:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00961"}, "ts": "2023-07-07 05:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43432", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:34:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43432.211.211"}, "ts": "2023-07-07 05:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1R4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:34:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T1R4.1792.1792"}, "ts": "2023-07-07 05:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DN90", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:35:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DN90"}, "ts": "2023-07-07 05:35:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64257ZG"}, "ts": "2023-07-07 05:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70627-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:35:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70627-1"}, "ts": "2023-07-07 05:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0P651", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:36:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0P651"}, "ts": "2023-07-07 05:36:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y566"}, "ts": "2023-07-07 05:36:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:36:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13284", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:36:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13284"}, "ts": "2023-07-07 05:36:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TZA2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:36:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5TZA2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSJ2"}, "ts": "2023-07-07 05:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:36:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60469"}, "ts": "2023-07-07 05:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60469", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:36:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83917"}, "ts": "2023-07-07 05:36:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95430GC"}, "ts": "2023-07-07 05:36:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZE95-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:36:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZE95-1"}, "ts": "2023-07-07 05:36:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K468-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:36:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K468-1"}, "ts": "2023-07-07 05:36:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z8R3-1"}, "ts": "2023-07-07 05:36:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z8R3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10978537", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:37:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10978537", "type": "PubMed"}, "ts": "2023-07-07 05:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:37:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41968"}, "ts": "2023-07-07 05:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03277YI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:37:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03277YI"}, "ts": "2023-07-07 05:37:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R4S0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:37:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R4S0"}, "ts": "2023-07-07 05:37:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DFV5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:37:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DFV5-1"}, "ts": "2023-07-07 05:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62924-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62924-1"}, "ts": "2023-07-07 05:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S52", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:37:43 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96S52", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:37:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08265CU"}, "ts": "2023-07-07 05:37:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08265CU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:37:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60932", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:38:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60932.206.206"}, "ts": "2023-07-07 05:38:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99307NJ"}, "ts": "2023-07-07 05:38:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12086GM"}, "ts": "2023-07-07 05:38:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12086GM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:38:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93500PH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:38:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93500PH"}, "ts": "2023-07-07 05:38:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78902VT"}, "ts": "2023-07-07 05:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G78902VT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:38:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HAU0.576.576"}, "ts": "2023-07-07 05:39:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAU0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:39:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06251VI"}, "ts": "2023-07-07 05:39:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06251VI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:39:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:39:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-07 05:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1V4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:39:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1V4"}, "ts": "2023-07-07 05:39:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93008"}, "ts": "2023-07-07 05:40:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15169", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:40:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15169"}, "ts": "2023-07-07 05:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBK8-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:40:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBK8-2"}, "ts": "2023-07-07 05:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31967937", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:40:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31967937", "type": "PubMed"}, "ts": "2023-07-07 05:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83555HU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:40:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83555HU"}, "ts": "2023-07-07 05:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:40:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75925"}, "ts": "2023-07-07 05:41:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75925", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94916"}, "ts": "2023-07-07 05:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94916", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5GH56-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60701", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60701"}, "ts": "2023-07-07 05:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5GH56-1"}, "ts": "2023-07-07 05:41:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYZ6"}, "ts": "2023-07-07 05:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13637"}, "ts": "2023-07-07 05:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:41:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56726"}, "ts": "2023-07-07 05:41:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D687.182.182"}, "ts": "2023-07-07 05:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D687", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07246CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:41:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07246CJ"}, "ts": "2023-07-07 05:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZK5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:42:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZK5.127.127"}, "ts": "2023-07-07 05:42:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22742857", "type": "PubMed"}, "ts": "2023-07-07 05:42:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22742857", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:42:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59594"}, "ts": "2023-07-07 05:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59594", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:43:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653-1"}, "ts": "2023-07-07 05:44:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24488861", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:44:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24488861", "type": "PubMed"}, "ts": "2023-07-07 05:44:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9P5-1"}, "ts": "2023-07-07 05:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9P5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:45:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K240-1"}, "ts": "2023-07-07 05:45:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K240-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:45:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-07 05:46:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76070"}, "ts": "2023-07-07 05:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:46:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S94"}, "ts": "2023-07-07 05:46:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18846110", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:46:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18846110", "type": "PubMed"}, "ts": "2023-07-07 05:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3I7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:46:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3I7"}, "ts": "2023-07-07 05:46:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-07 05:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:47:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-07 05:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:47:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00462"}, "ts": "2023-07-07 05:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00462", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:48:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXS0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:48:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXS0"}, "ts": "2023-07-07 05:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O19441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:48:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O19441"}, "ts": "2023-07-07 05:48:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R5V4-1"}, "ts": "2023-07-07 05:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R5V4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:48:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19622", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19622"}, "ts": "2023-07-07 05:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15360-1"}, "ts": "2023-07-07 05:48:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15360-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:48:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89098", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:48:39 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O89098", "cluster_type": "unselected"}, "ts": "2023-07-07 05:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89098", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 05:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A460-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:48:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A460-1"}, "ts": "2023-07-07 05:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z8R0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:48:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z8R0-1"}, "ts": "2023-07-07 05:48:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08AF3"}, "ts": "2023-07-07 05:49:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08AF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35309", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:49:31 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O35309", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:49:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYU1"}, "ts": "2023-07-07 05:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54284-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54284-1"}, "ts": "2023-07-07 05:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZYB3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZYB3-1"}, "ts": "2023-07-07 05:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00961", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BMP4"}, "ts": "2023-07-07 05:50:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BMP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:50:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-07 05:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE23"}, "ts": "2023-07-07 05:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:51:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:51:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3J3"}, "ts": "2023-07-07 05:51:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3J3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:51:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60500.79.79"}, "ts": "2023-07-07 05:51:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60500", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:51:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GW7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:52:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96GW7.384.384"}, "ts": "2023-07-07 05:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31507604", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:52:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31507604", "type": "PubMed"}, "ts": "2023-07-07 05:52:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q02223-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02223-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:52:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95158"}, "ts": "2023-07-07 05:52:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2303462", "type": "PubMed"}, "ts": "2023-07-07 05:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2303462", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:52:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BH16-1"}, "ts": "2023-07-07 05:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BH16-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95158", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:52:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64319"}, "ts": "2023-07-07 05:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64319", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:52:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95460"}, "ts": "2023-07-07 05:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95460", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:52:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0PMD2"}, "ts": "2023-07-07 05:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0PMD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:52:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 05:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 05:52:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 05:52:50 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-07 05:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-07 05:52:52 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-07 05:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000016"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-07 05:52:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000042"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000004"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000021"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000050"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000049"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000017"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000051"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000006"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000044"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000033"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000043"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000037"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000026"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000032"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000029"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000041"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000039"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000047"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000058"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000027"}, "ts": "2023-07-07 05:52:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000040"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000046"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000252"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000030"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000057"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000025"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000074"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000118"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000095"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000100"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000064"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000078"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000091"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000089"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000104"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000060"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000085"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000108"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000110"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000121"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000059"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000081"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000068"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000114"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000070"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-07 05:52:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000084"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000109"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000111"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000075"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000120"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000013"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000080"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000069"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000115"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000071"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000098"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000119"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000094"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000007"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000101"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000065"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000054"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000079"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000088"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000105"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000061"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000086"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000113"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000077"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000122"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000011"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000082"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-07 05:52:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000117"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000073"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000096"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000103"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000067"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000056"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000092"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000028"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000063"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000097"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000102"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000066"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000093"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000053"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000106"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000062"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000087"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000014"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000112"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000076"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000010"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000083"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000116"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000072"}, "ts": "2023-07-07 05:52:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90374QW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:53:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90374QW"}, "ts": "2023-07-07 05:53:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56UD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:53:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56UD9"}, "ts": "2023-07-07 05:53:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19634", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:53:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19634"}, "ts": "2023-07-07 05:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:54:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXB5"}, "ts": "2023-07-07 05:54:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32PY9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:54:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32PY9-1"}, "ts": "2023-07-07 05:54:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9V2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:54:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9V2"}, "ts": "2023-07-07 05:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28898718", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:54:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28898718", "type": "PubMed"}, "ts": "2023-07-07 05:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92743", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92743"}, "ts": "2023-07-07 05:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80U78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80U78"}, "ts": "2023-07-07 05:54:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00445", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 05:55:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00445.335.335"}, "ts": "2023-07-07 05:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18401II", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:55:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18401II"}, "ts": "2023-07-07 05:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14773"}, "ts": "2023-07-07 05:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14773", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:55:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34082"}, "ts": "2023-07-07 05:55:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70375MX"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80735OA"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 05:55:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:56:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZP6"}, "ts": "2023-07-07 05:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:56:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q3TEW6-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 05:56:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TEW6-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 05:56:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H765"}, "ts": "2023-07-07 05:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18825", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:56:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18825"}, "ts": "2023-07-07 05:56:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P69892"}, "ts": "2023-07-07 05:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69892", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:56:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-07 05:56:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3865178", "type": "PubMed"}, "ts": "2023-07-07 05:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3865178", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:56:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JB7"}, "ts": "2023-07-07 05:57:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17927IW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:57:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17927IW"}, "ts": "2023-07-07 05:57:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71300RP"}, "ts": "2023-07-07 05:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71300RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28546514", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:57:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28546514", "type": "PubMed"}, "ts": "2023-07-07 05:57:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28546514", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 05:57:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PQ7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 05:57:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PQ7"}, "ts": "2023-07-07 05:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:57:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04004", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:58:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04004"}, "ts": "2023-07-07 05:58:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A0E8-1"}, "ts": "2023-07-07 05:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A0E8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:58:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0C3"}, "ts": "2023-07-07 05:58:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0C3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:58:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43405"}, "ts": "2023-07-07 05:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09579YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 05:59:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09579YO"}, "ts": "2023-07-07 05:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:59:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11054422", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:59:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11054422", "type": "PubMed"}, "ts": "2023-07-07 05:59:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R5K4-1"}, "ts": "2023-07-07 05:59:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R5K4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A517-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:59:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A517-1"}, "ts": "2023-07-07 05:59:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A517-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 05:59:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A517-1"}, "ts": "2023-07-07 05:59:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20947785", "type": "PubMed"}, "ts": "2023-07-07 05:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20947785", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 05:59:59 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 06:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 06:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 06:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 06:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 06:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 06:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:00:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31991IV"}, "ts": "2023-07-07 06:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31991IV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16181", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:00:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16181"}, "ts": "2023-07-07 06:00:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14523.604.604"}, "ts": "2023-07-07 06:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14523", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09622", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:01:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09622.502.502"}, "ts": "2023-07-07 06:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17812"}, "ts": "2023-07-07 06:01:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY74.914.914"}, "ts": "2023-07-07 06:01:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY74", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20948DN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:01:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20948DN"}, "ts": "2023-07-07 06:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19277732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:01:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19277732", "type": "PubMed"}, "ts": "2023-07-07 06:01:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:01:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4C0"}, "ts": "2023-07-07 06:01:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22897.1205.1205"}, "ts": "2023-07-07 06:02:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22897", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:02:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:02:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:02:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96TA2"}, "ts": "2023-07-07 06:02:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96TA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:02:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16092.585.585"}, "ts": "2023-07-07 06:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16092", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EB81"}, "ts": "2023-07-07 06:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EB81", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIG0"}, "ts": "2023-07-07 06:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:02:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09326", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:02:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09326.206.206"}, "ts": "2023-07-07 06:02:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K198-1"}, "ts": "2023-07-07 06:02:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K198-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:03:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05978GH"}, "ts": "2023-07-07 06:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05978GH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98579QO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:03:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98579QO"}, "ts": "2023-07-07 06:03:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:03:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJ98-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:03:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJ98-1"}, "ts": "2023-07-07 06:03:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21932-1"}, "ts": "2023-07-07 06:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21932-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:03:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14389GM"}, "ts": "2023-07-07 06:04:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14389GM"}, "ts": "2023-07-07 06:04:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZUH3-1"}, "ts": "2023-07-07 06:04:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZUH3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:04:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JVA9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:04:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JVA9"}, "ts": "2023-07-07 06:04:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCZ1.666.666"}, "ts": "2023-07-07 06:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCZ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:04:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:04:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2T1"}, "ts": "2023-07-07 06:04:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60568"}, "ts": "2023-07-07 06:05:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09161"}, "ts": "2023-07-07 06:05:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:05:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTK4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTK4-1"}, "ts": "2023-07-07 06:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3P9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:05:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y3P9.277.277"}, "ts": "2023-07-07 06:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22123132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:05:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22123132", "type": "PubMed"}, "ts": "2023-07-07 06:05:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05165"}, "ts": "2023-07-07 06:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05165", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:05:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PF06"}, "ts": "2023-07-07 06:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PF06", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00034MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:06:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00034MO"}, "ts": "2023-07-07 06:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969X0", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 06:06:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q969X0", "cluster_type": "unselected"}, "ts": "2023-07-07 06:06:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 06:06:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80108"}, "ts": "2023-07-07 06:06:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969X0", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 06:06:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 06:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:07:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WVV9"}, "ts": "2023-07-07 06:07:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21726WW"}, "ts": "2023-07-07 06:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21726WW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:07:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60660BN"}, "ts": "2023-07-07 06:07:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01833.88.88"}, "ts": "2023-07-07 06:07:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01833", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:07:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S55"}, "ts": "2023-07-07 06:07:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:07:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:08:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98088.1483.1483"}, "ts": "2023-07-07 06:08:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6C2"}, "ts": "2023-07-07 06:08:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6C2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:08:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-07 06:08:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A597"}, "ts": "2023-07-07 06:08:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10072754", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:09:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10072754", "type": "PubMed"}, "ts": "2023-07-07 06:09:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYI0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:10:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYI0"}, "ts": "2023-07-07 06:10:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19015309", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:10:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19015309", "type": "PubMed"}, "ts": "2023-07-07 06:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14231", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:10:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14231.193.193"}, "ts": "2023-07-07 06:10:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:10:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFY4.222.222"}, "ts": "2023-07-07 06:10:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFY4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14869", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 06:10:58 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14869", "cluster_type": "unselected"}, "ts": "2023-07-07 06:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96NZ9"}, "ts": "2023-07-07 06:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14869", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 06:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NZ9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21815", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:11:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P21815.122.122"}, "ts": "2023-07-07 06:11:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60894"}, "ts": "2023-07-07 06:11:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQJ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:12:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PQJ8-1"}, "ts": "2023-07-07 06:12:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05324EO"}, "ts": "2023-07-07 06:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05324EO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00395TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:12:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63981YU"}, "ts": "2023-07-07 06:12:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63981YU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:12:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAX9"}, "ts": "2023-07-07 06:12:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80909EN"}, "ts": "2023-07-07 06:12:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70426-1"}, "ts": "2023-07-07 06:13:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70426-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8810905", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:13:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8810905", "type": "PubMed"}, "ts": "2023-07-07 06:13:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99075"}, "ts": "2023-07-07 06:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:13:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82576YO"}, "ts": "2023-07-07 06:13:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59128IS"}, "ts": "2023-07-07 06:13:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59128IS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:13:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C5V8-1"}, "ts": "2023-07-07 06:13:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C5V8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06795XH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:14:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06795XH"}, "ts": "2023-07-07 06:14:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14147"}, "ts": "2023-07-07 06:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14147", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:14:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:14:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WTS6"}, "ts": "2023-07-07 06:14:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WTS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:14:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:14:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMQ2"}, "ts": "2023-07-07 06:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11207026", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:14:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11207026", "type": "PubMed"}, "ts": "2023-07-07 06:14:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18794151", "type": "PubMed"}, "ts": "2023-07-07 06:14:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18794151", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:14:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-07 06:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80909EN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:15:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QVP4.22.22"}, "ts": "2023-07-07 06:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QVP4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:15:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZT78-1"}, "ts": "2023-07-07 06:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZT78-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:16:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6B7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:16:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6B7"}, "ts": "2023-07-07 06:16:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25711307", "type": "PubMed"}, "ts": "2023-07-07 06:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25711307", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:16:09 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-07 06:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 06:16:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 06:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TMR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:16:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TMR0"}, "ts": "2023-07-07 06:16:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937"}, "ts": "2023-07-07 06:16:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14112", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:16:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14112.168.168"}, "ts": "2023-07-07 06:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:17:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8647271", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:18:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8647271", "type": "PubMed"}, "ts": "2023-07-07 06:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-07 06:18:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM07-1"}, "ts": "2023-07-07 06:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM07-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:19:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8530102", "type": "PubMed"}, "ts": "2023-07-07 06:19:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51151"}, "ts": "2023-07-07 06:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8530102", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:19:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10480904", "type": "PubMed"}, "ts": "2023-07-07 06:19:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10480904", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JVQ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:19:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JVQ2-1"}, "ts": "2023-07-07 06:19:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFP4"}, "ts": "2023-07-07 06:19:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:19:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00194ZL"}, "ts": "2023-07-07 06:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00194ZL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14389GM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14389GM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:20:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35280FV"}, "ts": "2023-07-07 06:20:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-07 06:20:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14389GM"}, "ts": "2023-07-07 06:20:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72750GQ"}, "ts": "2023-07-07 06:20:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65937TS"}, "ts": "2023-07-07 06:20:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24338", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24338"}, "ts": "2023-07-07 06:20:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VW38-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:20:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VW38-1"}, "ts": "2023-07-07 06:20:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11597", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:20:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11597.262.262"}, "ts": "2023-07-07 06:20:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3D4-1"}, "ts": "2023-07-07 06:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H3D4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60568", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:21:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCB5"}, "ts": "2023-07-07 06:21:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22607"}, "ts": "2023-07-07 06:21:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P18583-1.1644.1644"}, "ts": "2023-07-07 06:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18583-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15265", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:22:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15265"}, "ts": "2023-07-07 06:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80108", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:22:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06152YZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:22:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06152YZ"}, "ts": "2023-07-07 06:22:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25205.275.275"}, "ts": "2023-07-07 06:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25205", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:22:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-07 06:22:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBF2"}, "ts": "2023-07-07 06:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBF2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00408", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:23:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00408"}, "ts": "2023-07-07 06:23:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75757LG"}, "ts": "2023-07-07 06:23:12 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 06:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 06:23:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 06:23:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKF8-1"}, "ts": "2023-07-07 06:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKF8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60660BN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1H8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:23:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1H8"}, "ts": "2023-07-07 06:23:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RCH8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:23:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RCH8-1"}, "ts": "2023-07-07 06:23:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56524-1"}, "ts": "2023-07-07 06:23:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJ72-1"}, "ts": "2023-07-07 06:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJ72-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JZ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:23:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JZ0-1"}, "ts": "2023-07-07 06:23:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14697"}, "ts": "2023-07-07 06:23:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14697", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:23:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11329255", "type": "PubMed"}, "ts": "2023-07-07 06:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11329255", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:24:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08828"}, "ts": "2023-07-07 06:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04141"}, "ts": "2023-07-07 06:24:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920R3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:25:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920R3"}, "ts": "2023-07-07 06:25:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:25:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9832145", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:25:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9832145", "type": "PubMed"}, "ts": "2023-07-07 06:25:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:25:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58182", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58182"}, "ts": "2023-07-07 06:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULZ2-1"}, "ts": "2023-07-07 06:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULZ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:25:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:26:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92954.579.579"}, "ts": "2023-07-07 06:26:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50579.60.60"}, "ts": "2023-07-07 06:26:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50579", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:26:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7516408", "type": "PubMed"}, "ts": "2023-07-07 06:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7516408", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:26:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921V7"}, "ts": "2023-07-07 06:26:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8TX70-1"}, "ts": "2023-07-07 06:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8TX70-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:26:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZW4.160.160"}, "ts": "2023-07-07 06:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZW4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15153520", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:27:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15153520", "type": "PubMed"}, "ts": "2023-07-07 06:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N357", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:27:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZNU5-1"}, "ts": "2023-07-07 06:27:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N357"}, "ts": "2023-07-07 06:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZNU5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:27:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99519"}, "ts": "2023-07-07 06:27:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L6"}, "ts": "2023-07-07 06:27:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EE38", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:28:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5EE38.25.25"}, "ts": "2023-07-07 06:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RK0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:28:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26850ZV"}, "ts": "2023-07-07 06:29:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6EMB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6EMB2"}, "ts": "2023-07-07 06:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZFW6"}, "ts": "2023-07-07 06:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZFW6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26850ZV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:29:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29118143", "type": "PubMed"}, "ts": "2023-07-07 06:29:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29118143", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:29:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82576YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:29:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68402"}, "ts": "2023-07-07 06:29:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FWI3"}, "ts": "2023-07-07 06:30:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FWI3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:30:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H720"}, "ts": "2023-07-07 06:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H720", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:30:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04130SK"}, "ts": "2023-07-07 06:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04130SK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13443", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:30:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13443.441.441"}, "ts": "2023-07-07 06:30:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11919186", "type": "PubMed"}, "ts": "2023-07-07 06:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11919186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10721", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:30:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10721.293.293"}, "ts": "2023-07-07 06:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JSQ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:30:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JSQ8-1"}, "ts": "2023-07-07 06:30:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SSG8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:31:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SSG8"}, "ts": "2023-07-07 06:31:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08146BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:31:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16066", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:31:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16066"}, "ts": "2023-07-07 06:31:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C7R2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:32:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C7R2-1"}, "ts": "2023-07-07 06:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQN7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:32:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQN7-1"}, "ts": "2023-07-07 06:32:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:32:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q925D4-1"}, "ts": "2023-07-07 06:33:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q925D4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:33:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20042.251.251"}, "ts": "2023-07-07 06:33:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20042", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07808", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:33:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07808"}, "ts": "2023-07-07 06:33:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17R55", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:33:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q17R55.101.101"}, "ts": "2023-07-07 06:33:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2G1"}, "ts": "2023-07-07 06:33:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2G1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-07 06:33:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW64"}, "ts": "2023-07-07 06:33:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:34:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:34:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC73"}, "ts": "2023-07-07 06:34:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60230HH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:34:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y493"}, "ts": "2023-07-07 06:34:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:34:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:34:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9174147"}, "ts": "2023-07-07 06:34:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 06:34:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJZ1"}, "ts": "2023-07-07 06:34:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921K9-1"}, "ts": "2023-07-07 06:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921K9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45714BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:34:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45714BQ"}, "ts": "2023-07-07 06:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32194978", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:35:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32194978", "type": "PubMed"}, "ts": "2023-07-07 06:35:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09708QO"}, "ts": "2023-07-07 06:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09708QO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:35:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4QPC6"}, "ts": "2023-07-07 06:36:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4QPC6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:36:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-07 06:36:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130"}, "ts": "2023-07-07 06:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:36:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18716323", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:36:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18716323", "type": "PubMed"}, "ts": "2023-07-07 06:36:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12830"}, "ts": "2023-07-07 06:36:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G28541PG"}, "ts": "2023-07-07 06:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G28541PG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:37:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47197"}, "ts": "2023-07-07 06:37:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47197", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22607", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:37:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05140"}, "ts": "2023-07-07 06:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05140", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:38:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13726"}, "ts": "2023-07-07 06:38:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18716RI"}, "ts": "2023-07-07 06:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18716RI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:38:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:38:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88871-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:38:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88871-1"}, "ts": "2023-07-07 06:38:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01880-1"}, "ts": "2023-07-07 06:39:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4Q2-1"}, "ts": "2023-07-07 06:39:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56524-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:39:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92535", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:39:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92535"}, "ts": "2023-07-07 06:39:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RD93-1"}, "ts": "2023-07-07 06:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RD93-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:40:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:40:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33372038", "type": "PubMed"}, "ts": "2023-07-07 06:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33372038", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33372038", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 06:40:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DX21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:41:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DX21"}, "ts": "2023-07-07 06:41:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G76329HL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:41:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76329HL"}, "ts": "2023-07-07 06:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2D6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:41:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2D6"}, "ts": "2023-07-07 06:41:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AY79-1"}, "ts": "2023-07-07 06:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AY79-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03950", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G39617JJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:42:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03950"}, "ts": "2023-07-07 06:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NJW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:42:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NJW9"}, "ts": "2023-07-07 06:42:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39617JJ"}, "ts": "2023-07-07 06:42:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:42:08 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NVM4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 06:42:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVM4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 06:42:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3A5"}, "ts": "2023-07-07 06:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3A5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:42:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10620008", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:42:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10620008", "type": "PubMed"}, "ts": "2023-07-07 06:42:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan_detail.html", "message": "page access"}, "ts": "2023-07-07 06:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IA17"}, "ts": "2023-07-07 06:43:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IA17", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:43:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13563.496.496"}, "ts": "2023-07-07 06:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13563", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:43:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8360170", "type": "PubMed"}, "ts": "2023-07-07 06:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8360170", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:43:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DC11", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 06:43:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9DC11", "cluster_type": "unselected"}, "ts": "2023-07-07 06:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DC11", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 06:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05360PA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:44:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05360PA"}, "ts": "2023-07-07 06:44:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:44:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42261"}, "ts": "2023-07-07 06:44:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:44:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56856"}, "ts": "2023-07-07 06:45:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60063JU"}, "ts": "2023-07-07 06:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60063JU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68402", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:45:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6TCH7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 06:46:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6TCH7"}, "ts": "2023-07-07 06:46:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12812759", "type": "PubMed"}, "ts": "2023-07-07 06:46:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12812759", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q562F6"}, "ts": "2023-07-07 06:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q562F6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 06:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5E8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:47:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5E8.682.682"}, "ts": "2023-07-07 06:47:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-07 06:47:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29805041", "type": "PubMed"}, "ts": "2023-07-07 06:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29805041", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JB7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:48:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JB7-1"}, "ts": "2023-07-07 06:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:48:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00751"}, "ts": "2023-07-07 06:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00751", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:49:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N146", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:50:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N146"}, "ts": "2023-07-07 06:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01668", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:50:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01668.2087.2087"}, "ts": "2023-07-07 06:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09527DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:50:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09527DH"}, "ts": "2023-07-07 06:50:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37231"}, "ts": "2023-07-07 06:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PGN1"}, "ts": "2023-07-07 06:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-07 06:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:51:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CG49"}, "ts": "2023-07-07 06:51:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18540UW"}, "ts": "2023-07-07 06:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18540UW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02978", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:51:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02978"}, "ts": "2023-07-07 06:51:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-07 06:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R512-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:52:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R512-1"}, "ts": "2023-07-07 06:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12837266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:52:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12837266", "type": "PubMed"}, "ts": "2023-07-07 06:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41230", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:53:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41230.897.897"}, "ts": "2023-07-07 06:53:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33431657", "type": "PubMed"}, "ts": "2023-07-07 06:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33431657", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33431657", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 06:53:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:53:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2T1"}, "ts": "2023-07-07 06:53:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-07 06:53:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G86750HK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:53:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33771090", "type": "PubMed"}, "ts": "2023-07-07 06:53:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33771090", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9671816", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:53:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9671816", "type": "PubMed"}, "ts": "2023-07-07 06:53:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33234333", "type": "PubMed"}, "ts": "2023-07-07 06:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33234333", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:54:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NNT2"}, "ts": "2023-07-07 06:54:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NNT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:54:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q562B4-1"}, "ts": "2023-07-07 06:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q562B4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75022", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:54:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75022"}, "ts": "2023-07-07 06:54:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53539"}, "ts": "2023-07-07 06:54:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53539", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ET58-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ET58-1"}, "ts": "2023-07-07 06:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:55:06 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6IUU3-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 06:55:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IUU3-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 06:55:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12872"}, "ts": "2023-07-07 06:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12872", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:55:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294"}, "ts": "2023-07-07 06:55:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15392"}, "ts": "2023-07-07 06:55:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15392", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:55:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96G21"}, "ts": "2023-07-07 06:55:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40939"}, "ts": "2023-07-07 06:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40939", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:55:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BVD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BVD1"}, "ts": "2023-07-07 06:56:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-07 06:56:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2F5"}, "ts": "2023-07-07 06:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2F5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:56:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20340138", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:56:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20340138", "type": "PubMed"}, "ts": "2023-07-07 06:56:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BW61"}, "ts": "2023-07-07 06:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BW61", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:56:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZWT2-1"}, "ts": "2023-07-07 06:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:57:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-07 06:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVT0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:57:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WVT0.326.326"}, "ts": "2023-07-07 06:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YT9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 06:57:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86YT9.133.133"}, "ts": "2023-07-07 06:57:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14936"}, "ts": "2023-07-07 06:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14936", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22360420", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 06:58:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22360420", "type": "PubMed"}, "ts": "2023-07-07 06:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06300IW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:58:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06300IW"}, "ts": "2023-07-07 06:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:59:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZWZ1-1"}, "ts": "2023-07-07 06:59:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZWZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:59:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55525GN"}, "ts": "2023-07-07 06:59:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55525GN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 06:59:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 06:59:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14966"}, "ts": "2023-07-07 06:59:45 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 07:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 07:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 07:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 07:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 07:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 07:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97946"}, "ts": "2023-07-07 07:00:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97946", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:00:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M389-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:01:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M389-1"}, "ts": "2023-07-07 07:01:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98161"}, "ts": "2023-07-07 07:02:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-07 07:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:02:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12259"}, "ts": "2023-07-07 07:03:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75339", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:03:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75339"}, "ts": "2023-07-07 07:03:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51679"}, "ts": "2023-07-07 07:03:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRJ7"}, "ts": "2023-07-07 07:03:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:04:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17858.633.633"}, "ts": "2023-07-07 07:04:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A8L5"}, "ts": "2023-07-07 07:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A8L5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:04:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00533-1"}, "ts": "2023-07-07 07:04:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32323791", "type": "PubMed"}, "ts": "2023-07-07 07:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32323791", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:05:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQV4"}, "ts": "2023-07-07 07:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:05:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4FU28"}, "ts": "2023-07-07 07:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4FU28", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08254"}, "ts": "2023-07-07 07:05:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08254", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10321", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10321"}, "ts": "2023-07-07 07:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42658", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42658"}, "ts": "2023-07-07 07:05:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-07 07:06:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49918", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:06:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49918"}, "ts": "2023-07-07 07:06:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:06:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TBP5.86.86"}, "ts": "2023-07-07 07:06:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TBP5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10852", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:08:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10852.420.420"}, "ts": "2023-07-07 07:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25418HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:08:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-07 07:08:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19161337", "type": "PubMed"}, "ts": "2023-07-07 07:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19161337", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:08:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZWT2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:08:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47756"}, "ts": "2023-07-07 07:08:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32969"}, "ts": "2023-07-07 07:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32969", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:09:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11723108", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:09:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11723108", "type": "PubMed"}, "ts": "2023-07-07 07:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:09:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05155.366.366"}, "ts": "2023-07-07 07:09:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12849"}, "ts": "2023-07-07 07:10:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:10:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98878RR"}, "ts": "2023-07-07 07:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98878RR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:11:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15302860", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:11:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15302860", "type": "PubMed"}, "ts": "2023-07-07 07:11:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05148UV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:11:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05148UV"}, "ts": "2023-07-07 07:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:11:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16643"}, "ts": "2023-07-07 07:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9S2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:12:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9S2-1"}, "ts": "2023-07-07 07:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50045TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:12:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24071", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:12:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24071"}, "ts": "2023-07-07 07:12:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0U3-1"}, "ts": "2023-07-07 07:12:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01864"}, "ts": "2023-07-07 07:12:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01864", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0U3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:12:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99081", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:12:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99081.251.251"}, "ts": "2023-07-07 07:12:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32469055", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:13:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32469055", "type": "PubMed"}, "ts": "2023-07-07 07:13:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2W8-1"}, "ts": "2023-07-07 07:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2W8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:13:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1689491", "type": "PubMed"}, "ts": "2023-07-07 07:14:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1689491", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:14:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16150-1.69.69"}, "ts": "2023-07-07 07:14:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16150-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:14:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:14:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y663"}, "ts": "2023-07-07 07:14:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77384RA"}, "ts": "2023-07-07 07:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70297", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:15:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70297"}, "ts": "2023-07-07 07:15:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-07 07:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24043", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24043"}, "ts": "2023-07-07 07:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ULF4-1"}, "ts": "2023-07-07 07:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ULF4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:16:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:16:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11847130", "type": "PubMed"}, "ts": "2023-07-07 07:16:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11847130", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:16:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D992"}, "ts": "2023-07-07 07:16:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:17:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00747.263.263"}, "ts": "2023-07-07 07:17:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ER30-1"}, "ts": "2023-07-07 07:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ER30-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:17:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:18:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60331.555.555"}, "ts": "2023-07-07 07:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60331", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:18:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:18:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01880-1.316.316"}, "ts": "2023-07-07 07:18:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01880-1", "user": "Undecided", "type": "error", "page": "Siteview", "message": "Network error. Site Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 07:18:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6H8Q1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:18:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6H8Q1"}, "ts": "2023-07-07 07:18:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z408.34.34"}, "ts": "2023-07-07 07:18:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z408", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:18:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 07:19:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P12956", "cluster_type": "unselected"}, "ts": "2023-07-07 07:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12956", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 07:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12956", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 07:19:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:19:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00887"}, "ts": "2023-07-07 07:19:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95865", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:19:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95865"}, "ts": "2023-07-07 07:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:19:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00533-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7552714", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:20:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7552714", "type": "PubMed"}, "ts": "2023-07-07 07:20:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24394"}, "ts": "2023-07-07 07:21:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36896-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:21:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36896-1"}, "ts": "2023-07-07 07:21:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M8J5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M8J5-1"}, "ts": "2023-07-07 07:21:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25391-1"}, "ts": "2023-07-07 07:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25391-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L1J8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:21:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67303LF"}, "ts": "2023-07-07 07:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67303LF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:21:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYZ6"}, "ts": "2023-07-07 07:21:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1L1J8-1"}, "ts": "2023-07-07 07:22:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34655920", "type": "PubMed"}, "ts": "2023-07-07 07:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34655920", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34655920", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 07:22:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDB8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:22:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDB8-1"}, "ts": "2023-07-07 07:22:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q810B9"}, "ts": "2023-07-07 07:22:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q810B9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:22:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LMW0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:22:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LMW0-1"}, "ts": "2023-07-07 07:22:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34175ZP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:22:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34175ZP"}, "ts": "2023-07-07 07:22:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60383", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:22:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60383.255.255"}, "ts": "2023-07-07 07:22:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43405"}, "ts": "2023-07-07 07:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZC12-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:23:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZC12-1"}, "ts": "2023-07-07 07:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10719", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:23:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10719"}, "ts": "2023-07-07 07:23:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7794769", "type": "PubMed"}, "ts": "2023-07-07 07:23:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7794769", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:23:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M5N7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:23:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M5N7-1"}, "ts": "2023-07-07 07:23:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02794", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:24:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02794"}, "ts": "2023-07-07 07:24:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69768VE"}, "ts": "2023-07-07 07:24:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07477"}, "ts": "2023-07-07 07:24:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:24:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NZJ6-1"}, "ts": "2023-07-07 07:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NZJ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:24:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49642", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:25:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P49642.356.356"}, "ts": "2023-07-07 07:25:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99990"}, "ts": "2023-07-07 07:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99990", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:25:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:25:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L0Y3"}, "ts": "2023-07-07 07:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L0Y3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:25:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98063"}, "ts": "2023-07-07 07:26:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:26:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q30D77", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:26:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q30D77"}, "ts": "2023-07-07 07:26:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30825", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:26:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30825"}, "ts": "2023-07-07 07:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JA4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:26:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18800351", "type": "PubMed"}, "ts": "2023-07-07 07:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18800351", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:26:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96JA4.338.338"}, "ts": "2023-07-07 07:27:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15910", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:27:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15910.679.679"}, "ts": "2023-07-07 07:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09103-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:28:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09103-1"}, "ts": "2023-07-07 07:28:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:28:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAM8-1"}, "ts": "2023-07-07 07:28:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAM8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:29:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64237"}, "ts": "2023-07-07 07:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-07 07:29:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAM9-1"}, "ts": "2023-07-07 07:30:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAM9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR09", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:30:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NR09"}, "ts": "2023-07-07 07:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:30:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12431783", "type": "PubMed"}, "ts": "2023-07-07 07:30:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12431783", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:30:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64803AP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:30:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64803AP"}, "ts": "2023-07-07 07:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:30:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFA1"}, "ts": "2023-07-07 07:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10535969", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:30:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10535969", "type": "PubMed"}, "ts": "2023-07-07 07:30:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P28070", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 07:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28070", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 07:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G77384RA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28070", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 07:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BIQ6"}, "ts": "2023-07-07 07:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BIQ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:31:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84467IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:31:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05114"}, "ts": "2023-07-07 07:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05114", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17643", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:32:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17643.96.96"}, "ts": "2023-07-07 07:32:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41226", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:32:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41226.408.408"}, "ts": "2023-07-07 07:32:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TSN2"}, "ts": "2023-07-07 07:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TSN2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:33:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24227627", "type": "PubMed"}, "ts": "2023-07-07 07:33:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24227627", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:33:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7W7-1"}, "ts": "2023-07-07 07:34:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7W7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:34:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924N4"}, "ts": "2023-07-07 07:34:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924N4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:34:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-07 07:34:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:34:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27038"}, "ts": "2023-07-07 07:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05997", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:34:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05997.1400.1400"}, "ts": "2023-07-07 07:34:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IYV9"}, "ts": "2023-07-07 07:34:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13207"}, "ts": "2023-07-07 07:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62312", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13207", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:34:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62312"}, "ts": "2023-07-07 07:35:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26518BW"}, "ts": "2023-07-07 07:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26518BW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59621EZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:35:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59621EZ"}, "ts": "2023-07-07 07:35:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02671"}, "ts": "2023-07-07 07:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:35:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10749"}, "ts": "2023-07-07 07:35:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99574-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:35:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99574-1"}, "ts": "2023-07-07 07:35:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08551.67.67"}, "ts": "2023-07-07 07:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95863", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:35:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08551", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:35:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00973-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:35:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00973-1"}, "ts": "2023-07-07 07:35:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95863.112.112"}, "ts": "2023-07-07 07:35:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:36:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12277"}, "ts": "2023-07-07 07:36:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12277", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:36:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-07 07:36:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:36:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42858-1"}, "ts": "2023-07-07 07:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42858-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G87682NE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:37:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-07 07:37:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:37:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75223"}, "ts": "2023-07-07 07:37:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87682NE"}, "ts": "2023-07-07 07:37:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09760", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:37:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09760"}, "ts": "2023-07-07 07:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RB04-1"}, "ts": "2023-07-07 07:37:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RB04-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:37:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29350", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:39:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29350.13.13"}, "ts": "2023-07-07 07:39:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16650"}, "ts": "2023-07-07 07:39:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-07 07:39:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:39:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:39:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13029"}, "ts": "2023-07-07 07:39:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13029", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N328", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:39:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N328"}, "ts": "2023-07-07 07:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06187", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:40:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06187"}, "ts": "2023-07-07 07:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 07:40:29 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 07:40:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 07:40:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51532", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51532"}, "ts": "2023-07-07 07:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX30"}, "ts": "2023-07-07 07:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01113", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:41:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q01113.520.520"}, "ts": "2023-07-07 07:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2387894", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:41:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2387894", "type": "PubMed"}, "ts": "2023-07-07 07:41:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A8B5-1"}, "ts": "2023-07-07 07:41:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A8B5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:42:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32927"}, "ts": "2023-07-07 07:42:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32927", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:42:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A3KGW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:42:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A3KGW5"}, "ts": "2023-07-07 07:42:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35926TG"}, "ts": "2023-07-07 07:42:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94985", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:42:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94985.815.815"}, "ts": "2023-07-07 07:42:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52292", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:43:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52292"}, "ts": "2023-07-07 07:43:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1MAF2-1"}, "ts": "2023-07-07 07:43:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1MAF2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:43:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00112IO"}, "ts": "2023-07-07 07:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00112IO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ALW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:43:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ALW5"}, "ts": "2023-07-07 07:43:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96370VA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:44:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-07 07:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-07 07:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:44:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NB90.70.70"}, "ts": "2023-07-07 07:44:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NB90", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:44:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14272"}, "ts": "2023-07-07 07:44:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14272", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:45:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:45:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUT4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:45:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDN1"}, "ts": "2023-07-07 07:45:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WUT4.75.75"}, "ts": "2023-07-07 07:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDC0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:45:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDC0"}, "ts": "2023-07-07 07:45:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAR7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:45:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAR7-1"}, "ts": "2023-07-07 07:45:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19634", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:46:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:46:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19634"}, "ts": "2023-07-07 07:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20020531", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:46:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20020531", "type": "PubMed"}, "ts": "2023-07-07 07:46:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15439", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:46:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15439"}, "ts": "2023-07-07 07:46:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:46:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UH93"}, "ts": "2023-07-07 07:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UH93", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:47:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C0W1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:47:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C0W1"}, "ts": "2023-07-07 07:47:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43187", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:47:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43187"}, "ts": "2023-07-07 07:47:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90271HJ"}, "ts": "2023-07-07 07:48:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90271HJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:48:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBS9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBS9"}, "ts": "2023-07-07 07:48:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.56.56"}, "ts": "2023-07-07 07:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDC0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:48:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.61.61"}, "ts": "2023-07-07 07:48:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.47.47"}, "ts": "2023-07-07 07:48:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.20.20"}, "ts": "2023-07-07 07:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1694784", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:48:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1694784", "type": "PubMed"}, "ts": "2023-07-07 07:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CHM7-1"}, "ts": "2023-07-07 07:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CHM7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:48:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYR9"}, "ts": "2023-07-07 07:48:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYR9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 07:48:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.44.44"}, "ts": "2023-07-07 07:48:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14859"}, "ts": "2023-07-07 07:49:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.48.48"}, "ts": "2023-07-07 07:49:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32521253", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:49:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32521253", "type": "PubMed"}, "ts": "2023-07-07 07:49:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G36123IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:49:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13500"}, "ts": "2023-07-07 07:50:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000071"}, "ts": "2023-07-07 07:50:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9783586", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 07:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06141RV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:51:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06141RV"}, "ts": "2023-07-07 07:51:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NDC0.51.51"}, "ts": "2023-07-07 07:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56657CK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:51:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56657CK"}, "ts": "2023-07-07 07:51:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:51:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3X1"}, "ts": "2023-07-07 07:51:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IYR6.55.55"}, "ts": "2023-07-07 07:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IYR6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:52:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KR86-1"}, "ts": "2023-07-07 07:52:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KR86-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FWI3"}, "ts": "2023-07-07 07:52:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62314"}, "ts": "2023-07-07 07:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FWI3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:52:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62314"}, "ts": "2023-07-07 07:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6U7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:53:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6U7"}, "ts": "2023-07-07 07:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:54:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHR4"}, "ts": "2023-07-07 07:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:54:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2BFE8-1"}, "ts": "2023-07-07 07:54:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2BFE8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:54:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6W5-1"}, "ts": "2023-07-07 07:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6W5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09454VW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:54:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09454VW"}, "ts": "2023-07-07 07:54:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55205-1"}, "ts": "2023-07-07 07:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55205-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:55:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-07 07:55:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTY0.56.56"}, "ts": "2023-07-07 07:55:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTY0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:55:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHR4"}, "ts": "2023-07-07 07:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01019", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:55:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01019"}, "ts": "2023-07-07 07:55:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-07 07:55:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHR4"}, "ts": "2023-07-07 07:56:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75083"}, "ts": "2023-07-07 07:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75083", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K310-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K310-1"}, "ts": "2023-07-07 07:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4B7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4B7"}, "ts": "2023-07-07 07:56:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-07 07:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XE9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:56:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91XE9.411.411"}, "ts": "2023-07-07 07:56:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1MAA7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:56:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1MAA7-1"}, "ts": "2023-07-07 07:56:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1E9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1E9"}, "ts": "2023-07-07 07:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJX5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:57:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJX5.779.779"}, "ts": "2023-07-07 07:57:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35926TG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 07:58:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02760"}, "ts": "2023-07-07 07:58:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02760", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:59:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LM64-1"}, "ts": "2023-07-07 07:59:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LM64-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AR10-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 07:59:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1AR10-1"}, "ts": "2023-07-07 07:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14623", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 07:59:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14623.286.286"}, "ts": "2023-07-07 07:59:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82450"}, "ts": "2023-07-07 07:59:49 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 08:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 08:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 08:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 08:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 08:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 08:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:00:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R789-1"}, "ts": "2023-07-07 08:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R789-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:00:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q70J99"}, "ts": "2023-07-07 08:00:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70J99", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09164"}, "ts": "2023-07-07 08:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:00:56 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q60625", "cluster_type": "unselected"}, "ts": "2023-07-07 08:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60625", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 08:00:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60625", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 08:00:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6E0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:01:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6E0-1"}, "ts": "2023-07-07 08:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29803", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 08:01:16 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P29803", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 08:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29803", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 08:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10725II", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:01:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10725II"}, "ts": "2023-07-07 08:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:02:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01023"}, "ts": "2023-07-07 08:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27091KK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:02:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27091KK"}, "ts": "2023-07-07 08:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3B7V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80UX8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3B7V0"}, "ts": "2023-07-07 08:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80UX8-1"}, "ts": "2023-07-07 08:02:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75351"}, "ts": "2023-07-07 08:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW35-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 08:02:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8IW35-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 08:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW35-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 08:02:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SU0"}, "ts": "2023-07-07 08:02:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SU0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EC8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:03:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EC8"}, "ts": "2023-07-07 08:03:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63604-1"}, "ts": "2023-07-07 08:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63604-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:03:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQD0"}, "ts": "2023-07-07 08:03:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:03:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY64"}, "ts": "2023-07-07 08:03:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61576-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:03:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61576-1"}, "ts": "2023-07-07 08:03:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H320", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 08:03:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H320", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 08:03:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63914QJ"}, "ts": "2023-07-07 08:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63914QJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:03:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25092", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:04:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25092.79.79"}, "ts": "2023-07-07 08:04:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6V1P9"}, "ts": "2023-07-07 08:04:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6V1P9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:04:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80X89"}, "ts": "2023-07-07 08:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80X89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:04:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26373.85.85"}, "ts": "2023-07-07 08:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R551-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:04:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R551-1"}, "ts": "2023-07-07 08:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26373", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RWK3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:05:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RWK3-1"}, "ts": "2023-07-07 08:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIF9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:05:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIF9"}, "ts": "2023-07-07 08:05:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09564", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:05:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09564"}, "ts": "2023-07-07 08:05:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13500", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:05:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z127"}, "ts": "2023-07-07 08:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:06:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQC9"}, "ts": "2023-07-07 08:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:06:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44215PV"}, "ts": "2023-07-07 08:06:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23294PN"}, "ts": "2023-07-07 08:06:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-07 08:06:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210JR"}, "ts": "2023-07-07 08:06:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47012YE"}, "ts": "2023-07-07 08:06:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80223IX"}, "ts": "2023-07-07 08:06:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-07 08:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:06:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77582RK"}, "ts": "2023-07-07 08:06:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15709-1"}, "ts": "2023-07-07 08:06:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-07 08:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15709-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58216EF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:06:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58216EF"}, "ts": "2023-07-07 08:06:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-07 08:06:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-07 08:07:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00213.287.287"}, "ts": "2023-07-07 08:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00213", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98965MQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:07:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98965MQ"}, "ts": "2023-07-07 08:07:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RKG2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:07:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5RKG2"}, "ts": "2023-07-07 08:07:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01137-1"}, "ts": "2023-07-07 08:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01137-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:08:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0F0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:08:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9C0F0.873.873"}, "ts": "2023-07-07 08:08:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H3G5"}, "ts": "2023-07-07 08:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06278", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:08:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06278"}, "ts": "2023-07-07 08:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34778104", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:08:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34778104", "type": "PubMed"}, "ts": "2023-07-07 08:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S94", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:08:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96S94.386.386"}, "ts": "2023-07-07 08:08:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:09:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:09:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ09"}, "ts": "2023-07-07 08:09:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20935635", "type": "PubMed"}, "ts": "2023-07-07 08:10:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20935635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:10:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G21672LC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:10:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21672LC"}, "ts": "2023-07-07 08:10:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7KZI7.487.487"}, "ts": "2023-07-07 08:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KZI7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:10:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54289", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:11:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54289.689.689"}, "ts": "2023-07-07 08:11:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW92", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:11:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IW92.255.255"}, "ts": "2023-07-07 08:11:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80TG9.384.384"}, "ts": "2023-07-07 08:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TG9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:11:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1H1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:11:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T1H1.516.516"}, "ts": "2023-07-07 08:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7A8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:11:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7A8-1"}, "ts": "2023-07-07 08:11:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10719.106.106"}, "ts": "2023-07-07 08:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10719", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q704Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:12:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q704Y3"}, "ts": "2023-07-07 08:12:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60603", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:12:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60603"}, "ts": "2023-07-07 08:12:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LD1"}, "ts": "2023-07-07 08:12:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27515512", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:12:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27515512", "type": "PubMed"}, "ts": "2023-07-07 08:12:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48431"}, "ts": "2023-07-07 08:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:12:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51589", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:12:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51589"}, "ts": "2023-07-07 08:12:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M7L9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:13:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M7L9-1"}, "ts": "2023-07-07 08:13:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JL70-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:13:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JL70-1"}, "ts": "2023-07-07 08:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:14:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPJ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:14:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EPJ9.135.135"}, "ts": "2023-07-07 08:14:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TN44"}, "ts": "2023-07-07 08:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TN44", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:14:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UN15"}, "ts": "2023-07-07 08:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:14:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UN15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:14:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P032-1"}, "ts": "2023-07-07 08:15:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P032-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PK81", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:15:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PK81"}, "ts": "2023-07-07 08:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0A8"}, "ts": "2023-07-07 08:15:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0A8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:15:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15561"}, "ts": "2023-07-07 08:15:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15561", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:15:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 08:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82450", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:15:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08997GC"}, "ts": "2023-07-07 08:16:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08997GC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTW5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:16:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTW5"}, "ts": "2023-07-07 08:16:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-07 08:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20908", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:16:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20908.315.315"}, "ts": "2023-07-07 08:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:16:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99P99-1"}, "ts": "2023-07-07 08:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99P99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:16:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMY4-2"}, "ts": "2023-07-07 08:17:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMY4-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:17:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TMA5"}, "ts": "2023-07-07 08:17:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TMA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:17:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVV4.232.232"}, "ts": "2023-07-07 08:17:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2G2"}, "ts": "2023-07-07 08:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2G2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:17:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66019PC"}, "ts": "2023-07-07 08:18:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613"}, "ts": "2023-07-07 08:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:18:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q24JP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:18:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q24JP5"}, "ts": "2023-07-07 08:18:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-07 08:18:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:18:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:18:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-07 08:18:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14696", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:19:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14696.92.92"}, "ts": "2023-07-07 08:19:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2E5"}, "ts": "2023-07-07 08:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2E5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPW1-1"}, "ts": "2023-07-07 08:20:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45880"}, "ts": "2023-07-07 08:20:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPW1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:20:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 08:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26453379", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:20:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26453379", "type": "PubMed"}, "ts": "2023-07-07 08:20:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0S7-1"}, "ts": "2023-07-07 08:21:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0S7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:21:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8640229", "type": "PubMed"}, "ts": "2023-07-07 08:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8640229", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKU9"}, "ts": "2023-07-07 08:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40425", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:21:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40425.330.330"}, "ts": "2023-07-07 08:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57729", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:22:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57729"}, "ts": "2023-07-07 08:22:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAZ9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAZ9-1"}, "ts": "2023-07-07 08:22:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-07 08:22:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33176", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:22:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33176.543.543"}, "ts": "2023-07-07 08:22:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K9E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:22:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K9E7"}, "ts": "2023-07-07 08:22:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZP6-1"}, "ts": "2023-07-07 08:22:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZP6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:22:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60909", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:22:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60909"}, "ts": "2023-07-07 08:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96R47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:23:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96R47"}, "ts": "2023-07-07 08:23:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:23:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V01"}, "ts": "2023-07-07 08:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZNV1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:23:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZNV1-1"}, "ts": "2023-07-07 08:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:24:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01860.229.229"}, "ts": "2023-07-07 08:24:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHE5-1"}, "ts": "2023-07-07 08:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHE5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:24:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48507", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:24:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48507.112.112"}, "ts": "2023-07-07 08:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUE6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:25:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IUE6.2.2"}, "ts": "2023-07-07 08:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:25:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94913-1.33.33"}, "ts": "2023-07-07 08:25:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99988-1"}, "ts": "2023-07-07 08:25:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94913-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:25:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99988-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:25:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95571"}, "ts": "2023-07-07 08:26:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:26:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61548", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:26:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61548.306.306"}, "ts": "2023-07-07 08:26:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-07 08:26:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2F0"}, "ts": "2023-07-07 08:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2F0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:26:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36955-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P36955-1"}, "ts": "2023-07-07 08:26:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32510182", "type": "PubMed"}, "ts": "2023-07-07 08:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32510182", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00241", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:27:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00241.293.293"}, "ts": "2023-07-07 08:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:28:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1K8"}, "ts": "2023-07-07 08:28:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09102DD"}, "ts": "2023-07-07 08:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:28:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09102DD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:28:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41229"}, "ts": "2023-07-07 08:29:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41229", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:29:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYW1"}, "ts": "2023-07-07 08:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3F0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3F0"}, "ts": "2023-07-07 08:29:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96308CY"}, "ts": "2023-07-07 08:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96308CY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6G5"}, "ts": "2023-07-07 08:30:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11117", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:30:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11117.135.135"}, "ts": "2023-07-07 08:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53621", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:30:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6F2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:30:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6F2"}, "ts": "2023-07-07 08:30:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53621"}, "ts": "2023-07-07 08:31:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2M389-1"}, "ts": "2023-07-07 08:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M389-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1861871", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:31:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1861871", "type": "PubMed"}, "ts": "2023-07-07 08:31:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IUK5-1"}, "ts": "2023-07-07 08:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUK5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0QW46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:32:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0QW46"}, "ts": "2023-07-07 08:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ75", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:32:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WZ75.784.784"}, "ts": "2023-07-07 08:32:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-07 08:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9242535", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:32:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9242535", "type": "PubMed"}, "ts": "2023-07-07 08:32:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:32:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96FT7.484.484"}, "ts": "2023-07-07 08:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FT7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8M1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:33:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8M1-1"}, "ts": "2023-07-07 08:33:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60359"}, "ts": "2023-07-07 08:33:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60359", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:33:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1Z9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:33:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1Z9-1"}, "ts": "2023-07-07 08:33:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:33:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04141"}, "ts": "2023-07-07 08:33:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54901-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:34:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969G6"}, "ts": "2023-07-07 08:34:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54901-1"}, "ts": "2023-07-07 08:34:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969G6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:34:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-07 08:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:35:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-07 08:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:35:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJQ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:35:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UJQ4.922.922"}, "ts": "2023-07-07 08:35:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:36:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14739"}, "ts": "2023-07-07 08:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41352UL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:36:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41352UL"}, "ts": "2023-07-07 08:36:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-07 08:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6QI22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:36:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6QI22"}, "ts": "2023-07-07 08:36:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DBB1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:36:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64560"}, "ts": "2023-07-07 08:36:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DBB1"}, "ts": "2023-07-07 08:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:36:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:36:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29482072", "type": "PubMed"}, "ts": "2023-07-07 08:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29482072", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:36:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35889"}, "ts": "2023-07-07 08:37:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35889", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:37:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85556MF"}, "ts": "2023-07-07 08:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85556MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06547", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06547"}, "ts": "2023-07-07 08:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:38:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQG9"}, "ts": "2023-07-07 08:38:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQG9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:38:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:38:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q495A1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:38:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q495A1"}, "ts": "2023-07-07 08:38:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43603", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:40:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43603.4.4"}, "ts": "2023-07-07 08:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33407466", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:40:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33407466", "type": "PubMed"}, "ts": "2023-07-07 08:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33407466", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 08:40:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BTZ2-1"}, "ts": "2023-07-07 08:40:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTZ2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11517", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11517"}, "ts": "2023-07-07 08:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68400"}, "ts": "2023-07-07 08:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68400", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15762", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15762"}, "ts": "2023-07-07 08:41:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYN5"}, "ts": "2023-07-07 08:41:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYN5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M9I4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:41:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M9I4-1"}, "ts": "2023-07-07 08:41:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24273172", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:41:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24273172", "type": "PubMed"}, "ts": "2023-07-07 08:41:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8806667", "type": "PubMed"}, "ts": "2023-07-07 08:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8806667", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:41:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUB1"}, "ts": "2023-07-07 08:41:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:41:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-07 08:41:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93899SO"}, "ts": "2023-07-07 08:42:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G93899SO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:42:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13480", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:42:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13480"}, "ts": "2023-07-07 08:42:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11104762", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:42:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11104762", "type": "PubMed"}, "ts": "2023-07-07 08:42:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-07 08:42:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:42:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83461WR"}, "ts": "2023-07-07 08:42:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0K1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0K1"}, "ts": "2023-07-07 08:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NSJ5"}, "ts": "2023-07-07 08:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NSJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57254KI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:43:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57254KI"}, "ts": "2023-07-07 08:43:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:43:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-07 08:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8380895", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:44:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8380895", "type": "PubMed"}, "ts": "2023-07-07 08:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70382FA"}, "ts": "2023-07-07 08:45:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31751-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:45:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31751-1"}, "ts": "2023-07-07 08:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NYC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:45:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6NYC8.72.72"}, "ts": "2023-07-07 08:45:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08640KF"}, "ts": "2023-07-07 08:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08640KF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:45:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K7Y9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:46:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K7Y9-1"}, "ts": "2023-07-07 08:46:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87051GH"}, "ts": "2023-07-07 08:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G87051GH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:46:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R622-1"}, "ts": "2023-07-07 08:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R622-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:46:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DN0"}, "ts": "2023-07-07 08:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DN0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:46:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q922H7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:46:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:46:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q922H7"}, "ts": "2023-07-07 08:46:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQR0.300.300"}, "ts": "2023-07-07 08:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRF8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:46:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRF8"}, "ts": "2023-07-07 08:46:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04864", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:47:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04864"}, "ts": "2023-07-07 08:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI08", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:47:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UI08"}, "ts": "2023-07-07 08:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:47:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9260929"}, "ts": "2023-07-07 08:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 08:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:48:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ65"}, "ts": "2023-07-07 08:48:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BTI8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:48:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BTI8"}, "ts": "2023-07-07 08:48:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5USA8-1"}, "ts": "2023-07-07 08:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5USA8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:48:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83436"}, "ts": "2023-07-07 08:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83436", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:48:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUI6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09824MS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:49:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09824MS"}, "ts": "2023-07-07 08:49:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y587"}, "ts": "2023-07-07 08:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y587", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:49:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-07 08:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:50:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-07 08:50:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60994.68.68"}, "ts": "2023-07-07 08:50:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20700-1"}, "ts": "2023-07-07 08:50:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92608", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92608"}, "ts": "2023-07-07 08:50:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253-1"}, "ts": "2023-07-07 08:51:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBV8"}, "ts": "2023-07-07 08:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:51:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZT90-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:51:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZT90-1"}, "ts": "2023-07-07 08:51:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A131"}, "ts": "2023-07-07 08:51:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A131", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:51:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23484GM"}, "ts": "2023-07-07 08:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23484GM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:51:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RC9"}, "ts": "2023-07-07 08:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94979"}, "ts": "2023-07-07 08:52:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94979", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:52:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35023483", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:53:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35023483", "type": "PubMed"}, "ts": "2023-07-07 08:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35023483", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 08:53:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62798PI"}, "ts": "2023-07-07 08:54:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12882916", "type": "PubMed"}, "ts": "2023-07-07 08:54:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12882916", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:54:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08AF3"}, "ts": "2023-07-07 08:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33033", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08AF3"}, "ts": "2023-07-07 08:55:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P33033.16.16"}, "ts": "2023-07-07 08:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08AF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:55:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08AF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:55:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MQ14", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:55:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A8MQ14.385.385"}, "ts": "2023-07-07 08:55:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70549-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 08:55:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70549-1"}, "ts": "2023-07-07 08:55:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G87251UV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:55:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87251UV"}, "ts": "2023-07-07 08:55:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8S5-1"}, "ts": "2023-07-07 08:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8S5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JE40", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:56:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "C9JE40.478.478"}, "ts": "2023-07-07 08:56:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53H54"}, "ts": "2023-07-07 08:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53H54", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19140243", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:56:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19140243", "type": "PubMed"}, "ts": "2023-07-07 08:56:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46379"}, "ts": "2023-07-07 08:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:56:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14161"}, "ts": "2023-07-07 08:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24863", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:56:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24863"}, "ts": "2023-07-07 08:56:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12761192", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:56:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12761192", "type": "PubMed"}, "ts": "2023-07-07 08:56:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06495-1"}, "ts": "2023-07-07 08:56:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06495-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:57:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVW8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 08:58:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVW8.210.210"}, "ts": "2023-07-07 08:58:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-07 08:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25771791", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 08:58:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25771791", "type": "PubMed"}, "ts": "2023-07-07 08:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83461WR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 08:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AYC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:58:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AYC4"}, "ts": "2023-07-07 08:58:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-07 08:59:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LUX3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LUX3-1"}, "ts": "2023-07-07 08:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:59:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43237"}, "ts": "2023-07-07 08:59:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6L2-1"}, "ts": "2023-07-07 08:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6L2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 08:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 09:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 09:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 09:00:01 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 09:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 09:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 09:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9Z2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H9Z2"}, "ts": "2023-07-07 09:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A9I7-1"}, "ts": "2023-07-07 09:00:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A9I7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:00:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q495B1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:00:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q495B1.92.92"}, "ts": "2023-07-07 09:00:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-07 09:00:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10981"}, "ts": "2023-07-07 09:00:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:00:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11852AF"}, "ts": "2023-07-07 09:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11852AF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:00:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B23"}, "ts": "2023-07-07 09:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R4M2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:00:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R4M2-1"}, "ts": "2023-07-07 09:00:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14317.103.103"}, "ts": "2023-07-07 09:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14317", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6V0I7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6V0I7"}, "ts": "2023-07-07 09:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33239170", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:01:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33239170", "type": "PubMed"}, "ts": "2023-07-07 09:01:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05205SE"}, "ts": "2023-07-07 09:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05205SE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20065029", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:01:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20065029", "type": "PubMed"}, "ts": "2023-07-07 09:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:01:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22413"}, "ts": "2023-07-07 09:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22413", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:01:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8BVI5.41.41"}, "ts": "2023-07-07 09:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BVI5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:02:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-07 09:02:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-07 09:02:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RXB0-1"}, "ts": "2023-07-07 09:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RXB0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88942-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:03:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88942-1"}, "ts": "2023-07-07 09:03:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:03:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK58"}, "ts": "2023-07-07 09:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:03:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK58"}, "ts": "2023-07-07 09:03:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P232", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:03:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P232.438.438"}, "ts": "2023-07-07 09:03:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12595504", "type": "PubMed"}, "ts": "2023-07-07 09:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12595504", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:04:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28094252", "type": "PubMed"}, "ts": "2023-07-07 09:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28094252", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6Y9"}, "ts": "2023-07-07 09:05:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08117", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:05:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08117"}, "ts": "2023-07-07 09:05:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96577RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:06:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAV1-1"}, "ts": "2023-07-07 09:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAV1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:06:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20700-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60994", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:06:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ULG3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:06:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ULG3"}, "ts": "2023-07-07 09:06:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CYA0"}, "ts": "2023-07-07 09:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CYA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:06:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 09:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10253-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:07:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTX8"}, "ts": "2023-07-07 09:07:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:07:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PL5"}, "ts": "2023-07-07 09:08:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PL5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q24JP5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:08:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q24JP5"}, "ts": "2023-07-07 09:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07075ND", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:08:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07075ND"}, "ts": "2023-07-07 09:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14191", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:08:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14191"}, "ts": "2023-07-07 09:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15670210", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:09:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15670210", "type": "PubMed"}, "ts": "2023-07-07 09:09:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01854.59.59"}, "ts": "2023-07-07 09:09:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01854", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:10:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22768VO"}, "ts": "2023-07-07 09:10:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:10:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95373"}, "ts": "2023-07-07 09:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25090", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:10:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25090"}, "ts": "2023-07-07 09:10:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LM6-1"}, "ts": "2023-07-07 09:10:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LM6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14427", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:10:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14427.197.197"}, "ts": "2023-07-07 09:10:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63519GO"}, "ts": "2023-07-07 09:11:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63519GO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:11:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00144"}, "ts": "2023-07-07 09:11:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76329HL"}, "ts": "2023-07-07 09:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G76329HL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:11:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-07 09:11:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:11:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54098"}, "ts": "2023-07-07 09:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54098", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:11:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 09:11:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-07 09:11:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75140"}, "ts": "2023-07-07 09:11:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-07 09:12:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10075", "user": "Undecided", "type": "user", "page": "protein", "message": "Performing Global Search"}, "ts": "2023-07-07 09:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-07 09:13:04 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "P10075"}, "ts": "2023-07-07 09:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-07 09:13:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10075", "user": "Undecided", "type": "user", "page": "global-search-result", "message": "Global search term=P10075"}, "ts": "2023-07-07 09:13:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAV4"}, "ts": "2023-07-07 09:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18212045", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:13:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18212045", "type": "PubMed"}, "ts": "2023-07-07 09:13:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34822AT"}, "ts": "2023-07-07 09:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34822AT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:13:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10075-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:13:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10075-1"}, "ts": "2023-07-07 09:13:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43355"}, "ts": "2023-07-07 09:13:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43355", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:14:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92791", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:14:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92791"}, "ts": "2023-07-07 09:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXT9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:14:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXT9"}, "ts": "2023-07-07 09:14:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2I8"}, "ts": "2023-07-07 09:14:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2I8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:14:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8486375", "type": "PubMed"}, "ts": "2023-07-07 09:15:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8486375", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:15:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-07 09:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-07 09:15:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H84"}, "ts": "2023-07-07 09:15:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:15:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01011-1.93.93"}, "ts": "2023-07-07 09:15:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01011-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:15:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95394"}, "ts": "2023-07-07 09:15:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:15:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 09:15:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRJ3"}, "ts": "2023-07-07 09:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRJ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "35104164", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:16:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "35104164", "type": "PubMed"}, "ts": "2023-07-07 09:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10981", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28329", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:16:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28329.34.34"}, "ts": "2023-07-07 09:16:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20823"}, "ts": "2023-07-07 09:16:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:16:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15027"}, "ts": "2023-07-07 09:16:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "36768728", "type": "PubMed"}, "ts": "2023-07-07 09:16:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "36768728", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:16:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01859LC"}, "ts": "2023-07-07 09:16:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01859LC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:16:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14151-1"}, "ts": "2023-07-07 09:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCC3"}, "ts": "2023-07-07 09:17:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N122"}, "ts": "2023-07-07 09:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:17:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61513"}, "ts": "2023-07-07 09:18:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1569568", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:18:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1569568", "type": "PubMed"}, "ts": "2023-07-07 09:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84452RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:18:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:18:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2H0.547.547"}, "ts": "2023-07-07 09:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2H0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:18:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25583577", "type": "PubMed"}, "ts": "2023-07-07 09:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25583577", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:19:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95429"}, "ts": "2023-07-07 09:19:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1Z8"}, "ts": "2023-07-07 09:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1Z8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:19:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75578"}, "ts": "2023-07-07 09:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75578", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15242646", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:20:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15242646", "type": "PubMed"}, "ts": "2023-07-07 09:20:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H920"}, "ts": "2023-07-07 09:20:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H920", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:20:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88792", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:20:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88792.282.282"}, "ts": "2023-07-07 09:20:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10491192", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:21:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10491192", "type": "PubMed"}, "ts": "2023-07-07 09:21:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07998"}, "ts": "2023-07-07 09:21:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07998", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:21:25 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q64605", "cluster_type": "unselected"}, "ts": "2023-07-07 09:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96JJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 09:21:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96JJ7"}, "ts": "2023-07-07 09:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64605", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 09:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64605", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 09:21:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P28472.146.146"}, "ts": "2023-07-07 09:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28472", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16780419", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:21:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16780419", "type": "PubMed"}, "ts": "2023-07-07 09:21:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66L44"}, "ts": "2023-07-07 09:22:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66L44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:22:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R665-1"}, "ts": "2023-07-07 09:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R665-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6Q3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:22:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N6Q3.170.170"}, "ts": "2023-07-07 09:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12492477", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:22:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12492477", "type": "PubMed"}, "ts": "2023-07-07 09:22:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6G5"}, "ts": "2023-07-07 09:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6G5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:22:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01033-1"}, "ts": "2023-07-07 09:22:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63118"}, "ts": "2023-07-07 09:22:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04866JA"}, "ts": "2023-07-07 09:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04866JA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:23:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-07 09:23:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31270"}, "ts": "2023-07-07 09:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:24:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31270", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:24:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31274"}, "ts": "2023-07-07 09:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31274", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:24:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31153XO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:24:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31153XO"}, "ts": "2023-07-07 09:24:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95382", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:25:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95382.953.953"}, "ts": "2023-07-07 09:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R915-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:25:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R915-1"}, "ts": "2023-07-07 09:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:25:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38445"}, "ts": "2023-07-07 09:25:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0G0-1"}, "ts": "2023-07-07 09:25:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000085"}, "ts": "2023-07-07 09:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0G0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:25:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K487-1"}, "ts": "2023-07-07 09:25:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K487-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:26:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22768VO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16314520", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:26:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16314520", "type": "PubMed"}, "ts": "2023-07-07 09:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:27:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-07 09:27:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04070"}, "ts": "2023-07-07 09:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q695T7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:27:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q695T7-1"}, "ts": "2023-07-07 09:27:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDR0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:28:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDR0.18.18"}, "ts": "2023-07-07 09:28:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231"}, "ts": "2023-07-07 09:28:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00156-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15393", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:29:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15393.213.213"}, "ts": "2023-07-07 09:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30101"}, "ts": "2023-07-07 09:29:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30101", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14968113", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:30:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14968113", "type": "PubMed"}, "ts": "2023-07-07 09:30:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D159", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:30:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D159"}, "ts": "2023-07-07 09:30:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:30:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60238"}, "ts": "2023-07-07 09:31:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DX4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:31:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96DX4.562.562"}, "ts": "2023-07-07 09:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16594-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:31:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16594-1"}, "ts": "2023-07-07 09:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:31:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64281-1"}, "ts": "2023-07-07 09:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64281-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:31:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15127"}, "ts": "2023-07-07 09:31:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60469.92.92"}, "ts": "2023-07-07 09:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60469", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7649182", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:32:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7649182", "type": "PubMed"}, "ts": "2023-07-07 09:32:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08426DX"}, "ts": "2023-07-07 09:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08426DX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:32:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:32:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75122-1"}, "ts": "2023-07-07 09:32:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2Y4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:32:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2Y4"}, "ts": "2023-07-07 09:32:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P179"}, "ts": "2023-07-07 09:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P179", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:33:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22902404", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:33:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22902404", "type": "PubMed"}, "ts": "2023-07-07 09:33:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97242GV"}, "ts": "2023-07-07 09:33:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G97242GV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:33:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02786"}, "ts": "2023-07-07 09:33:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05164", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:33:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05164.729.729"}, "ts": "2023-07-07 09:33:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61513", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:34:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C595-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:34:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C595-1"}, "ts": "2023-07-07 09:34:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:34:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUN9"}, "ts": "2023-07-07 09:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18464VS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:34:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18464VS"}, "ts": "2023-07-07 09:34:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:35:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDU9"}, "ts": "2023-07-07 09:35:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16152"}, "ts": "2023-07-07 09:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16152", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:36:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7M9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:37:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7M9"}, "ts": "2023-07-07 09:37:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00009BX"}, "ts": "2023-07-07 09:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00009BX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:38:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-07 09:38:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6C8"}, "ts": "2023-07-07 09:38:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6C8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:38:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01033-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:38:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUF5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:38:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUF5"}, "ts": "2023-07-07 09:38:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15431"}, "ts": "2023-07-07 09:38:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D8C8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:38:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D8C8.53.53"}, "ts": "2023-07-07 09:38:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJ08-1"}, "ts": "2023-07-07 09:38:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJ08-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:38:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P36578", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:38:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-07 09:38:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P36578.266.266"}, "ts": "2023-07-07 09:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55259", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:38:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55259.314.314"}, "ts": "2023-07-07 09:38:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05901", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:39:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q05901.199.199"}, "ts": "2023-07-07 09:39:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21781"}, "ts": "2023-07-07 09:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21781", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:40:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H9Q4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:40:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H9Q4"}, "ts": "2023-07-07 09:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DPD6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:40:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DPD6.640.640"}, "ts": "2023-07-07 09:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02549", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11627", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:40:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02549.94.94"}, "ts": "2023-07-07 09:40:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11627.1073.1073"}, "ts": "2023-07-07 09:40:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11158296", "type": "PubMed"}, "ts": "2023-07-07 09:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11158296", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:41:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15457346", "type": "PubMed"}, "ts": "2023-07-07 09:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15457346", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:41:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14338VK"}, "ts": "2023-07-07 09:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14338VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1590804", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:41:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1590804", "type": "PubMed"}, "ts": "2023-07-07 09:41:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ84"}, "ts": "2023-07-07 09:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:41:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q60805.202.202"}, "ts": "2023-07-07 09:42:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60805", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:42:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHY2"}, "ts": "2023-07-07 09:42:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02768"}, "ts": "2023-07-07 09:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19517GM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:43:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19517GM"}, "ts": "2023-07-07 09:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07832", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:43:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07832"}, "ts": "2023-07-07 09:43:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12807903", "type": "PubMed"}, "ts": "2023-07-07 09:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12807903", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:43:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS7"}, "ts": "2023-07-07 09:44:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:44:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:44:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12670716", "type": "PubMed"}, "ts": "2023-07-07 09:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12670716", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89086-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:45:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O89086-1"}, "ts": "2023-07-07 09:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18904MY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:45:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18904MY"}, "ts": "2023-07-07 09:45:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27655845", "type": "PubMed"}, "ts": "2023-07-07 09:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27655845", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:46:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHV5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:46:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHV5"}, "ts": "2023-07-07 09:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "42dupk4qa3g8ba5pztxw628oocqs4bsk", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP23", "user": "42dupk4qa3g8ba5pztxw628oocqs4bsk", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DP23"}, "ts": "2023-07-07 09:46:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 09:46:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12908.4.4"}, "ts": "2023-07-07 09:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12908", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:47:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72460OS"}, "ts": "2023-07-07 09:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72460OS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83638RK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:47:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83638RK"}, "ts": "2023-07-07 09:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:47:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBV4-1"}, "ts": "2023-07-07 09:47:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75122-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:48:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XAS2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6XAS2-1"}, "ts": "2023-07-07 09:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1WBT8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1WBT8"}, "ts": "2023-07-07 09:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBU8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:49:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIJ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:49:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIJ1-1"}, "ts": "2023-07-07 09:49:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBU8"}, "ts": "2023-07-07 09:49:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q29RF7"}, "ts": "2023-07-07 09:49:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q29RF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:49:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02786", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:49:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q498U4-1"}, "ts": "2023-07-07 09:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q498U4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:49:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13041EF"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45827ZM"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49632WD"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80111QD"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11911BT"}, "ts": "2023-07-07 09:49:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULC3"}, "ts": "2023-07-07 09:50:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULC3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:50:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43883"}, "ts": "2023-07-07 09:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-07 09:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43497", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:50:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43497.1450.1450"}, "ts": "2023-07-07 09:50:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94855", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:50:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94855"}, "ts": "2023-07-07 09:50:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14646", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:50:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14646"}, "ts": "2023-07-07 09:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CK0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:51:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CK0-1"}, "ts": "2023-07-07 09:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:51:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10722114", "type": "PubMed"}, "ts": "2023-07-07 09:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10722114", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:51:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P179.519.519"}, "ts": "2023-07-07 09:52:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P179", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:52:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27352"}, "ts": "2023-07-07 09:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99853"}, "ts": "2023-07-07 09:52:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99853", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9499401", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:52:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9499401", "type": "PubMed"}, "ts": "2023-07-07 09:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:52:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61769"}, "ts": "2023-07-07 09:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCK5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCK5-1"}, "ts": "2023-07-07 09:52:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T0T0-1"}, "ts": "2023-07-07 09:52:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T0T0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:52:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZCP9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:53:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZCP9"}, "ts": "2023-07-07 09:53:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A3K2"}, "ts": "2023-07-07 09:53:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A3K2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:53:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11557028", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:53:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11557028", "type": "PubMed"}, "ts": "2023-07-07 09:53:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41145"}, "ts": "2023-07-07 09:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41145", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:54:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:54:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3E7-1"}, "ts": "2023-07-07 09:54:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3E7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIA5"}, "ts": "2023-07-07 09:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIA5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:54:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08629-1"}, "ts": "2023-07-07 09:54:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08629-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:54:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54253"}, "ts": "2023-07-07 09:54:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7LBR1"}, "ts": "2023-07-07 09:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LBR1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:54:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63173"}, "ts": "2023-07-07 09:54:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZFC8-1"}, "ts": "2023-07-07 09:54:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZFC8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:55:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7LGC8.305.305"}, "ts": "2023-07-07 09:55:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7LGC8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:55:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C142"}, "ts": "2023-07-07 09:55:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C142", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:55:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16515", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:55:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16515"}, "ts": "2023-07-07 09:55:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-07 09:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12011057", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:55:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12011057", "type": "PubMed"}, "ts": "2023-07-07 09:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50406", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:55:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50406.281.281"}, "ts": "2023-07-07 09:55:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31949"}, "ts": "2023-07-07 09:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60656", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:57:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60656.438.438"}, "ts": "2023-07-07 09:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58473YB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 09:57:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58473YB"}, "ts": "2023-07-07 09:57:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-07 09:58:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11165242", "type": "PubMed"}, "ts": "2023-07-07 09:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11165242", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:58:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18267090", "type": "PubMed"}, "ts": "2023-07-07 09:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18267090", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99829", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:58:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99829"}, "ts": "2023-07-07 09:58:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27635"}, "ts": "2023-07-07 09:58:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27635", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:58:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02768", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:58:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6D8-1"}, "ts": "2023-07-07 09:59:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6D8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:59:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKB4"}, "ts": "2023-07-07 09:59:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKB4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:59:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:59:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14732"}, "ts": "2023-07-07 09:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15393", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 09:59:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15393.213.213"}, "ts": "2023-07-07 09:59:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGI9"}, "ts": "2023-07-07 09:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 09:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78325-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 09:59:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78325-1"}, "ts": "2023-07-07 09:59:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18310267", "type": "PubMed"}, "ts": "2023-07-07 09:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18310267", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:59:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10908300", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 09:59:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10908300", "type": "PubMed"}, "ts": "2023-07-07 09:59:59 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 10:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 10:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 10:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 10:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 10:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 10:00:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000116"}, "ts": "2023-07-07 10:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23932781", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:00:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23932781", "type": "PubMed"}, "ts": "2023-07-07 10:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M720", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:00:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M720"}, "ts": "2023-07-07 10:01:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27248RA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:01:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27248RA"}, "ts": "2023-07-07 10:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:01:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55291"}, "ts": "2023-07-07 10:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55291", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein", "message": "Disabled Logging"}, "ts": "2023-07-07 10:01:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0C4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0C7"}, "ts": "2023-07-07 10:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0C4-1"}, "ts": "2023-07-07 10:01:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 10:01:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:01:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:01:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-07 10:01:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32574038", "type": "PubMed"}, "ts": "2023-07-07 10:01:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32574038", "user": "q93bnjz1qb9qctrw15q06uwryxqf5gia", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05198", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:01:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05198.5.5"}, "ts": "2023-07-07 10:01:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A096MJM7"}, "ts": "2023-07-07 10:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A096MJM7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54253", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:02:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54253.23.23"}, "ts": "2023-07-07 10:02:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8J6"}, "ts": "2023-07-07 10:02:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8J6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:02:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQV5"}, "ts": "2023-07-07 10:02:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQV5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQV5", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 10:02:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22301"}, "ts": "2023-07-07 10:02:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22301", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:03:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O60500", "cluster_type": "unselected"}, "ts": "2023-07-07 10:03:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60500", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 10:03:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60500", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 10:03:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48668"}, "ts": "2023-07-07 10:04:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48668", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:04:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VTH2"}, "ts": "2023-07-07 10:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VTH2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:04:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y294"}, "ts": "2023-07-07 10:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUD5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:04:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUD5"}, "ts": "2023-07-07 10:04:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7M0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:04:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z7M0.612.612"}, "ts": "2023-07-07 10:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWG6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:04:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWG6-1"}, "ts": "2023-07-07 10:04:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43007"}, "ts": "2023-07-07 10:04:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCW6"}, "ts": "2023-07-07 10:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCW6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78524", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78524"}, "ts": "2023-07-07 10:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14979"}, "ts": "2023-07-07 10:05:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14979", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:05:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02363"}, "ts": "2023-07-07 10:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:05:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-07 10:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T88-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96T88-1"}, "ts": "2023-07-07 10:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2TB10", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:06:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2TB10"}, "ts": "2023-07-07 10:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:06:17 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8NAX2-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 10:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAX2-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 10:06:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NAX2-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 10:06:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3H7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:06:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3H7"}, "ts": "2023-07-07 10:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:06:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55001"}, "ts": "2023-07-07 10:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYJ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:06:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYJ8.456.456"}, "ts": "2023-07-07 10:06:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY4"}, "ts": "2023-07-07 10:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BXJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:07:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BXJ2"}, "ts": "2023-07-07 10:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75907", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:07:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75907.18.18"}, "ts": "2023-07-07 10:07:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-07 10:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7M9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z7M9"}, "ts": "2023-07-07 10:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:08:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07942"}, "ts": "2023-07-07 10:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01097", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:08:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01097"}, "ts": "2023-07-07 10:08:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q24JP5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:08:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q1RP75", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:08:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q24JP5-1"}, "ts": "2023-07-07 10:08:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q1RP75"}, "ts": "2023-07-07 10:08:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33333695", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:08:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33333695", "type": "PubMed"}, "ts": "2023-07-07 10:08:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63142"}, "ts": "2023-07-07 10:08:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66H07-1"}, "ts": "2023-07-07 10:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66H07-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02549", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02549"}, "ts": "2023-07-07 10:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01432", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:09:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01432"}, "ts": "2023-07-07 10:09:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19460345", "type": "PubMed"}, "ts": "2023-07-07 10:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19460345", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:09:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15303"}, "ts": "2023-07-07 10:09:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:09:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30213871", "type": "PubMed"}, "ts": "2023-07-07 10:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30213871", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30213871", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 10:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:10:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61335", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:10:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61335"}, "ts": "2023-07-07 10:10:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:10:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-07 10:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CZ29", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:11:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CZ29"}, "ts": "2023-07-07 10:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:11:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXA5"}, "ts": "2023-07-07 10:11:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19958IL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:11:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11047-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:11:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047-1.1038.1038"}, "ts": "2023-07-07 10:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14545", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:11:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14545.415.415"}, "ts": "2023-07-07 10:11:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:11:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55492KC"}, "ts": "2023-07-07 10:11:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55492KC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:11:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2K5.330.330"}, "ts": "2023-07-07 10:11:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31949", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:12:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VF55-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:13:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VF55-1"}, "ts": "2023-07-07 10:13:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94983", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:13:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53365", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:13:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94983.267.267"}, "ts": "2023-07-07 10:13:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53365"}, "ts": "2023-07-07 10:13:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19203SG"}, "ts": "2023-07-07 10:14:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 10:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14142", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 10:14:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q14142", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 10:14:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 10:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:15:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-07 10:15:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0C7"}, "ts": "2023-07-07 10:15:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:15:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRA2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:15:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63538"}, "ts": "2023-07-07 10:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63538", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34019948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:15:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34019948", "type": "PubMed"}, "ts": "2023-07-07 10:15:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O55186"}, "ts": "2023-07-07 10:15:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRA2-1"}, "ts": "2023-07-07 10:15:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:16:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMS0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:16:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMS0"}, "ts": "2023-07-07 10:16:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-07 10:16:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PF18", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:16:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PF18"}, "ts": "2023-07-07 10:16:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01127"}, "ts": "2023-07-07 10:17:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PV0"}, "ts": "2023-07-07 10:17:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:17:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTP6.685.685"}, "ts": "2023-07-07 10:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTP6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:17:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:17:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PV0"}, "ts": "2023-07-07 10:17:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JMB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:17:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JMB8"}, "ts": "2023-07-07 10:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLZ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:17:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JLZ8.101.101"}, "ts": "2023-07-07 10:17:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O35379.290.290"}, "ts": "2023-07-07 10:17:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35379", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:17:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCC9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:18:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCC9"}, "ts": "2023-07-07 10:18:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18630941", "type": "PubMed"}, "ts": "2023-07-07 10:18:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18630941", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:18:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UMR7.209.209"}, "ts": "2023-07-07 10:18:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMR7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:18:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP95"}, "ts": "2023-07-07 10:18:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24718924", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:18:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24718924", "type": "PubMed"}, "ts": "2023-07-07 10:18:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "media", "message": "page access"}, "ts": "2023-07-07 10:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92886-1"}, "ts": "2023-07-07 10:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92886-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:18:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95292", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:19:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95292"}, "ts": "2023-07-07 10:19:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-07 10:19:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11679NT"}, "ts": "2023-07-07 10:19:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11679NT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:19:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ20", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ20"}, "ts": "2023-07-07 10:19:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88374WZ"}, "ts": "2023-07-07 10:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34484180", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:20:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34484180", "type": "PubMed"}, "ts": "2023-07-07 10:20:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:20:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS1"}, "ts": "2023-07-07 10:20:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09429.210.210"}, "ts": "2023-07-07 10:20:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09429", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQN0-1"}, "ts": "2023-07-07 10:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQN0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43007", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:20:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20333", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:20:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20333"}, "ts": "2023-07-07 10:20:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43252"}, "ts": "2023-07-07 10:21:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10497253", "type": "PubMed"}, "ts": "2023-07-07 10:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10497253", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:21:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08357"}, "ts": "2023-07-07 10:21:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 10:21:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43121"}, "ts": "2023-07-07 10:21:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AY94"}, "ts": "2023-07-07 10:22:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AY94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:22:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9169149", "type": "PubMed"}, "ts": "2023-07-07 10:22:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9169149", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-07 10:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P260", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:22:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P260"}, "ts": "2023-07-07 10:22:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYM2"}, "ts": "2023-07-07 10:22:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYM2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:23:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:23:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86Y56"}, "ts": "2023-07-07 10:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:23:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86Y56"}, "ts": "2023-07-07 10:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:23:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:23:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50443", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:23:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50443.75.75"}, "ts": "2023-07-07 10:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54253", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:24:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54253"}, "ts": "2023-07-07 10:24:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51884.235.235"}, "ts": "2023-07-07 10:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51884", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:24:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74270QR"}, "ts": "2023-07-07 10:24:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07339"}, "ts": "2023-07-07 10:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07339", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z1Z6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:24:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z1Z6-1"}, "ts": "2023-07-07 10:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33859776", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:24:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33859776", "type": "PubMed"}, "ts": "2023-07-07 10:24:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-07 10:24:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06186"}, "ts": "2023-07-07 10:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7760831", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:25:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7760831", "type": "PubMed"}, "ts": "2023-07-07 10:25:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T6X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:25:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T6X5"}, "ts": "2023-07-07 10:25:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-07 10:25:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L58"}, "ts": "2023-07-07 10:25:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L58"}, "ts": "2023-07-07 10:25:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMX9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:26:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UMX9"}, "ts": "2023-07-07 10:26:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15389"}, "ts": "2023-07-07 10:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15389", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:26:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LRE5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:26:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LRE5-1"}, "ts": "2023-07-07 10:26:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O09106.406.406"}, "ts": "2023-07-07 10:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09106", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:27:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:27:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15717", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15717"}, "ts": "2023-07-07 10:27:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08581"}, "ts": "2023-07-07 10:28:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IUH5.302.302"}, "ts": "2023-07-07 10:28:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUH5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:28:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18765015", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:28:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18765015", "type": "PubMed"}, "ts": "2023-07-07 10:28:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33903257", "type": "PubMed"}, "ts": "2023-07-07 10:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33903257", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZID3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:28:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZID3-1"}, "ts": "2023-07-07 10:28:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:28:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-07 10:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:28:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43915", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:29:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43915"}, "ts": "2023-07-07 10:29:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:29:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30059200", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:29:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30059200", "type": "PubMed"}, "ts": "2023-07-07 10:29:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29351928", "type": "PubMed"}, "ts": "2023-07-07 10:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:29:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29351928", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:29:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-07 10:29:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40225"}, "ts": "2023-07-07 10:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:29:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00418"}, "ts": "2023-07-07 10:29:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:29:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31492838", "type": "PubMed"}, "ts": "2023-07-07 10:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31492838", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEM7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:29:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEM7"}, "ts": "2023-07-07 10:29:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:29:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TCD5"}, "ts": "2023-07-07 10:29:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRI4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRI4-1"}, "ts": "2023-07-07 10:29:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQ01-1"}, "ts": "2023-07-07 10:30:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQ01-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:30:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLR1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:30:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLR1-1"}, "ts": "2023-07-07 10:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19203SG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:30:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08190JB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:30:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08190JB"}, "ts": "2023-07-07 10:30:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920E0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920E0"}, "ts": "2023-07-07 10:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58004", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:30:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58004"}, "ts": "2023-07-07 10:30:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00612-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:30:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00612-1"}, "ts": "2023-07-07 10:30:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14829"}, "ts": "2023-07-07 10:30:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KM07-1"}, "ts": "2023-07-07 10:30:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KM07-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14829", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:30:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50850NI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:31:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50850NI"}, "ts": "2023-07-07 10:31:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9853615", "type": "PubMed"}, "ts": "2023-07-07 10:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9853615", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:31:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O55186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:31:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98007XA"}, "ts": "2023-07-07 10:31:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98007XA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:32:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIX4"}, "ts": "2023-07-07 10:32:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17447891", "type": "PubMed"}, "ts": "2023-07-07 10:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17447891", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:32:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-07 10:32:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N895", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:32:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N895.284.284"}, "ts": "2023-07-07 10:32:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50453-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:33:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50453-1"}, "ts": "2023-07-07 10:33:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:33:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-07 10:33:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:33:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4KMQ2.909.909"}, "ts": "2023-07-07 10:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMQ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:34:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:34:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VC31"}, "ts": "2023-07-07 10:34:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2R6"}, "ts": "2023-07-07 10:34:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2R6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:34:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGJ2.283.283"}, "ts": "2023-07-07 10:34:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C6E0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:34:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C6E0-1"}, "ts": "2023-07-07 10:34:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91413ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17858", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:35:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17858.130.130"}, "ts": "2023-07-07 10:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23007646", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G88374WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:35:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23007646", "type": "PubMed"}, "ts": "2023-07-07 10:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NKN8-1"}, "ts": "2023-07-07 10:36:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NKN8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:36:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98544EX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:36:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98544EX"}, "ts": "2023-07-07 10:36:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60415BS"}, "ts": "2023-07-07 10:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60415BS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:37:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:37:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.3090.3090"}, "ts": "2023-07-07 10:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43252", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:37:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08357", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22310AV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:37:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:37:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451"}, "ts": "2023-07-07 10:37:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z3T1"}, "ts": "2023-07-07 10:38:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z3T1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96B86", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96B86"}, "ts": "2023-07-07 10:38:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37166HP"}, "ts": "2023-07-07 10:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37166HP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:39:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZM3.239.239"}, "ts": "2023-07-07 10:39:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZU90-1"}, "ts": "2023-07-07 10:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZU90-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15735", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:40:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15735.13.13"}, "ts": "2023-07-07 10:40:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q76LX8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64394MX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q76LX8"}, "ts": "2023-07-07 10:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQT4"}, "ts": "2023-07-07 10:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQT4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:41:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50294", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:41:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06787.370.370"}, "ts": "2023-07-07 10:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06787", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:41:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63381RX"}, "ts": "2023-07-07 10:41:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75037"}, "ts": "2023-07-07 10:42:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 10:42:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-07 10:42:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62314"}, "ts": "2023-07-07 10:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62314", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96E11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:42:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96E11"}, "ts": "2023-07-07 10:42:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45120SG"}, "ts": "2023-07-07 10:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45120SG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:43:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10767429", "type": "PubMed"}, "ts": "2023-07-07 10:43:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10767429", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:43:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q04", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96Q04"}, "ts": "2023-07-07 10:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:43:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71F54-1"}, "ts": "2023-07-07 10:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71F54-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:44:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G28477UY"}, "ts": "2023-07-07 10:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G28477UY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:44:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56390QA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:44:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56390QA"}, "ts": "2023-07-07 10:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35622MN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:44:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35622MN"}, "ts": "2023-07-07 10:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHW9"}, "ts": "2023-07-07 10:45:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25466284", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:45:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25466284", "type": "PubMed"}, "ts": "2023-07-07 10:45:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88917"}, "ts": "2023-07-07 10:45:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88917", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:45:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88507"}, "ts": "2023-07-07 10:45:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99943"}, "ts": "2023-07-07 10:46:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99943", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:46:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00975"}, "ts": "2023-07-07 10:46:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:46:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:46:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35251-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35251-1"}, "ts": "2023-07-07 10:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08574", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08574"}, "ts": "2023-07-07 10:46:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94718HG"}, "ts": "2023-07-07 10:46:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94718HG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:46:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:46:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-07 10:47:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14859", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14859"}, "ts": "2023-07-07 10:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZX9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:47:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZX9-1"}, "ts": "2023-07-07 10:47:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58781JH"}, "ts": "2023-07-07 10:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58781JH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:47:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-07 10:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:48:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21572392", "type": "PubMed"}, "ts": "2023-07-07 10:48:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21572392", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:48:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98130KM"}, "ts": "2023-07-07 10:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98130KM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:48:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15291.182.182"}, "ts": "2023-07-07 10:48:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15291", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53168IY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:48:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53168IY"}, "ts": "2023-07-07 10:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13651", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:48:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13651"}, "ts": "2023-07-07 10:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:48:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RI0"}, "ts": "2023-07-07 10:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80U78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:48:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80U78"}, "ts": "2023-07-07 10:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:49:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15047"}, "ts": "2023-07-07 10:49:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:49:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5G4.130.130"}, "ts": "2023-07-07 10:49:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A8I9-1"}, "ts": "2023-07-07 10:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A8I9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16650", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:49:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16650.648.648"}, "ts": "2023-07-07 10:49:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0E0"}, "ts": "2023-07-07 10:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0E0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02094", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:50:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02094"}, "ts": "2023-07-07 10:50:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K9Q0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K9Q0-1"}, "ts": "2023-07-07 10:51:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-07 10:51:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08378"}, "ts": "2023-07-07 10:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:51:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08378", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:51:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMG0"}, "ts": "2023-07-07 10:51:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:51:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-07 10:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2X9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:51:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2X9"}, "ts": "2023-07-07 10:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:52:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18678649", "type": "PubMed"}, "ts": "2023-07-07 10:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18678649", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 10:52:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13638-1"}, "ts": "2023-07-07 10:52:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K298-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:52:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K298-1"}, "ts": "2023-07-07 10:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:52:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH90"}, "ts": "2023-07-07 10:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH90", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:52:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62781GE"}, "ts": "2023-07-07 10:52:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62781GE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:52:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51580"}, "ts": "2023-07-07 10:53:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56373", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:53:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P56373.122.122"}, "ts": "2023-07-07 10:53:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q7L6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 10:53:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q7L6"}, "ts": "2023-07-07 10:53:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWF9"}, "ts": "2023-07-07 10:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWF9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4G176-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:54:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4G176-1"}, "ts": "2023-07-07 10:54:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHB7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:54:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHB7.120.120"}, "ts": "2023-07-07 10:54:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12967.70.70"}, "ts": "2023-07-07 10:54:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12967", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:54:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGY5.293.293"}, "ts": "2023-07-07 10:56:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:56:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30919-1"}, "ts": "2023-07-07 10:56:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30919-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:56:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01937VC"}, "ts": "2023-07-07 10:57:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01937VC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 10:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:58:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23919"}, "ts": "2023-07-07 10:58:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0DJD0.1373.1373"}, "ts": "2023-07-07 10:58:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DJD0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:58:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14682.135.135"}, "ts": "2023-07-07 10:58:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14682", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 10:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01955", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:58:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01955"}, "ts": "2023-07-07 10:58:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13491"}, "ts": "2023-07-07 10:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13491", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UDY2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 10:59:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UDY2"}, "ts": "2023-07-07 10:59:49 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 11:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 11:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 11:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 11:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 11:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 11:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:00:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4KMQ2"}, "ts": "2023-07-07 11:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4KMQ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:00:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14686"}, "ts": "2023-07-07 11:00:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29508"}, "ts": "2023-07-07 11:00:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25110"}, "ts": "2023-07-07 11:00:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25110", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15204", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:01:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15204"}, "ts": "2023-07-07 11:01:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFU8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 11:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30040", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30040"}, "ts": "2023-07-07 11:01:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFU8"}, "ts": "2023-07-07 11:01:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02765", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02765"}, "ts": "2023-07-07 11:01:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06213"}, "ts": "2023-07-07 11:02:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZR58"}, "ts": "2023-07-07 11:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZR58", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:02:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15342"}, "ts": "2023-07-07 11:03:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15342", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:03:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFZ8"}, "ts": "2023-07-07 11:04:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFZ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6H6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:04:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6H6"}, "ts": "2023-07-07 11:04:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40238"}, "ts": "2023-07-07 11:04:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AGT5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:04:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AGT5"}, "ts": "2023-07-07 11:04:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:04:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPD5"}, "ts": "2023-07-07 11:04:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14958", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14958"}, "ts": "2023-07-07 11:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RCE6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:06:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RCE6-1"}, "ts": "2023-07-07 11:06:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35225"}, "ts": "2023-07-07 11:06:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:06:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60603"}, "ts": "2023-07-07 11:07:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96881RJ"}, "ts": "2023-07-07 11:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13638-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:08:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92804", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 11:08:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92804", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 11:08:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:08:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51580", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:09:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53680"}, "ts": "2023-07-07 11:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80V53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:09:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80V53"}, "ts": "2023-07-07 11:10:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00311MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:11:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00311MF"}, "ts": "2023-07-07 11:11:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:11:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80370"}, "ts": "2023-07-07 11:11:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80370", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:11:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6X2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LVQ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:12:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LVQ8-1"}, "ts": "2023-07-07 11:12:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-07 11:12:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:12:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T9"}, "ts": "2023-07-07 11:12:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZFG7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:12:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZFG7-1"}, "ts": "2023-07-07 11:12:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62799.684.684"}, "ts": "2023-07-07 11:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62799", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:13:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E2RYF6"}, "ts": "2023-07-07 11:13:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E2RYF6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:13:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R5C8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:14:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R5C8-1"}, "ts": "2023-07-07 11:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R8J8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:14:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R8J8-1"}, "ts": "2023-07-07 11:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33934099", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:14:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33934099", "type": "PubMed"}, "ts": "2023-07-07 11:14:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7RTP6.1143.1143"}, "ts": "2023-07-07 11:15:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14686", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:16:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29508", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:16:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9792798", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:17:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9792798", "type": "PubMed"}, "ts": "2023-07-07 11:17:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15391", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:17:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:17:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15391"}, "ts": "2023-07-07 11:17:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLR9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:18:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLR9-1"}, "ts": "2023-07-07 11:18:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:18:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-07 11:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:18:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06356OH"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13694XX"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31665QC"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34617SM"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57888GL"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62461SM"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74728JK"}, "ts": "2023-07-07 11:19:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-07 11:19:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82830MN"}, "ts": "2023-07-07 11:19:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-07 11:19:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:19:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-07 11:19:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UJY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:19:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UJY5"}, "ts": "2023-07-07 11:19:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07306-1"}, "ts": "2023-07-07 11:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07306-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:20:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O35949", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 11:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 11:20:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35949", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 11:20:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6YBV0"}, "ts": "2023-07-07 11:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YBV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:20:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LI76"}, "ts": "2023-07-07 11:20:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LI76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:20:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7512983", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:20:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7512983", "type": "PubMed"}, "ts": "2023-07-07 11:20:53 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 11:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 11:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 11:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62804-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:21:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62804-1"}, "ts": "2023-07-07 11:21:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46013"}, "ts": "2023-07-07 11:21:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTZ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:22:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTZ2"}, "ts": "2023-07-07 11:22:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47203JO"}, "ts": "2023-07-07 11:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G47203JO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSE5"}, "ts": "2023-07-07 11:22:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:23:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62853-1"}, "ts": "2023-07-07 11:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62853-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:23:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:23:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXF7"}, "ts": "2023-07-07 11:23:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B4F7E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B4F7E7"}, "ts": "2023-07-07 11:24:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14784", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:25:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14784.536.536"}, "ts": "2023-07-07 11:25:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:25:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTM1"}, "ts": "2023-07-07 11:25:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SY16", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:25:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SY16"}, "ts": "2023-07-07 11:25:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4FZB7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:26:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4FZB7"}, "ts": "2023-07-07 11:26:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01085"}, "ts": "2023-07-07 11:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01085", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:26:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11766", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:27:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11766.369.369"}, "ts": "2023-07-07 11:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:27:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:28:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15053"}, "ts": "2023-07-07 11:28:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15053", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:28:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99741"}, "ts": "2023-07-07 11:28:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99741", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:29:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35461GE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:29:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35461GE"}, "ts": "2023-07-07 11:29:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D1F6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:29:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4D1F6"}, "ts": "2023-07-07 11:29:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38484.219.219"}, "ts": "2023-07-07 11:29:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38484", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:29:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05107"}, "ts": "2023-07-07 11:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89110", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:29:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O89110.188.188"}, "ts": "2023-07-07 11:29:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60882"}, "ts": "2023-07-07 11:29:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK65"}, "ts": "2023-07-07 11:29:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:29:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01042-1"}, "ts": "2023-07-07 11:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62986-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:31:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62986-1"}, "ts": "2023-07-07 11:31:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29144"}, "ts": "2023-07-07 11:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R053", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:31:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R053"}, "ts": "2023-07-07 11:31:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:31:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92673"}, "ts": "2023-07-07 11:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92673", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92954", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:32:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92954.123.123"}, "ts": "2023-07-07 11:32:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83582BK"}, "ts": "2023-07-07 11:33:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G83582BK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:33:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:34:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84103", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:34:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P84103.105.105"}, "ts": "2023-07-07 11:34:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UD1-1"}, "ts": "2023-07-07 11:34:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UD1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KRD0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:35:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KRD0-1"}, "ts": "2023-07-07 11:35:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75390", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:35:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-07 11:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DJD3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:35:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DJD3-1"}, "ts": "2023-07-07 11:35:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4I2"}, "ts": "2023-07-07 11:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4I2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:36:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:36:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCD5.454.454"}, "ts": "2023-07-07 11:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63074-1"}, "ts": "2023-07-07 11:37:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63074-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:37:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDA6-1"}, "ts": "2023-07-07 11:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDA6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:37:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86TP1"}, "ts": "2023-07-07 11:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:37:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZEM3-1"}, "ts": "2023-07-07 11:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZEM3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:37:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00945TF"}, "ts": "2023-07-07 11:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00945TF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:37:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15121"}, "ts": "2023-07-07 11:38:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62853-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:38:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62853-1"}, "ts": "2023-07-07 11:38:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75789AR"}, "ts": "2023-07-07 11:38:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75789AR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:38:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05635CX"}, "ts": "2023-07-07 11:38:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05635CX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:38:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21665001", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:38:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21665001", "type": "PubMed"}, "ts": "2023-07-07 11:38:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-07 11:39:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZE80-1"}, "ts": "2023-07-07 11:39:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZE80-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:39:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VDD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:40:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VDD5"}, "ts": "2023-07-07 11:40:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14056-1"}, "ts": "2023-07-07 11:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14056-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:41:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14561.4.4"}, "ts": "2023-07-07 11:41:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14561", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:41:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16512", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:42:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16512"}, "ts": "2023-07-07 11:42:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23664119", "type": "PubMed"}, "ts": "2023-07-07 11:42:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23664119", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:42:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NS75"}, "ts": "2023-07-07 11:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS75", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:42:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01643LM"}, "ts": "2023-07-07 11:42:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01643LM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:42:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-07 11:43:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-07 11:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycoprotein_list.html", "message": "page access"}, "ts": "2023-07-07 11:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IY22", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:44:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IY22.349.349"}, "ts": "2023-07-07 11:44:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23434"}, "ts": "2023-07-07 11:44:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:44:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14494"}, "ts": "2023-07-07 11:44:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14494", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:44:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 11:44:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXX7.1233.1233"}, "ts": "2023-07-07 11:44:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30379171", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:44:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30379171", "type": "PubMed"}, "ts": "2023-07-07 11:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28625484", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:44:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28625484", "type": "PubMed"}, "ts": "2023-07-07 11:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05107", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:45:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:45:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI7"}, "ts": "2023-07-07 11:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60882", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:45:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01876-1"}, "ts": "2023-07-07 11:45:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01222"}, "ts": "2023-07-07 11:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6N6"}, "ts": "2023-07-07 11:46:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06400", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:46:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06400.397.397"}, "ts": "2023-07-07 11:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02029PW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:46:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02029PW"}, "ts": "2023-07-07 11:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01042-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:47:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14626"}, "ts": "2023-07-07 11:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:47:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0K1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:48:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0K1"}, "ts": "2023-07-07 11:48:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23864HZ"}, "ts": "2023-07-07 11:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23864HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:48:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15164"}, "ts": "2023-07-07 11:49:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15164", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:49:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13137", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:49:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13137"}, "ts": "2023-07-07 11:49:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C6B3-1"}, "ts": "2023-07-07 11:49:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C6B3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:49:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDL9"}, "ts": "2023-07-07 11:49:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXT0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:50:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXT0-1"}, "ts": "2023-07-07 11:50:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9103523", "type": "PubMed"}, "ts": "2023-07-07 11:50:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9103523", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:50:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07225"}, "ts": "2023-07-07 11:51:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69411IG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43567"}, "ts": "2023-07-07 11:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43567", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NW68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:51:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NW68"}, "ts": "2023-07-07 11:51:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND24-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:51:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND24-1"}, "ts": "2023-07-07 11:51:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43426"}, "ts": "2023-07-07 11:53:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:53:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86VP3.414.414"}, "ts": "2023-07-07 11:53:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VP3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:53:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:54:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22728658", "type": "PubMed"}, "ts": "2023-07-07 11:54:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22728658", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 11:54:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07089VQ"}, "ts": "2023-07-07 11:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07089VQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 11:54:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:54:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98215MN"}, "ts": "2023-07-07 11:54:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6R7-1"}, "ts": "2023-07-07 11:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:55:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:55:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21581"}, "ts": "2023-07-07 11:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RRU4-1"}, "ts": "2023-07-07 11:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RRU4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48200", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 11:55:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48200.368.368"}, "ts": "2023-07-07 11:55:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06493-1"}, "ts": "2023-07-07 11:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43234", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43234"}, "ts": "2023-07-07 11:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:56:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19652"}, "ts": "2023-07-07 11:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 11:57:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8JZR6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 11:57:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8JZR6"}, "ts": "2023-07-07 11:57:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08F94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:58:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08F94"}, "ts": "2023-07-07 11:58:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02766"}, "ts": "2023-07-07 11:59:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:59:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZ42"}, "ts": "2023-07-07 11:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23434", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 11:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 12:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 12:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 12:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 12:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 12:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 12:00:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96991ZR"}, "ts": "2023-07-07 12:00:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96991ZR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:00:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35372"}, "ts": "2023-07-07 12:00:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35372", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80318", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:00:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80318"}, "ts": "2023-07-07 12:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0N0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:00:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0N0"}, "ts": "2023-07-07 12:00:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3Z9L0-1"}, "ts": "2023-07-07 12:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3Z9L0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NKN8-1"}, "ts": "2023-07-07 12:00:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08721"}, "ts": "2023-07-07 12:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NKN8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:00:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-07 12:00:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20388707", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:00:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20388707", "type": "PubMed"}, "ts": "2023-07-07 12:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05121"}, "ts": "2023-07-07 12:01:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G68915EJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:01:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68915EJ"}, "ts": "2023-07-07 12:01:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:01:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 12:01:49 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 12:01:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 12:01:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQ38-1"}, "ts": "2023-07-07 12:01:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQ38-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14624"}, "ts": "2023-07-07 12:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14624", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:02:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18197EH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:02:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18197EH"}, "ts": "2023-07-07 12:02:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:02:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50749"}, "ts": "2023-07-07 12:02:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:02:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0B8"}, "ts": "2023-07-07 12:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0B8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55263", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:03:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55263"}, "ts": "2023-07-07 12:03:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23567335", "type": "PubMed"}, "ts": "2023-07-07 12:03:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23567335", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:03:20 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-07 12:03:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 12:03:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-07 12:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40261"}, "ts": "2023-07-07 12:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40261", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:04:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02152", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:04:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02152"}, "ts": "2023-07-07 12:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JY65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:04:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JY65"}, "ts": "2023-07-07 12:04:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75882", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:04:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43688", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:04:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43688"}, "ts": "2023-07-07 12:04:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75882"}, "ts": "2023-07-07 12:04:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7M729", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:05:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7M729"}, "ts": "2023-07-07 12:05:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54766"}, "ts": "2023-07-07 12:05:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47196"}, "ts": "2023-07-07 12:05:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q68DV7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:05:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q68DV7"}, "ts": "2023-07-07 12:05:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R5V1-1"}, "ts": "2023-07-07 12:06:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R5V1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:06:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-07 12:06:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55196-4"}, "ts": "2023-07-07 12:06:08 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-07 12:06:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07538NX"}, "ts": "2023-07-07 12:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07538NX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14639", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:06:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14639"}, "ts": "2023-07-07 12:06:15 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 9}, "ts": "2023-07-07 12:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">9", "user": "Anonymous", "type": "user", "page": "blast", "message": "Blast Search query=9"}, "ts": "2023-07-07 12:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-07 12:06:18 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 9}, "ts": "2023-07-07 12:06:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P30613-1, P53657-1, P12928-1, P52480-1, P14618-1, P11980-1, M0RD14-1, A0A8I6AKN1-1, A0A8I6A7K2-1, A0A8I6G3S8-1, A0A8I6A0X1-1, O62619-1, A0A8I5ZL95-1, Q9VQH0-1"}, "ts": "2023-07-07 12:06:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-07 12:06:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y450"}, "ts": "2023-07-07 12:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y450", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:06:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00238"}, "ts": "2023-07-07 12:06:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00238", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:06:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08173"}, "ts": "2023-07-07 12:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R907-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:07:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R907-1"}, "ts": "2023-07-07 12:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q684R7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:07:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q684R7"}, "ts": "2023-07-07 12:07:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPT5"}, "ts": "2023-07-07 12:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPT5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30613-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:07:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30613-1"}, "ts": "2023-07-07 12:07:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-07 12:07:42 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 9}, "ts": "2023-07-07 12:07:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8679605", "type": "PubMed"}, "ts": "2023-07-07 12:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P30613-1, P53657-1, P12928-1, P52480-1, P14618-1, P11980-1, M0RD14-1, A0A8I6AKN1-1, A0A8I6A7K2-1, A0A8I6G3S8-1, A0A8I6A0X1-1, O62619-1, A0A8I5ZL95-1, Q9VQH0-1"}, "ts": "2023-07-07 12:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8679605", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:07:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06330"}, "ts": "2023-07-07 12:07:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32M45", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:07:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q32M45.257.257"}, "ts": "2023-07-07 12:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63142", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:08:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63142"}, "ts": "2023-07-07 12:08:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JUI1-1"}, "ts": "2023-07-07 12:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JUI1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:08:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69032HY"}, "ts": "2023-07-07 12:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15596", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:08:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15596"}, "ts": "2023-07-07 12:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P83565-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:08:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P83565-1"}, "ts": "2023-07-07 12:08:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:09:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11896WX"}, "ts": "2023-07-07 12:09:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11896WX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:09:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03518", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:09:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03518"}, "ts": "2023-07-07 12:09:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06594DV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:09:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06594DV"}, "ts": "2023-07-07 12:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12872"}, "ts": "2023-07-07 12:09:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12872", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:09:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75NE6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75NE6-1"}, "ts": "2023-07-07 12:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9J8-1"}, "ts": "2023-07-07 12:10:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9J8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:10:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R1T1.232.232"}, "ts": "2023-07-07 12:10:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1T1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15529", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:10:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15529"}, "ts": "2023-07-07 12:10:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-07 12:10:37 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-07 12:10:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06401", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:10:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06401.81.81"}, "ts": "2023-07-07 12:10:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZ58-1"}, "ts": "2023-07-07 12:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZ58-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:10:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RYU8-1"}, "ts": "2023-07-07 12:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RYU8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AY3"}, "ts": "2023-07-07 12:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2E3"}, "ts": "2023-07-07 12:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2E3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R5R6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R5R6-1"}, "ts": "2023-07-07 12:11:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18827-1"}, "ts": "2023-07-07 12:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18827-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-07 12:11:55 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "protein", "input_namespace": "GeneCards", "output_namespace": "UniProtKB", "input_idlist": ["ALG1"]}, "ts": "2023-07-07 12:11:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06493-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7ea156b42bd5b057029531c6e14fc6a2", "user": "Anonymous", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"protein\",\"input_namespace\":\"GeneCards\",\"output_namespace\":\"UniProtKB\",\"input_idlist\":\"ALG1\"}"}, "ts": "2023-07-07 12:11:56 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "7ea156b42bd5b057029531c6e14fc6a2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 12:11:56 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "7ea156b42bd5b057029531c6e14fc6a2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 12:11:56 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "7ea156b42bd5b057029531c6e14fc6a2", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 12:11:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7ea156b42bd5b057029531c6e14fc6a2", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "7ea156b42bd5b057029531c6e14fc6a2", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57317CE"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-07 12:11:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-07 12:11:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K1M6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K1M6"}, "ts": "2023-07-07 12:11:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76001GO"}, "ts": "2023-07-07 12:12:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76001GO"}, "ts": "2023-07-07 12:12:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G54740VA"}, "ts": "2023-07-07 12:12:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G54740VA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:12:26 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 12:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 12:12:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00362UY"}, "ts": "2023-07-07 12:12:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00362UY"}, "ts": "2023-07-07 12:12:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37525EU"}, "ts": "2023-07-07 12:12:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37525EU"}, "ts": "2023-07-07 12:12:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32248"}, "ts": "2023-07-07 12:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32248", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:12:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G76325KO"}, "ts": "2023-07-07 12:12:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94917JX"}, "ts": "2023-07-07 12:13:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94917JX"}, "ts": "2023-07-07 12:13:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35879BG"}, "ts": "2023-07-07 12:13:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97432-1"}, "ts": "2023-07-07 12:13:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75311GD"}, "ts": "2023-07-07 12:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97432-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:13:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75311GD"}, "ts": "2023-07-07 12:13:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:13:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60381"}, "ts": "2023-07-07 12:13:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60381", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:13:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:13:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22478ZB"}, "ts": "2023-07-07 12:13:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22478ZB"}, "ts": "2023-07-07 12:13:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G34020II", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:13:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34020II"}, "ts": "2023-07-07 12:13:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43416JO"}, "ts": "2023-07-07 12:13:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43416JO"}, "ts": "2023-07-07 12:13:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:13:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CH1"}, "ts": "2023-07-07 12:13:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00036MO"}, "ts": "2023-07-07 12:14:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00036MO"}, "ts": "2023-07-07 12:14:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02278OY"}, "ts": "2023-07-07 12:14:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02278OY"}, "ts": "2023-07-07 12:14:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:14:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03519"}, "ts": "2023-07-07 12:14:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O89110.188.188"}, "ts": "2023-07-07 12:14:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O89110", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:14:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:14:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78431CN"}, "ts": "2023-07-07 12:14:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78431CN"}, "ts": "2023-07-07 12:15:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:15:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:15:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:15:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32601MJ"}, "ts": "2023-07-07 12:15:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32601MJ"}, "ts": "2023-07-07 12:15:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26038"}, "ts": "2023-07-07 12:15:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26275JI"}, "ts": "2023-07-07 12:15:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26275JI"}, "ts": "2023-07-07 12:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:15:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-07 12:15:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05384EB"}, "ts": "2023-07-07 12:15:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05384EB"}, "ts": "2023-07-07 12:15:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UGM5"}, "ts": "2023-07-07 12:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:15:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G24267OV"}, "ts": "2023-07-07 12:15:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000058"}, "ts": "2023-07-07 12:15:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69427EG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:15:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69427EG"}, "ts": "2023-07-07 12:15:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G46726NY"}, "ts": "2023-07-07 12:15:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46726NY"}, "ts": "2023-07-07 12:15:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-07 12:16:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36909XX"}, "ts": "2023-07-07 12:16:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36909XX"}, "ts": "2023-07-07 12:16:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47076UN"}, "ts": "2023-07-07 12:16:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47076UN"}, "ts": "2023-07-07 12:16:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G33278DK"}, "ts": "2023-07-07 12:16:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33278DK"}, "ts": "2023-07-07 12:16:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98715JA"}, "ts": "2023-07-07 12:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98715JA"}, "ts": "2023-07-07 12:16:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1Y3"}, "ts": "2023-07-07 12:16:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:16:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:16:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:16:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:16:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08721", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:16:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:16:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07011TA"}, "ts": "2023-07-07 12:16:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07011TA"}, "ts": "2023-07-07 12:16:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26237YH"}, "ts": "2023-07-07 12:17:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26237YH"}, "ts": "2023-07-07 12:17:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15807NZ"}, "ts": "2023-07-07 12:17:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15807NZ"}, "ts": "2023-07-07 12:17:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21858121", "type": "PubMed"}, "ts": "2023-07-07 12:17:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21858121", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:17:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00038MO"}, "ts": "2023-07-07 12:17:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00038MO"}, "ts": "2023-07-07 12:17:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07982LO"}, "ts": "2023-07-07 12:17:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07982LO"}, "ts": "2023-07-07 12:17:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18331QM"}, "ts": "2023-07-07 12:17:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18331QM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:17:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96643WB"}, "ts": "2023-07-07 12:17:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96643WB"}, "ts": "2023-07-07 12:17:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63132", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:17:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05121", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:17:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q63132.77.77"}, "ts": "2023-07-07 12:17:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16476DW"}, "ts": "2023-07-07 12:17:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16476DW"}, "ts": "2023-07-07 12:17:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZE00-1"}, "ts": "2023-07-07 12:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZE00-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:17:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19865CT"}, "ts": "2023-07-07 12:17:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19865CT"}, "ts": "2023-07-07 12:18:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61752HI"}, "ts": "2023-07-07 12:18:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61752HI"}, "ts": "2023-07-07 12:18:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03346FO"}, "ts": "2023-07-07 12:18:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03346FO"}, "ts": "2023-07-07 12:18:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98670RK"}, "ts": "2023-07-07 12:18:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98670RK"}, "ts": "2023-07-07 12:18:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03071KV"}, "ts": "2023-07-07 12:18:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03071KV"}, "ts": "2023-07-07 12:18:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16258KS"}, "ts": "2023-07-07 12:18:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16258KS"}, "ts": "2023-07-07 12:18:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41576FY"}, "ts": "2023-07-07 12:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ARV4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:18:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ARV4-1"}, "ts": "2023-07-07 12:18:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41576FY"}, "ts": "2023-07-07 12:19:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93507IP"}, "ts": "2023-07-07 12:19:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93507IP"}, "ts": "2023-07-07 12:19:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08962", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:19:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08962.172.172"}, "ts": "2023-07-07 12:19:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:19:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:19:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23467.598.598"}, "ts": "2023-07-07 12:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23467", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:19:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:19:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:19:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01706RV"}, "ts": "2023-07-07 12:19:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01706RV"}, "ts": "2023-07-07 12:19:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T5P2"}, "ts": "2023-07-07 12:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T5P2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:19:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07218NO"}, "ts": "2023-07-07 12:19:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07218NO"}, "ts": "2023-07-07 12:19:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:19:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:20:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q64LD2.306.306"}, "ts": "2023-07-07 12:20:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64LD2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:20:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70000DB"}, "ts": "2023-07-07 12:20:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70000DB"}, "ts": "2023-07-07 12:20:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:20:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:20:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67357EP"}, "ts": "2023-07-07 12:20:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G47863IJ"}, "ts": "2023-07-07 12:20:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G24990UB"}, "ts": "2023-07-07 12:20:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24990UB"}, "ts": "2023-07-07 12:20:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:20:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:20:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:21:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:21:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0JPJ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:21:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0JPJ7-1"}, "ts": "2023-07-07 12:21:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71222KY"}, "ts": "2023-07-07 12:21:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71222KY"}, "ts": "2023-07-07 12:21:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97054BM"}, "ts": "2023-07-07 12:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:21:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97054BM"}, "ts": "2023-07-07 12:21:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:21:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R0S5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:21:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R0S5"}, "ts": "2023-07-07 12:21:36 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23681XP"}, "ts": "2023-07-07 12:21:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:21:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:21:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56655CC"}, "ts": "2023-07-07 12:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55196-4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:21:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56655CC"}, "ts": "2023-07-07 12:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03951", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:22:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03951"}, "ts": "2023-07-07 12:22:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23023HU"}, "ts": "2023-07-07 12:22:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23023HU"}, "ts": "2023-07-07 12:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:22:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00070MO"}, "ts": "2023-07-07 12:22:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00070MO"}, "ts": "2023-07-07 12:22:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:22:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBX5"}, "ts": "2023-07-07 12:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11198FY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:22:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11198FY"}, "ts": "2023-07-07 12:22:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:22:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:22:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G86471BL"}, "ts": "2023-07-07 12:22:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86471BL"}, "ts": "2023-07-07 12:22:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98687PM"}, "ts": "2023-07-07 12:22:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98687PM"}, "ts": "2023-07-07 12:22:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G33368QU"}, "ts": "2023-07-07 12:22:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33368QU"}, "ts": "2023-07-07 12:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08173", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:23:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62421SJ"}, "ts": "2023-07-07 12:23:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18052", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:23:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18052"}, "ts": "2023-07-07 12:23:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11071853", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:23:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11071853", "type": "PubMed"}, "ts": "2023-07-07 12:23:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43818LO"}, "ts": "2023-07-07 12:23:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06547"}, "ts": "2023-07-07 12:23:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6Y1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:23:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6Y1.1577.1577"}, "ts": "2023-07-07 12:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06547", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:23:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:23:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:23:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45718WR"}, "ts": "2023-07-07 12:23:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35594BH"}, "ts": "2023-07-07 12:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06330", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:23:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63738PK"}, "ts": "2023-07-07 12:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63738PK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:23:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35594BH"}, "ts": "2023-07-07 12:23:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BKT2"}, "ts": "2023-07-07 12:23:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BKT2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:23:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48115DD"}, "ts": "2023-07-07 12:23:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48115DD"}, "ts": "2023-07-07 12:23:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-07 12:23:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:23:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:24:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07814"}, "ts": "2023-07-07 12:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07814", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:24:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G97221WN"}, "ts": "2023-07-07 12:24:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97221WN"}, "ts": "2023-07-07 12:24:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56546LQ"}, "ts": "2023-07-07 12:24:18 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56546LQ"}, "ts": "2023-07-07 12:24:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64799PD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:24:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64799PD"}, "ts": "2023-07-07 12:24:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71185WF"}, "ts": "2023-07-07 12:24:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71185WF"}, "ts": "2023-07-07 12:24:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND94"}, "ts": "2023-07-07 12:24:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-07 12:24:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:24:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:24:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69032HY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:24:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36264SN"}, "ts": "2023-07-07 12:24:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06979ME"}, "ts": "2023-07-07 12:24:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19490AF"}, "ts": "2023-07-07 12:25:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37805DA"}, "ts": "2023-07-07 12:25:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37805DA"}, "ts": "2023-07-07 12:25:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31087MR"}, "ts": "2023-07-07 12:25:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31087MR"}, "ts": "2023-07-07 12:25:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85633VC"}, "ts": "2023-07-07 12:25:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G85633VC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:25:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:25:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:25:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14514.89.89"}, "ts": "2023-07-07 12:25:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G92042VQ"}, "ts": "2023-07-07 12:25:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92042VQ"}, "ts": "2023-07-07 12:25:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:25:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:25:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94235HZ"}, "ts": "2023-07-07 12:25:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94235HZ"}, "ts": "2023-07-07 12:26:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:26:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:26:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16566"}, "ts": "2023-07-07 12:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RBH9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:26:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RBH9-1"}, "ts": "2023-07-07 12:26:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41909PZ"}, "ts": "2023-07-07 12:26:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42089IU"}, "ts": "2023-07-07 12:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41909PZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:26:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42089IU"}, "ts": "2023-07-07 12:26:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:26:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:26:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:26:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IUW5"}, "ts": "2023-07-07 12:26:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45526DW"}, "ts": "2023-07-07 12:26:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45526DW"}, "ts": "2023-07-07 12:26:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10838186", "type": "PubMed"}, "ts": "2023-07-07 12:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10838186", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH37", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:26:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NH37"}, "ts": "2023-07-07 12:26:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96568SI"}, "ts": "2023-07-07 12:26:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96568SI"}, "ts": "2023-07-07 12:26:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14188TW"}, "ts": "2023-07-07 12:26:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14188TW"}, "ts": "2023-07-07 12:27:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:27:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:27:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G92630VX"}, "ts": "2023-07-07 12:27:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92630VX"}, "ts": "2023-07-07 12:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K442", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:27:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K442"}, "ts": "2023-07-07 12:27:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:27:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:27:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:27:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G33772BZ"}, "ts": "2023-07-07 12:27:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33772BZ"}, "ts": "2023-07-07 12:27:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62833"}, "ts": "2023-07-07 12:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62833", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:27:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q792S6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:27:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q792S6"}, "ts": "2023-07-07 12:27:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G66421OE"}, "ts": "2023-07-07 12:27:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 12:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:27:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48414YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:27:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 12:27:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49174JP"}, "ts": "2023-07-07 12:27:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PU5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:27:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PU5.367.367"}, "ts": "2023-07-07 12:27:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67710XV"}, "ts": "2023-07-07 12:27:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67710XV"}, "ts": "2023-07-07 12:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30873-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:28:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30873-1"}, "ts": "2023-07-07 12:28:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87044UH"}, "ts": "2023-07-07 12:28:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87044UH"}, "ts": "2023-07-07 12:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:28:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q00613.142.142"}, "ts": "2023-07-07 12:28:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25623VL"}, "ts": "2023-07-07 12:28:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25623VL"}, "ts": "2023-07-07 12:28:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:28:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:28:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00028MO"}, "ts": "2023-07-07 12:28:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00028MO"}, "ts": "2023-07-07 12:28:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09046VD"}, "ts": "2023-07-07 12:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09046VD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:28:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:28:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:28:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:29:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:29:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D023"}, "ts": "2023-07-07 12:29:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:29:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:29:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6K0P9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 12:29:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2HXL6-1"}, "ts": "2023-07-07 12:29:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63272-1"}, "ts": "2023-07-07 12:29:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63272-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGF7"}, "ts": "2023-07-07 12:29:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGF7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q6K0P9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 12:29:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G25940DW"}, "ts": "2023-07-07 12:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2HXL6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00214", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A8MQ14", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license", "message": "page access"}, "ts": "2023-07-07 12:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A8MQ14"}, "ts": "2023-07-07 12:29:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y490", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:29:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25940DW"}, "ts": "2023-07-07 12:29:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-07 12:29:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60542VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:29:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXI9-1.273.273"}, "ts": "2023-07-07 12:29:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8T0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6K0P9", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-07 12:29:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9R001"}, "ts": "2023-07-07 12:29:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23511"}, "ts": "2023-07-07 12:29:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60542VK", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-07 12:29:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:29:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-07 12:29:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y279", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y279"}, "ts": "2023-07-07 12:29:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:29:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23819", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:29:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15743.91.91"}, "ts": "2023-07-07 12:30:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15743", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KN3"}, "ts": "2023-07-07 12:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KN3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:30:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96017QA"}, "ts": "2023-07-07 12:30:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96017QA"}, "ts": "2023-07-07 12:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D2Y5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:30:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D2Y5"}, "ts": "2023-07-07 12:30:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08424"}, "ts": "2023-07-07 12:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08424", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:30:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV91", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:30:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WV91.300.300"}, "ts": "2023-07-07 12:30:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:30:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07835SR"}, "ts": "2023-07-07 12:30:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13523", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:30:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13523"}, "ts": "2023-07-07 12:30:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53723XK"}, "ts": "2023-07-07 12:31:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53723XK"}, "ts": "2023-07-07 12:31:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00053MO"}, "ts": "2023-07-07 12:31:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94468TS"}, "ts": "2023-07-07 12:31:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94468TS"}, "ts": "2023-07-07 12:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26150FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:31:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26150FI"}, "ts": "2023-07-07 12:31:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62421SJ"}, "ts": "2023-07-07 12:31:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26038", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:31:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14511641", "type": "PubMed"}, "ts": "2023-07-07 12:31:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14511641", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:31:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19375AT"}, "ts": "2023-07-07 12:31:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04350"}, "ts": "2023-07-07 12:31:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:31:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19375AT"}, "ts": "2023-07-07 12:31:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09057YJ"}, "ts": "2023-07-07 12:31:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09057YJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:31:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49247"}, "ts": "2023-07-07 12:31:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G24760XQ"}, "ts": "2023-07-07 12:31:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24760XQ"}, "ts": "2023-07-07 12:31:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:31:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90099GV"}, "ts": "2023-07-07 12:31:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90099GV"}, "ts": "2023-07-07 12:31:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00012MO"}, "ts": "2023-07-07 12:32:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99312NX"}, "ts": "2023-07-07 12:32:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99312NX"}, "ts": "2023-07-07 12:32:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:32:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8999839", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:32:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8999839", "type": "PubMed"}, "ts": "2023-07-07 12:32:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50638US"}, "ts": "2023-07-07 12:32:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50638US"}, "ts": "2023-07-07 12:32:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:32:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:32:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G80552MJ"}, "ts": "2023-07-07 12:32:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80552MJ"}, "ts": "2023-07-07 12:32:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60664.265.265"}, "ts": "2023-07-07 12:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:32:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38695WE"}, "ts": "2023-07-07 12:32:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38695WE"}, "ts": "2023-07-07 12:32:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:33:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QE4"}, "ts": "2023-07-07 12:33:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87528ZH"}, "ts": "2023-07-07 12:33:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87528ZH"}, "ts": "2023-07-07 12:33:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G52966FX"}, "ts": "2023-07-07 12:33:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52966FX"}, "ts": "2023-07-07 12:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99393DF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:33:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99393DF"}, "ts": "2023-07-07 12:33:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77276AJ"}, "ts": "2023-07-07 12:33:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77276AJ"}, "ts": "2023-07-07 12:33:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50297NI"}, "ts": "2023-07-07 12:33:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50297NI"}, "ts": "2023-07-07 12:33:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:33:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22732RT"}, "ts": "2023-07-07 12:33:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22732RT"}, "ts": "2023-07-07 12:33:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:34:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:34:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26361-1"}, "ts": "2023-07-07 12:34:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26361-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:34:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G34234AZ"}, "ts": "2023-07-07 12:34:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34234AZ"}, "ts": "2023-07-07 12:34:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:34:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU1"}, "ts": "2023-07-07 12:34:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70696OG"}, "ts": "2023-07-07 12:34:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70696OG"}, "ts": "2023-07-07 12:34:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08892TX"}, "ts": "2023-07-07 12:34:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04690JX"}, "ts": "2023-07-07 12:34:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04690JX"}, "ts": "2023-07-07 12:34:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57284NN"}, "ts": "2023-07-07 12:34:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57284NN"}, "ts": "2023-07-07 12:34:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01002UX"}, "ts": "2023-07-07 12:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-07 12:34:56 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-07 12:34:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01002UX"}, "ts": "2023-07-07 12:34:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:35:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23499554", "type": "PubMed"}, "ts": "2023-07-07 12:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23499554", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:35:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:35:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19841IT"}, "ts": "2023-07-07 12:35:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19841IT"}, "ts": "2023-07-07 12:35:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 12:35:20 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 12:35:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87205VF"}, "ts": "2023-07-07 12:35:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87205VF"}, "ts": "2023-07-07 12:35:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9115179", "type": "PubMed"}, "ts": "2023-07-07 12:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9115179", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:35:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZM05-1"}, "ts": "2023-07-07 12:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZM05-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:35:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08380SA"}, "ts": "2023-07-07 12:35:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CYA6"}, "ts": "2023-07-07 12:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 12:35:38 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "organism": {"organism_list": [{"name": "Homo sapiens", "id": 9606}], "annotation_category": "", "operation": "or"}}, "ts": "2023-07-07 12:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CYA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:35:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08380SA"}, "ts": "2023-07-07 12:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">82ff33c24895a862a754e479fbf75eb4", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"organism\":{\"organism_list\":[{\"name\":\"Homo sapiens\",\"id\":9606}],\"annotation_category\":\"\",\"operation\":\"or\"}}"}, "ts": "2023-07-07 12:35:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "82ff33c24895a862a754e479fbf75eb4", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 12:35:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "82ff33c24895a862a754e479fbf75eb4", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 12:35:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36191CD"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55220VL"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80966KZ"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86357DX"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25520XG"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63889NK"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80858MF"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91365ZQ"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94531EZ"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82348BZ"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45359RY"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11041DA"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91413ZX"}, "ts": "2023-07-07 12:35:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71467EA"}, "ts": "2023-07-07 12:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71467EA"}, "ts": "2023-07-07 12:35:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G83546KK"}, "ts": "2023-07-07 12:35:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83546KK"}, "ts": "2023-07-07 12:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13639-1"}, "ts": "2023-07-07 12:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64240"}, "ts": "2023-07-07 12:36:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G16274HY"}, "ts": "2023-07-07 12:36:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16274HY"}, "ts": "2023-07-07 12:36:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:36:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 12:36:21 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NYP7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 12:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYP7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 12:36:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G30056KC"}, "ts": "2023-07-07 12:36:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30056KC"}, "ts": "2023-07-07 12:36:30 EDT-0400"}, {"api": "/data/list_download/", "req": {"id": "82ff33c24895a862a754e479fbf75eb4", "download_type": "glycan_list", "format": "csv", "compressed": false, "filters": []}, "ts": "2023-07-07 12:36:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "82ff33c24895a862a754e479fbf75eb4", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "csv"}, "ts": "2023-07-07 12:36:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84273ZH"}, "ts": "2023-07-07 12:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84273ZH"}, "ts": "2023-07-07 12:36:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10158SF"}, "ts": "2023-07-07 12:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10158SF"}, "ts": "2023-07-07 12:36:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:36:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:36:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-07 12:36:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22566WO"}, "ts": "2023-07-07 12:37:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22566WO"}, "ts": "2023-07-07 12:37:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67828VR"}, "ts": "2023-07-07 12:37:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67828VR"}, "ts": "2023-07-07 12:37:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:37:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:37:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38310GJ"}, "ts": "2023-07-07 12:37:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38310GJ"}, "ts": "2023-07-07 12:37:35 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-07 12:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-07 12:37:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:37:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-07 12:37:52 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Compound", "input_idlist": ["G55220VL", "G80966KZ", "G84467IZ", "G17689DH", "G86357DX", "G29857RC", "G56749GV", "G25520XG", "G63889NK", "G80858MF", "G91365ZQ"]}, "ts": "2023-07-07 12:37:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77409CT"}, "ts": "2023-07-07 12:37:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c029383eab0497202cdb40ac7869d351", "user": "Anonymous", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"G55220VL,G80966KZ,G84467IZ,G17689DH,G86357DX,G29857RC,G56749GV,G25520XG,G63889NK,G80858MF,G91365ZQ\"}"}, "ts": "2023-07-07 12:37:52 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 12:37:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 12:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-07 12:37:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 12:37:53 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 12:37:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42227"}, "ts": "2023-07-07 12:38:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53625EJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:38:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53625EJ"}, "ts": "2023-07-07 12:38:15 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-07 12:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-07 12:38:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZWI4-1"}, "ts": "2023-07-07 12:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZWI4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:38:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78929WE"}, "ts": "2023-07-07 12:38:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78929WE"}, "ts": "2023-07-07 12:38:29 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "GlyConnect", "input_idlist": ["G55220VL", "G80966KZ", "G84467IZ", "G17689DH", "G86357DX", "G29857RC", "G56749GV", "G25520XG", "G63889NK", "G80858MF", "G91365ZQ"]}, "ts": "2023-07-07 12:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-07 12:38:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c029383eab0497202cdb40ac7869d351", "user": "Anonymous", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"GlyConnect\",\"input_idlist\":\"G55220VL,G80966KZ,G84467IZ,G17689DH,G86357DX,G29857RC,G56749GV,G25520XG,G63889NK,G80858MF,G91365ZQ\"}"}, "ts": "2023-07-07 12:38:34 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 12:38:35 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 12:38:35 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 12:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-07 12:38:35 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "c029383eab0497202cdb40ac7869d351", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 12:38:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06755AP"}, "ts": "2023-07-07 12:38:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06755AP"}, "ts": "2023-07-07 12:38:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:38:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68806LA"}, "ts": "2023-07-07 12:39:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68806LA"}, "ts": "2023-07-07 12:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 12:39:09 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 12:39:09 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-07 12:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 12:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 12:39:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G21971UP"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81459MV"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29255IL"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93822DY"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64132UH"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626XQ"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24005JZ"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67393WG"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72956NR"}, "ts": "2023-07-07 12:39:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30048DT"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48844XN"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74026TS"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94019IV"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90889KG"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61734US"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180XB"}, "ts": "2023-07-07 12:39:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21971UP"}, "ts": "2023-07-07 12:39:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09009DV"}, "ts": "2023-07-07 12:39:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09009DV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:39:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55818EE"}, "ts": "2023-07-07 12:39:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55818EE"}, "ts": "2023-07-07 12:39:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:39:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01844"}, "ts": "2023-07-07 12:39:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01844", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:39:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-07 12:39:28 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96504QH"}, "ts": "2023-07-07 12:39:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96504QH"}, "ts": "2023-07-07 12:39:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01011-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:39:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01011-1"}, "ts": "2023-07-07 12:39:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G88437QR"}, "ts": "2023-07-07 12:39:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88437QR"}, "ts": "2023-07-07 12:39:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1MA26-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:39:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1MA26-1"}, "ts": "2023-07-07 12:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:39:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02248"}, "ts": "2023-07-07 12:39:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G39995KJ"}, "ts": "2023-07-07 12:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02248", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:39:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39995KJ"}, "ts": "2023-07-07 12:39:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06247RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:40:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90539LD"}, "ts": "2023-07-07 12:40:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90539LD"}, "ts": "2023-07-07 12:40:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:40:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:40:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:40:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:40:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03829ED"}, "ts": "2023-07-07 12:40:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03829ED"}, "ts": "2023-07-07 12:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVH8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:40:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVH8-1"}, "ts": "2023-07-07 12:40:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00773-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00773-1"}, "ts": "2023-07-07 12:40:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G45003JO"}, "ts": "2023-07-07 12:40:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45003JO"}, "ts": "2023-07-07 12:40:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42380GI"}, "ts": "2023-07-07 12:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42380GI"}, "ts": "2023-07-07 12:40:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27105"}, "ts": "2023-07-07 12:41:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G33391ZV"}, "ts": "2023-07-07 12:41:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27105", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:41:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05109NU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:41:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05109NU"}, "ts": "2023-07-07 12:41:03 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33391ZV"}, "ts": "2023-07-07 12:41:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1823160", "type": "PubMed"}, "ts": "2023-07-07 12:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1823160", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:41:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15941"}, "ts": "2023-07-07 12:41:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02776UX"}, "ts": "2023-07-07 12:41:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02776UX"}, "ts": "2023-07-07 12:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A2Z4LIS9-1"}, "ts": "2023-07-07 12:41:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41876BL"}, "ts": "2023-07-07 12:41:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A2Z4LIS9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:41:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41876BL"}, "ts": "2023-07-07 12:41:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69461KL"}, "ts": "2023-07-07 12:41:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69461KL"}, "ts": "2023-07-07 12:41:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62645", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:41:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62645"}, "ts": "2023-07-07 12:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 12:41:38 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-07 12:41:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22880KN"}, "ts": "2023-07-07 12:41:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22880KN"}, "ts": "2023-07-07 12:41:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G73559DL"}, "ts": "2023-07-07 12:41:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73559DL"}, "ts": "2023-07-07 12:41:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 12:41:52 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-07 12:41:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77019UJ"}, "ts": "2023-07-07 12:41:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77019UJ"}, "ts": "2023-07-07 12:42:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09803"}, "ts": "2023-07-07 12:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09803", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:42:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82710YP"}, "ts": "2023-07-07 12:42:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G54089ZD"}, "ts": "2023-07-07 12:42:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:42:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:42:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05156.466.466"}, "ts": "2023-07-07 12:42:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4X5"}, "ts": "2023-07-07 12:42:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G85977BN"}, "ts": "2023-07-07 12:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05156", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:42:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85977BN"}, "ts": "2023-07-07 12:42:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96866DI"}, "ts": "2023-07-07 12:42:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BN25", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:42:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BN25"}, "ts": "2023-07-07 12:42:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96866DI"}, "ts": "2023-07-07 12:42:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71956IS"}, "ts": "2023-07-07 12:42:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71956IS"}, "ts": "2023-07-07 12:42:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1J7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:42:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1J7"}, "ts": "2023-07-07 12:42:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29476"}, "ts": "2023-07-07 12:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29476", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:42:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G68783EM"}, "ts": "2023-07-07 12:42:58 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68783EM"}, "ts": "2023-07-07 12:42:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:43:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:43:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G54258NG"}, "ts": "2023-07-07 12:43:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54258NG"}, "ts": "2023-07-07 12:43:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75500ME"}, "ts": "2023-07-07 12:43:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75500ME"}, "ts": "2023-07-07 12:43:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99229VQ"}, "ts": "2023-07-07 12:43:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99229VQ"}, "ts": "2023-07-07 12:43:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04690JX"}, "ts": "2023-07-07 12:43:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04690JX"}, "ts": "2023-07-07 12:43:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67189MD"}, "ts": "2023-07-07 12:43:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67189MD"}, "ts": "2023-07-07 12:43:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 12:44:02 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 12:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 12:44:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62204FH"}, "ts": "2023-07-07 12:44:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62204FH"}, "ts": "2023-07-07 12:44:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96057TO"}, "ts": "2023-07-07 12:44:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96057TO"}, "ts": "2023-07-07 12:44:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G93380BT"}, "ts": "2023-07-07 12:44:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93380BT"}, "ts": "2023-07-07 12:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30966"}, "ts": "2023-07-07 12:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V6K6-1"}, "ts": "2023-07-07 12:44:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42049JU"}, "ts": "2023-07-07 12:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V6K6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42049JU"}, "ts": "2023-07-07 12:44:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15541SE"}, "ts": "2023-07-07 12:44:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20301772", "type": "PubMed"}, "ts": "2023-07-07 12:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20301772", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20301772", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 12:44:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15541SE"}, "ts": "2023-07-07 12:44:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55916"}, "ts": "2023-07-07 12:44:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-07 12:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:44:47 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:44:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:44:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:44:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56708PR"}, "ts": "2023-07-07 12:44:57 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56708PR"}, "ts": "2023-07-07 12:44:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32572241", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:45:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32572241", "type": "PubMed"}, "ts": "2023-07-07 12:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:45:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBV2.323.323"}, "ts": "2023-07-07 12:45:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESR9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:45:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESR9"}, "ts": "2023-07-07 12:45:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G36691KB"}, "ts": "2023-07-07 12:45:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7MU54"}, "ts": "2023-07-07 12:45:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36691KB"}, "ts": "2023-07-07 12:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7MU54", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:45:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWZ2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:45:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VWZ2"}, "ts": "2023-07-07 12:45:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06817XP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:45:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06817XP"}, "ts": "2023-07-07 12:45:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94437IW"}, "ts": "2023-07-07 12:45:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94437IW"}, "ts": "2023-07-07 12:45:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35680TA"}, "ts": "2023-07-07 12:45:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35680TA"}, "ts": "2023-07-07 12:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:45:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35363", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:45:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71272JH"}, "ts": "2023-07-07 12:45:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71272JH"}, "ts": "2023-07-07 12:45:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:45:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:45:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55067DH"}, "ts": "2023-07-07 12:46:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55067DH"}, "ts": "2023-07-07 12:46:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87249CK"}, "ts": "2023-07-07 12:46:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87249CK"}, "ts": "2023-07-07 12:46:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61830"}, "ts": "2023-07-07 12:46:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:46:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D9L5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:46:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G52166JE"}, "ts": "2023-07-07 12:46:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D9L5"}, "ts": "2023-07-07 12:46:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52166JE"}, "ts": "2023-07-07 12:46:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:46:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34099278", "type": "PubMed"}, "ts": "2023-07-07 12:46:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34099278", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:46:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65156XZ"}, "ts": "2023-07-07 12:46:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65156XZ"}, "ts": "2023-07-07 12:46:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27448", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:46:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P27448.376.376"}, "ts": "2023-07-07 12:46:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14052TA"}, "ts": "2023-07-07 12:46:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14052TA"}, "ts": "2023-07-07 12:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00053MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:46:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29339IQ"}, "ts": "2023-07-07 12:46:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48611"}, "ts": "2023-07-07 12:47:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:47:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "None"}, "ts": "2023-07-07 12:47:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10377CG"}, "ts": "2023-07-07 12:47:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10377CG"}, "ts": "2023-07-07 12:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2ASQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:47:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2ASQ1"}, "ts": "2023-07-07 12:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49247", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:47:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18327255", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:47:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18327255", "type": "PubMed"}, "ts": "2023-07-07 12:47:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G04", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96G04"}, "ts": "2023-07-07 12:47:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T4S7"}, "ts": "2023-07-07 12:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T4S7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:48:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K212.529.529"}, "ts": "2023-07-07 12:48:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K212", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:48:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56076DZ"}, "ts": "2023-07-07 12:48:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56076DZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:48:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:48:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NG77"}, "ts": "2023-07-07 12:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R044", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 12:48:34 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9R044", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 12:48:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06756"}, "ts": "2023-07-07 12:48:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23584533", "type": "PubMed"}, "ts": "2023-07-07 12:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23584533", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:48:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:49:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C0L5.1391.1391"}, "ts": "2023-07-07 12:49:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:49:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19740739", "type": "PubMed"}, "ts": "2023-07-07 12:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19740739", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:49:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07214-1"}, "ts": "2023-07-07 12:49:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07214-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:50:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KQ7"}, "ts": "2023-07-07 12:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KQ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:50:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:51:14 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15047173", "type": "PubMed"}, "ts": "2023-07-07 12:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15047173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:51:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CFK6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:51:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17039"}, "ts": "2023-07-07 12:51:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17039", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:51:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CFK6"}, "ts": "2023-07-07 12:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13439-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:51:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13439-1"}, "ts": "2023-07-07 12:51:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13639-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:51:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:51:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08351"}, "ts": "2023-07-07 12:51:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IW41"}, "ts": "2023-07-07 12:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IW41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:52:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830"}, "ts": "2023-07-07 12:52:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10857745", "type": "PubMed"}, "ts": "2023-07-07 12:52:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10857745", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D306"}, "ts": "2023-07-07 12:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C050-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:53:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C050-1"}, "ts": "2023-07-07 12:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42227", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75311", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:53:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75311"}, "ts": "2023-07-07 12:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:54:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17765923", "type": "PubMed"}, "ts": "2023-07-07 12:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17765923", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 12:54:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32297", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:55:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32297"}, "ts": "2023-07-07 12:55:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15388.220.220"}, "ts": "2023-07-07 12:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15388", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:55:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKK6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKK6-1"}, "ts": "2023-07-07 12:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15205"}, "ts": "2023-07-07 12:56:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01410KF"}, "ts": "2023-07-07 12:56:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHI7.138.138"}, "ts": "2023-07-07 12:56:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHI7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 12:56:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15941", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:56:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6G8"}, "ts": "2023-07-07 12:57:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:57:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D53"}, "ts": "2023-07-07 12:57:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TQ03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TQ03"}, "ts": "2023-07-07 12:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14672-1"}, "ts": "2023-07-07 12:57:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14672-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:57:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01974"}, "ts": "2023-07-07 12:57:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01974", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:58:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZM1"}, "ts": "2023-07-07 12:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-07 12:58:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:58:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811P6"}, "ts": "2023-07-07 12:58:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05982-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:59:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05982-1"}, "ts": "2023-07-07 12:59:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBX3"}, "ts": "2023-07-07 12:59:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:59:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00805TZ"}, "ts": "2023-07-07 12:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00805TZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 12:59:22 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q70Z44", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 12:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q70Z44", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 12:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BD8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 12:59:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BD8"}, "ts": "2023-07-07 12:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 12:59:57 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 12:59:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 12:59:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 12:59:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99PP7"}, "ts": "2023-07-07 12:59:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99PP7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:00:01 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 13:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 13:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 13:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 13:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 13:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 13:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G80858MF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:00:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60711-1"}, "ts": "2023-07-07 13:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60711-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:00:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17185360", "type": "PubMed"}, "ts": "2023-07-07 13:01:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17185360", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:01:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NMS7"}, "ts": "2023-07-07 13:01:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NMS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:01:04 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P13597", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 13:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13597", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 13:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21452", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:01:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21452"}, "ts": "2023-07-07 13:01:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07392QY"}, "ts": "2023-07-07 13:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01589", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:02:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:02:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01589.89.89"}, "ts": "2023-07-07 13:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48611", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:03:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D53"}, "ts": "2023-07-07 13:03:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D53", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15391", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15391"}, "ts": "2023-07-07 13:03:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16067", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:03:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16067.349.349"}, "ts": "2023-07-07 13:03:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81088WT"}, "ts": "2023-07-07 13:04:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7-1"}, "ts": "2023-07-07 13:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:04:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15800-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:04:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15800-1"}, "ts": "2023-07-07 13:04:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91WD0"}, "ts": "2023-07-07 13:05:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91WD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2826484", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:05:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2826484", "type": "PubMed"}, "ts": "2023-07-07 13:05:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZC3"}, "ts": "2023-07-07 13:06:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:06:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:06:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9WVQ1.883.883"}, "ts": "2023-07-07 13:06:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99569", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:06:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99569.595.595"}, "ts": "2023-07-07 13:06:38 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 13:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 13:06:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 13:06:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02545"}, "ts": "2023-07-07 13:07:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98175", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98175"}, "ts": "2023-07-07 13:07:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AQ07"}, "ts": "2023-07-07 13:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AQ07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:07:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JUX2-1"}, "ts": "2023-07-07 13:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JUX2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A208-1"}, "ts": "2023-07-07 13:08:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A208-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:08:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYS8"}, "ts": "2023-07-07 13:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HC73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:08:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HC73"}, "ts": "2023-07-07 13:08:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:08:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6IEU7.33.33"}, "ts": "2023-07-07 13:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IEU7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:08:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42771-1"}, "ts": "2023-07-07 13:09:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14650", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:09:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14650"}, "ts": "2023-07-07 13:09:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND94", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:09:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND94"}, "ts": "2023-07-07 13:09:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15125"}, "ts": "2023-07-07 13:09:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15379"}, "ts": "2023-07-07 13:10:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63096"}, "ts": "2023-07-07 13:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:10:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-07 13:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15205", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:12:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84852GW"}, "ts": "2023-07-07 13:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:13:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5H943"}, "ts": "2023-07-07 13:13:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97797-1"}, "ts": "2023-07-07 13:13:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-07 13:14:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:14:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBN1"}, "ts": "2023-07-07 13:14:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:14:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10599", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:14:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V6K6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:14:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3V6K6-1"}, "ts": "2023-07-07 13:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0VGT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:14:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0VGT2"}, "ts": "2023-07-07 13:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z173-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 13:14:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Z173-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 13:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2HXL6-1"}, "ts": "2023-07-07 13:14:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2HXL6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:14:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-07 13:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31153XO", "user": "Undecided", "type": "error", "page": "glycan", "message": "Network error. Glycan Detail api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-07 13:14:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46379", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:14:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46379.1122.1122"}, "ts": "2023-07-07 13:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:14:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61830"}, "ts": "2023-07-07 13:14:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49913"}, "ts": "2023-07-07 13:14:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:15:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 13:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08519"}, "ts": "2023-07-07 13:15:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:15:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6N6.888.888"}, "ts": "2023-07-07 13:15:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JIL4.348.348"}, "ts": "2023-07-07 13:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIL4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2111175", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:15:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2111175", "type": "PubMed"}, "ts": "2023-07-07 13:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1V9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:15:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U1V9"}, "ts": "2023-07-07 13:15:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:15:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DR8"}, "ts": "2023-07-07 13:15:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZZ24", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:15:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZZ24"}, "ts": "2023-07-07 13:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2R6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:16:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2R6.662.662"}, "ts": "2023-07-07 13:16:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKE0"}, "ts": "2023-07-07 13:16:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKE0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:16:08 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 13:16:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 13:16:13 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-07 13:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 13:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 13:16:17 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 13:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 13:16:17 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 13:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:16:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-07 13:16:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-07 13:16:36 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-07 13:16:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-07 13:16:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-07 13:16:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 13:16:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 13:16:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 13:16:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-07 13:16:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:17:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5F8"}, "ts": "2023-07-07 13:17:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25813380", "type": "PubMed"}, "ts": "2023-07-07 13:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25813380", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:17:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:17:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40199-1.241.241"}, "ts": "2023-07-07 13:17:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40199-1", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "avkkm85t6pm66vrhc26l4e24s4qkar69", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:17:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35611"}, "ts": "2023-07-07 13:17:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35611", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:17:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLL9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:18:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLL9"}, "ts": "2023-07-07 13:18:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8K212.28.28"}, "ts": "2023-07-07 13:18:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 13:18:23 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-07 13:18:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50052", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:18:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50052.34.34"}, "ts": "2023-07-07 13:18:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXI9"}, "ts": "2023-07-07 13:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:18:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16186", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:18:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16186.222.222"}, "ts": "2023-07-07 13:18:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13029"}, "ts": "2023-07-07 13:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13029", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:18:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80204-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:19:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80204-1"}, "ts": "2023-07-07 13:19:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV96"}, "ts": "2023-07-07 13:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:19:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UP0.717.717"}, "ts": "2023-07-07 13:19:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:19:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20171170", "type": "PubMed"}, "ts": "2023-07-07 13:19:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20171170", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"PDKGFDDNYCRNPDGQPRPWCYTLDPHTRW\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-07 13:20:04 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "PDKGFDDNYCRNPDGQPRPWCYTLDPHTRW", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-07 13:20:04 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 10}, "ts": "2023-07-07 13:20:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">10", "user": "Anonymous", "type": "user", "page": "blast", "message": "Blast Search query=10"}, "ts": "2023-07-07 13:20:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-07 13:20:06 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 10}, "ts": "2023-07-07 13:20:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P14210-1, P17945-1, Q08048-1, Q01177-1, P20918-1, P08519-1, Q2TV78-1, P26927-1, F7FMS0-1, Q16609-1, P00747-1, P26928-1, Q9V6K3-1, P06869-1, P00734-1"}, "ts": "2023-07-07 13:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:20:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9653646"}, "ts": "2023-07-07 13:20:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 13:20:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5TEU4.245.245"}, "ts": "2023-07-07 13:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TEU4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:21:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40791GU"}, "ts": "2023-07-07 13:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40791GU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:21:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:21:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-07 13:21:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19823.675.675"}, "ts": "2023-07-07 13:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50402", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:21:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RU2"}, "ts": "2023-07-07 13:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:21:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50402.59.59"}, "ts": "2023-07-07 13:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08922", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08922"}, "ts": "2023-07-07 13:21:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15063", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:21:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15063.402.402"}, "ts": "2023-07-07 13:21:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-07 13:22:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R749-1"}, "ts": "2023-07-07 13:22:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A577"}, "ts": "2023-07-07 13:22:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29812"}, "ts": "2023-07-07 13:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33035436", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:22:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33035436", "type": "PubMed"}, "ts": "2023-07-07 13:22:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:22:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03216SJ"}, "ts": "2023-07-07 13:22:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03216SJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:22:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02545", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:23:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11302735", "type": "PubMed"}, "ts": "2023-07-07 13:23:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11302735", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:23:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14429"}, "ts": "2023-07-07 13:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14429", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:23:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23769"}, "ts": "2023-07-07 13:23:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23769", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PIU2-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:23:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD20", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:23:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HD20.886.886"}, "ts": "2023-07-07 13:23:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PIU2-1"}, "ts": "2023-07-07 13:23:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BI57-1"}, "ts": "2023-07-07 13:23:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BI57-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:23:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2452975", "type": "PubMed"}, "ts": "2023-07-07 13:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2452975", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75417", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:23:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75417.2236.2236"}, "ts": "2023-07-07 13:23:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60477", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:23:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96DR5"}, "ts": "2023-07-07 13:23:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60477"}, "ts": "2023-07-07 13:23:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DR5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:23:54 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 13:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 13:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 13:23:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYQ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:24:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYQ0.92.92"}, "ts": "2023-07-07 13:24:11 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-07 13:24:12 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26500IJ"}, "ts": "2023-07-07 13:24:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26500IJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:24:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42771-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:25:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2K9"}, "ts": "2023-07-07 13:25:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09803", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:25:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09803"}, "ts": "2023-07-07 13:25:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BY2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:25:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BY2-1"}, "ts": "2023-07-07 13:25:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-07 13:25:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 13:25:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15125", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:25:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94842", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:25:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94842"}, "ts": "2023-07-07 13:25:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2456616", "type": "PubMed"}, "ts": "2023-07-07 13:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2456616", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:26:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15337739", "type": "PubMed"}, "ts": "2023-07-07 13:26:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15337739", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:26:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:26:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C0L5.1391.1391"}, "ts": "2023-07-07 13:26:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00247PL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:27:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00247PL"}, "ts": "2023-07-07 13:27:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00461"}, "ts": "2023-07-07 13:27:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00461", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:27:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22223"}, "ts": "2023-07-07 13:27:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:27:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43586", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:27:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43586"}, "ts": "2023-07-07 13:27:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N2A6-1"}, "ts": "2023-07-07 13:27:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N2A6-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86XX4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:27:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86XX4.2093.2093"}, "ts": "2023-07-07 13:27:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-07 13:28:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXD5"}, "ts": "2023-07-07 13:28:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:28:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5G2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:28:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5G2"}, "ts": "2023-07-07 13:28:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94856"}, "ts": "2023-07-07 13:28:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94856", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:28:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10146.78.78"}, "ts": "2023-07-07 13:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10146", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62009"}, "ts": "2023-07-07 13:28:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62009", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:28:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRB3"}, "ts": "2023-07-07 13:29:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98264BW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:29:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98264BW"}, "ts": "2023-07-07 13:29:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7991565", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:29:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7991565", "type": "PubMed"}, "ts": "2023-07-07 13:29:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BS35", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BS35"}, "ts": "2023-07-07 13:29:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62361-1"}, "ts": "2023-07-07 13:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62361-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:29:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62959.55.55"}, "ts": "2023-07-07 13:29:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01260KW"}, "ts": "2023-07-07 13:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01260KW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:29:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62959", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:29:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWH7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:29:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NWH7.478.478"}, "ts": "2023-07-07 13:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96LU5"}, "ts": "2023-07-07 13:30:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LU5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:30:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 13:30:48 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 13:30:48 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 13:30:56 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-07 13:30:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-07 13:30:56 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 13:31:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 13:31:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A577", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:31:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PAL1"}, "ts": "2023-07-07 13:31:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25445"}, "ts": "2023-07-07 13:31:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PAL1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:31:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 13:31:13 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-07 13:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 13:31:13 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 13:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 13:31:13 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 13:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:31:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-07 13:31:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:31:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H222", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:31:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H222.535.535"}, "ts": "2023-07-07 13:31:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G48414YA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:31:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-07 13:31:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-07 13:31:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-07 13:31:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-07 13:31:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-07 13:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08519", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:31:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59528", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:31:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59528"}, "ts": "2023-07-07 13:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99683ND", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:32:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99683ND"}, "ts": "2023-07-07 13:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35443", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:32:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35443"}, "ts": "2023-07-07 13:32:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G09078LY"}, "ts": "2023-07-07 13:32:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G09078LY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:32:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34810"}, "ts": "2023-07-07 13:32:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34810", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:33:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80303"}, "ts": "2023-07-07 13:33:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RB30-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:33:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RB30-1"}, "ts": "2023-07-07 13:33:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P80020", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:33:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P80020"}, "ts": "2023-07-07 13:33:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRF9"}, "ts": "2023-07-07 13:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRF9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:34:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58658", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:34:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P58658.165.165"}, "ts": "2023-07-07 13:34:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64973KT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:35:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-07 13:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:35:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43883"}, "ts": "2023-07-07 13:35:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15486FH"}, "ts": "2023-07-07 13:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15486FH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19492-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:35:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19492-1"}, "ts": "2023-07-07 13:35:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P63218"}, "ts": "2023-07-07 13:35:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P63218", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64430-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:35:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64430-1"}, "ts": "2023-07-07 13:35:19 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09775CH"}, "ts": "2023-07-07 13:35:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14548ZL"}, "ts": "2023-07-07 13:35:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31852PQ"}, "ts": "2023-07-07 13:35:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37135JQ"}, "ts": "2023-07-07 13:35:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765YT"}, "ts": "2023-07-07 13:35:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58753"}, "ts": "2023-07-07 13:35:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58753", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:35:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60323", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:35:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P60323.171.171"}, "ts": "2023-07-07 13:35:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-07 13:36:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96T88"}, "ts": "2023-07-07 13:36:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96T88", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:36:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:36:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55001"}, "ts": "2023-07-07 13:36:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BW5"}, "ts": "2023-07-07 13:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7611299", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:37:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7611299", "type": "PubMed"}, "ts": "2023-07-07 13:37:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06340", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:37:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06340.52.52"}, "ts": "2023-07-07 13:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXN1-1"}, "ts": "2023-07-07 13:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXN1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:37:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:37:49 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20930030", "type": "PubMed"}, "ts": "2023-07-07 13:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20930030", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:38:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:38:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11488"}, "ts": "2023-07-07 13:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2971663", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:38:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2971663", "type": "PubMed"}, "ts": "2023-07-07 13:38:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UP6"}, "ts": "2023-07-07 13:38:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:38:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10137XF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:38:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10137XF"}, "ts": "2023-07-07 13:38:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:39:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM1"}, "ts": "2023-07-07 13:39:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXY4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:39:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXY4-1"}, "ts": "2023-07-07 13:39:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q642F4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:39:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q642F4"}, "ts": "2023-07-07 13:39:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51116", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:39:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51116.410.410"}, "ts": "2023-07-07 13:39:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62314"}, "ts": "2023-07-07 13:39:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62314", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:39:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20927323", "type": "PubMed"}, "ts": "2023-07-07 13:39:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20927323", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:39:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13667"}, "ts": "2023-07-07 13:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13667", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:40:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPF0"}, "ts": "2023-07-07 13:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:40:27 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 13:40:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 13:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 13:40:36 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-07 13:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 13:40:36 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 13:40:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 13:40:37 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 13:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-07 13:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:40:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60725", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:41:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60725"}, "ts": "2023-07-07 13:41:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12660"}, "ts": "2023-07-07 13:41:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 13:41:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14210-1", "cluster_type": "homologset.oma"}, "ts": "2023-07-07 13:41:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A198-1"}, "ts": "2023-07-07 13:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A198-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:41:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22723"}, "ts": "2023-07-07 13:42:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22723", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 13:43:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99623"}, "ts": "2023-07-07 13:43:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99623", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:43:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13611"}, "ts": "2023-07-07 13:43:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01118"}, "ts": "2023-07-07 13:43:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:43:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 13:43:43 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 13:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01854"}, "ts": "2023-07-07 13:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01854", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22223", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:43:49 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "G17689DH", "term_category": "any"}, "ts": "2023-07-07 13:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 13:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"G17689DH\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 13:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "user": "Anonymous", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 13:43:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6db0a535f896f31ad73eeecc521ee9e7", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 13:43:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81459MV"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86750HK"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29255IL"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37626XQ"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93822DY"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64132UH"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24005JZ"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08606CV"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67393WG"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72956NR"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30048DT"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48844XN"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74026TS"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94019IV"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90889KG"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61734US"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92180XB"}, "ts": "2023-07-07 13:43:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:44:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS6"}, "ts": "2023-07-07 13:44:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DCK3"}, "ts": "2023-07-07 13:44:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DCK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23825075", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:44:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23825075", "type": "PubMed"}, "ts": "2023-07-07 13:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:44:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:45:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TC27", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:45:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TC27.244.244"}, "ts": "2023-07-07 13:45:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60502"}, "ts": "2023-07-07 13:45:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9810004", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:46:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9810004", "type": "PubMed"}, "ts": "2023-07-07 13:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV31-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:46:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV31-1"}, "ts": "2023-07-07 13:46:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10642597", "type": "PubMed"}, "ts": "2023-07-07 13:46:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10642597", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:46:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-07 13:46:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49771"}, "ts": "2023-07-07 13:46:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49771", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:46:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:47:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:47:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q9K5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:47:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q9K5"}, "ts": "2023-07-07 13:47:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99798"}, "ts": "2023-07-07 13:47:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99798", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09163-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:47:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q09163-1.100.100"}, "ts": "2023-07-07 13:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:47:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30154", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:47:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30154"}, "ts": "2023-07-07 13:47:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CI12", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:47:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8CI12.131.131"}, "ts": "2023-07-07 13:47:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:47:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25661920", "type": "PubMed"}, "ts": "2023-07-07 13:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25661920", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:47:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08629.228.228"}, "ts": "2023-07-07 13:47:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26067085", "type": "PubMed"}, "ts": "2023-07-07 13:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08629", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:47:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26067085", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:47:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RCB7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:47:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RCB7-1"}, "ts": "2023-07-07 13:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK88", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:47:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JK88"}, "ts": "2023-07-07 13:47:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:48:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30154"}, "ts": "2023-07-07 13:48:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30154", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:48:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXK2"}, "ts": "2023-07-07 13:48:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXK2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:48:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24584101", "type": "PubMed"}, "ts": "2023-07-07 13:48:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:48:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24584101", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:48:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QUM4"}, "ts": "2023-07-07 13:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QUM4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:48:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1K2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:48:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P1K2"}, "ts": "2023-07-07 13:48:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28059702", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:48:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28059702", "type": "PubMed"}, "ts": "2023-07-07 13:48:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00451-1"}, "ts": "2023-07-07 13:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4J6C6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:48:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4J6C6"}, "ts": "2023-07-07 13:48:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22689652", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:49:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22689652", "type": "PubMed"}, "ts": "2023-07-07 13:49:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z6Z7.1368.1368"}, "ts": "2023-07-07 13:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6Z7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:49:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:49:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-07 13:49:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41724ZD"}, "ts": "2023-07-07 13:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41724ZD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:49:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25063"}, "ts": "2023-07-07 13:49:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q687X5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:50:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q687X5"}, "ts": "2023-07-07 13:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P69892", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:50:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P69892.51.51"}, "ts": "2023-07-07 13:50:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11047.1436.1436"}, "ts": "2023-07-07 13:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11047", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:51:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K210-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:51:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K210-1"}, "ts": "2023-07-07 13:51:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NYV4"}, "ts": "2023-07-07 13:52:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-07 13:52:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LM96-1"}, "ts": "2023-07-07 13:52:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LM96-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:52:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28335", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:52:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28335"}, "ts": "2023-07-07 13:52:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TC92-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TC92-1"}, "ts": "2023-07-07 13:53:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:53:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67631MS"}, "ts": "2023-07-07 13:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67631MS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:53:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18825"}, "ts": "2023-07-07 13:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18825", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RQ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:53:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2M3G0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:53:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96RQ1.228.228"}, "ts": "2023-07-07 13:53:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q2M3G0.819.819"}, "ts": "2023-07-07 13:53:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14543-1"}, "ts": "2023-07-07 13:53:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:53:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13501"}, "ts": "2023-07-07 13:53:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920P3"}, "ts": "2023-07-07 13:53:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920P3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:53:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:54:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULJ1"}, "ts": "2023-07-07 13:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:54:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKP4"}, "ts": "2023-07-07 13:54:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97528.468.468"}, "ts": "2023-07-07 13:55:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97528", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:55:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:55:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16075187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:55:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16075187", "type": "PubMed"}, "ts": "2023-07-07 13:55:40 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-07 13:55:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-07 13:55:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15366"}, "ts": "2023-07-07 13:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15366", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:55:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZHA3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:55:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZHA3-1"}, "ts": "2023-07-07 13:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23940119", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:56:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11388-1"}, "ts": "2023-07-07 13:56:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01189"}, "ts": "2023-07-07 13:56:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13227", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:56:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13227.161.161"}, "ts": "2023-07-07 13:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00051MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22891", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:56:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22891"}, "ts": "2023-07-07 13:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:56:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBU9"}, "ts": "2023-07-07 13:56:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBU9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:56:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62786-1"}, "ts": "2023-07-07 13:56:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62786-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01189", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:57:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01189.71.71"}, "ts": "2023-07-07 13:57:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q53GQ0"}, "ts": "2023-07-07 13:57:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q53GQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:57:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12660", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:57:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49458"}, "ts": "2023-07-07 13:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49458", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 13:57:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:57:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:57:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-07 13:57:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-07 13:57:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-07 13:57:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38887TM"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42665KV"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315FS"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-07 13:57:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96G30.9.9"}, "ts": "2023-07-07 13:57:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96G30", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:57:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-07 13:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:57:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-07 13:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 13:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23052ZQ"}, "ts": "2023-07-07 13:57:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67200RM"}, "ts": "2023-07-07 13:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15624ZV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:57:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15624ZV"}, "ts": "2023-07-07 13:57:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10197JO"}, "ts": "2023-07-07 13:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10197JO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 13:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:57:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20618"}, "ts": "2023-07-07 13:58:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20618", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:58:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N5M1-1"}, "ts": "2023-07-07 13:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N5M1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:58:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6K4"}, "ts": "2023-07-07 13:58:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6K4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25278365", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 13:58:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25278365", "type": "PubMed"}, "ts": "2023-07-07 13:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95433", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:58:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95433.66.66"}, "ts": "2023-07-07 13:58:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UHR6"}, "ts": "2023-07-07 13:58:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 13:58:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P85037.655.655"}, "ts": "2023-07-07 13:59:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85037", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13611", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:59:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H8T0-1"}, "ts": "2023-07-07 13:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H8T0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:59:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06481.43.43"}, "ts": "2023-07-07 13:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:59:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 13:59:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NX40"}, "ts": "2023-07-07 13:59:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NX40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:59:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731-1"}, "ts": "2023-07-07 13:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 13:59:48 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 14:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 14:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 14:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 14:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 14:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 14:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyTouCan", "output_namespace": "PubChem Compound", "input_idlist": ["G97655UC", "G08246QI", "G86725SE", "G33612TW", "G03266UM", "G1234"]}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">67e04aa8f769bb294dff599f27b6df5c", "user": "Anonymous", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyTouCan\",\"output_namespace\":\"PubChem Compound\",\"input_idlist\":\"G97655UC,G08246QI,G86725SE,G33612TW,G03266UM,G1234\"}"}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 14:00:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11445551", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:00:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11445551", "type": "PubMed"}, "ts": "2023-07-07 14:00:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47325XO"}, "ts": "2023-07-07 14:00:21 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60145BJ"}, "ts": "2023-07-07 14:00:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18191269", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:00:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18191269", "type": "PubMed"}, "ts": "2023-07-07 14:00:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35500"}, "ts": "2023-07-07 14:00:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35500", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:00:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00797ZX"}, "ts": "2023-07-07 14:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00797ZX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:00:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R9G9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:00:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R9G9-1"}, "ts": "2023-07-07 14:00:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G95760DN"}, "ts": "2023-07-07 14:00:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G95760DN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:00:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A9R3"}, "ts": "2023-07-07 14:00:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A9R3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2E6"}, "ts": "2023-07-07 14:01:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07141"}, "ts": "2023-07-07 14:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60502", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:01:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G25520XG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZM8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZM8"}, "ts": "2023-07-07 14:02:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28677912", "type": "PubMed"}, "ts": "2023-07-07 14:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28677912", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:02:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TQ82-1"}, "ts": "2023-07-07 14:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TQ82-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:02:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNP9"}, "ts": "2023-07-07 14:02:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03266UM"}, "ts": "2023-07-07 14:02:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03266UM", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:02:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03266UM"}, "ts": "2023-07-07 14:02:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-07 14:02:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-07 14:02:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07527DV"}, "ts": "2023-07-07 14:02:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-07 14:02:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07102WY"}, "ts": "2023-07-07 14:02:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-07 14:02:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51888.289.289"}, "ts": "2023-07-07 14:02:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19652"}, "ts": "2023-07-07 14:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51888", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:02:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:02:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-07 14:03:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G32550BI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:03:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-07 14:03:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03054QW"}, "ts": "2023-07-07 14:03:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03663BL"}, "ts": "2023-07-07 14:03:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03294VW"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04779EY"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05031SD"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05581UW"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05964BT"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06419VB"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06483KZ"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06910AO"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07397MN"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07532UC"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09988GX"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10174LI"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10535GX"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11049II"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11647UD"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12000YX"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14900XK"}, "ts": "2023-07-07 14:03:09 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 14:03:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-07 14:03:13 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 14:03:13 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 14:03:13 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 14:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-07 14:03:16 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-07 14:03:16 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 14:03:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "user": "Anonymous", "type": "user", "page": "mapper", "message": "IdMapping modification initiated"}, "ts": "2023-07-07 14:03:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:03:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:03:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41250-1"}, "ts": "2023-07-07 14:03:33 EDT-0400"}, {"api": "/idmapping/search/", "req": {"recordtype": "glycan", "input_namespace": "GlyConnect", "output_namespace": "ChEBI", "input_idlist": ["118", "114", "615", "641", "678"]}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c", "user": "Anonymous", "type": "user", "page": "mapper", "message": "Performing ID Mapping Search"}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "67e04aa8f769bb294dff599f27b6df5c>61a2532804e5d36036008cddec060318", "user": "Anonymous", "type": "user", "page": "mapper", "message": "ID Mapping Search query={\"recordtype\":\"glycan\",\"input_namespace\":\"GlyConnect\",\"output_namespace\":\"ChEBI\",\"input_idlist\":\"118,114,615,641,678\"}"}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "61a2532804e5d36036008cddec060318", "user": "Anonymous", "type": "user", "page": "mapper-result", "message": "page access"}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "input_id", "category": "unmapped"}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/idmapping/list/", "req": {"id": "61a2532804e5d36036008cddec060318", "offset": 1, "limit": 20, "order": "asc", "sort": "from", "category": "mapped"}, "ts": "2023-07-07 14:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "mapper", "message": "page access"}, "ts": "2023-07-07 14:04:43 EDT-0400"}, {"api": "/idmapping/search_init/", "req": {}, "ts": "2023-07-07 14:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSK0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:04:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSK0-1"}, "ts": "2023-07-07 14:04:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90187BH"}, "ts": "2023-07-07 14:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90187BH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00451-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WTQ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:04:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WTQ1"}, "ts": "2023-07-07 14:04:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08358DN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:05:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08358DN"}, "ts": "2023-07-07 14:05:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15173175", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:05:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15173175", "type": "PubMed"}, "ts": "2023-07-07 14:05:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31751", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:05:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P31751.451.451"}, "ts": "2023-07-07 14:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:05:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25063", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:05:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:05:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:05:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06734"}, "ts": "2023-07-07 14:05:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZT9"}, "ts": "2023-07-07 14:05:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZT9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:05:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL40"}, "ts": "2023-07-07 14:06:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:06:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3T9"}, "ts": "2023-07-07 14:06:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3T9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZTU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:06:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZTU2"}, "ts": "2023-07-07 14:06:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41943OZ"}, "ts": "2023-07-07 14:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41943OZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41352UL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:06:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41352UL"}, "ts": "2023-07-07 14:06:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:06:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62816-1"}, "ts": "2023-07-07 14:06:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NFU0"}, "ts": "2023-07-07 14:06:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NFU0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:06:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEP8"}, "ts": "2023-07-07 14:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:07:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSA2"}, "ts": "2023-07-07 14:07:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27037"}, "ts": "2023-07-07 14:07:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27037", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NT99", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:07:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NT99"}, "ts": "2023-07-07 14:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZQ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ8"}, "ts": "2023-07-07 14:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UIW0"}, "ts": "2023-07-07 14:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:07:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VWK5"}, "ts": "2023-07-07 14:07:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:08:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23560"}, "ts": "2023-07-07 14:08:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5Y7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:08:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H5Y7.110.110"}, "ts": "2023-07-07 14:08:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33923458", "type": "PubMed"}, "ts": "2023-07-07 14:08:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33923458", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:08:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWU5"}, "ts": "2023-07-07 14:08:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02708"}, "ts": "2023-07-07 14:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02708", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:08:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20815TK"}, "ts": "2023-07-07 14:08:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20138841", "type": "PubMed"}, "ts": "2023-07-07 14:08:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20138841", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:08:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-07 14:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14543-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:09:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRY8-1"}, "ts": "2023-07-07 14:09:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRY8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:09:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13315", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:09:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13315"}, "ts": "2023-07-07 14:09:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02091-1"}, "ts": "2023-07-07 14:09:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQC3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:10:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NQC3.226.226"}, "ts": "2023-07-07 14:10:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYH1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:10:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYH1.208.208"}, "ts": "2023-07-07 14:10:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24452-1"}, "ts": "2023-07-07 14:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24452-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:10:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02549", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:10:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02549.844.844"}, "ts": "2023-07-07 14:10:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26022"}, "ts": "2023-07-07 14:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26022", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJ22", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:10:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JJ22.749.749"}, "ts": "2023-07-07 14:10:59 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14520ZO"}, "ts": "2023-07-07 14:11:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14520ZO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:11:08 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 14:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 14:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 14:11:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQQ3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:11:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9EQQ3.68.68"}, "ts": "2023-07-07 14:11:15 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 14:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 14:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 14:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:11:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35711"}, "ts": "2023-07-07 14:11:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01563"}, "ts": "2023-07-07 14:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35711", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 14:11:46 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "spint2", "term_category": "any"}, "ts": "2023-07-07 14:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">66a2822f62b1f5ad5e7580f5e10a3a36", "user": "Undecided", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"spint2\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 14:11:46 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 14:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "66a2822f62b1f5ad5e7580f5e10a3a36", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 14:11:46 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "66a2822f62b1f5ad5e7580f5e10a3a36", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 14:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43291-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:11:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43291-1"}, "ts": "2023-07-07 14:11:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RCI9-1"}, "ts": "2023-07-07 14:11:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RCI9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:12:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 14:12:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 14:12:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 14:12:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11388-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:12:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P85037.651.651"}, "ts": "2023-07-07 14:12:20 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 14:12:25 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "66a2822f62b1f5ad5e7580f5e10a3a36", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 14:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "66a2822f62b1f5ad5e7580f5e10a3a36", "user": "Undecided", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 14:12:25 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 14:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 14:12:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-07 14:12:38 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-07 14:12:38 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 14:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-07 14:12:38 EDT-0400"}, {"api": "/site/search_init/", "req": {}, "ts": "2023-07-07 14:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "site-search", "message": "page access"}, "ts": "2023-07-07 14:12:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "site-search", "message": "page access"}, "ts": "2023-07-07 14:12:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1706597", "type": "PubMed"}, "ts": "2023-07-07 14:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1706597", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:12:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3X943", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:13:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "G3X943"}, "ts": "2023-07-07 14:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LWX9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20685009", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:13:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LWX9-1"}, "ts": "2023-07-07 14:13:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20685009", "type": "PubMed"}, "ts": "2023-07-07 14:13:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54278", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:13:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54278.96.96"}, "ts": "2023-07-07 14:13:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:13:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96L91.549.549"}, "ts": "2023-07-07 14:13:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:13:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99615.484.484"}, "ts": "2023-07-07 14:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99615", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54764", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:14:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54764"}, "ts": "2023-07-07 14:14:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86YC3"}, "ts": "2023-07-07 14:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:14:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T7W0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:14:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T7W0"}, "ts": "2023-07-07 14:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:15:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-07 14:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BN64-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:15:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BN64-1"}, "ts": "2023-07-07 14:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95707"}, "ts": "2023-07-07 14:15:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95707", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:15:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06885ZB"}, "ts": "2023-07-07 14:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06885ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:15:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5NCH9-1"}, "ts": "2023-07-07 14:15:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5NCH9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J1I3-1"}, "ts": "2023-07-07 14:16:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULP9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:16:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULP9"}, "ts": "2023-07-07 14:16:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06772YH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:16:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06772YH"}, "ts": "2023-07-07 14:16:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J1I3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:16:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23205927", "type": "PubMed"}, "ts": "2023-07-07 14:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23205927", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:16:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:16:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVC5"}, "ts": "2023-07-07 14:16:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16676006", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:16:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16676006", "type": "PubMed"}, "ts": "2023-07-07 14:16:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ75", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:17:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WZ75.230.230"}, "ts": "2023-07-07 14:17:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:17:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBW0"}, "ts": "2023-07-07 14:17:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:17:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15498"}, "ts": "2023-07-07 14:17:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15498", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:17:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75326"}, "ts": "2023-07-07 14:17:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75326", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:17:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:17:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63164"}, "ts": "2023-07-07 14:17:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63164", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WSX0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:17:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVQ4"}, "ts": "2023-07-07 14:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVQ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WSX0-1"}, "ts": "2023-07-07 14:18:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86YZ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:18:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17997974", "type": "PubMed"}, "ts": "2023-07-07 14:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17997974", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41250-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:19:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27964BX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:19:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:19:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6FHJ7"}, "ts": "2023-07-07 14:19:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6FHJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:19:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47881"}, "ts": "2023-07-07 14:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47881", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:20:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13636", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:20:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13636"}, "ts": "2023-07-07 14:20:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31000"}, "ts": "2023-07-07 14:20:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31000", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:20:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01355-1"}, "ts": "2023-07-07 14:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01355-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:20:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61216", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:20:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61216.648.648"}, "ts": "2023-07-07 14:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01850", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 14:20:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 14:20:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P01850", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 14:20:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWS1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:21:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWS1-1"}, "ts": "2023-07-07 14:21:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30397120", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:21:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30397120", "type": "PubMed"}, "ts": "2023-07-07 14:21:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A8G6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:21:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A8G6-1"}, "ts": "2023-07-07 14:21:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6Z7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:21:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6Z7"}, "ts": "2023-07-07 14:21:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A087WSX0-1"}, "ts": "2023-07-07 14:21:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A087WSX0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:21:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHI7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:21:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHI7.13.13"}, "ts": "2023-07-07 14:21:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75882.383.383"}, "ts": "2023-07-07 14:21:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75882.383.383"}, "ts": "2023-07-07 14:21:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99685", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:22:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99685"}, "ts": "2023-07-07 14:22:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXS8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:22:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXS8"}, "ts": "2023-07-07 14:22:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:22:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53168IY"}, "ts": "2023-07-07 14:22:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53168IY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:22:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38887TM"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42665KV"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78315FS"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-07 14:22:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05602KY"}, "ts": "2023-07-07 14:22:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05602KY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:22:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZWS0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:23:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZWS0"}, "ts": "2023-07-07 14:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A729", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:23:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A729"}, "ts": "2023-07-07 14:23:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-07 14:23:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G74722FL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:23:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22312GP"}, "ts": "2023-07-07 14:23:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:23:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTJ4"}, "ts": "2023-07-07 14:23:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXI9-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:24:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXI9-1.273.273"}, "ts": "2023-07-07 14:24:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3THK7-1"}, "ts": "2023-07-07 14:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3THK7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:24:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14046", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:24:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14046.393.393"}, "ts": "2023-07-07 14:24:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17021013", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:24:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17021013", "type": "PubMed"}, "ts": "2023-07-07 14:24:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20815TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:24:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:24:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:24:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWV7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:24:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWV7-1"}, "ts": "2023-07-07 14:24:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license", "message": "page access"}, "ts": "2023-07-07 14:24:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license", "message": "page access"}, "ts": "2023-07-07 14:24:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZRI0.1096.1096"}, "ts": "2023-07-07 14:25:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRI0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZJ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:25:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZJ6"}, "ts": "2023-07-07 14:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06124-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:25:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06124-2"}, "ts": "2023-07-07 14:25:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27193484", "type": "PubMed"}, "ts": "2023-07-07 14:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27193484", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:25:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43897", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:25:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43897"}, "ts": "2023-07-07 14:25:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02091-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:25:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30153-1"}, "ts": "2023-07-07 14:25:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:26:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVT6"}, "ts": "2023-07-07 14:26:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37275"}, "ts": "2023-07-07 14:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:26:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UPU3.1065.1065"}, "ts": "2023-07-07 14:26:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G04910RR"}, "ts": "2023-07-07 14:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G04910RR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 14:26:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKD9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 14:26:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9JKD9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 14:26:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25116"}, "ts": "2023-07-07 14:27:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:27:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J1I3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:27:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0B4J1I3-1"}, "ts": "2023-07-07 14:27:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08918EL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:27:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08918EL"}, "ts": "2023-07-07 14:27:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90627TW"}, "ts": "2023-07-07 14:27:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18532-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:27:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18532-1"}, "ts": "2023-07-07 14:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:28:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PT3"}, "ts": "2023-07-07 14:28:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBX3"}, "ts": "2023-07-07 14:28:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:28:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-07 14:28:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K0L0"}, "ts": "2023-07-07 14:28:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K0L0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:28:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-07 14:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:28:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 14:28:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-07 14:28:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23052ZQ"}, "ts": "2023-07-07 14:28:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67200RM"}, "ts": "2023-07-07 14:28:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q11201.201.201"}, "ts": "2023-07-07 14:28:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q11201", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:28:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31662", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:28:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31662"}, "ts": "2023-07-07 14:28:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV2"}, "ts": "2023-07-07 14:28:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9514732", "type": "PubMed"}, "ts": "2023-07-07 14:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9514732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:29:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42263", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:29:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42263"}, "ts": "2023-07-07 14:29:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:29:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13214", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 14:29:33 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q13214", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 14:29:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-07 14:29:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26493RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:29:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-07 14:29:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68529CM"}, "ts": "2023-07-07 14:29:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59848RU"}, "ts": "2023-07-07 14:29:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LWE4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LWE4"}, "ts": "2023-07-07 14:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06410KH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:29:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06410KH"}, "ts": "2023-07-07 14:29:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX07"}, "ts": "2023-07-07 14:29:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:29:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13157WZ"}, "ts": "2023-07-07 14:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13157WZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:29:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02745", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:31:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02745.17.17"}, "ts": "2023-07-07 14:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDW7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:31:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDW7.1964.1964"}, "ts": "2023-07-07 14:31:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31785", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:31:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31785"}, "ts": "2023-07-07 14:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:31:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "18440555"}, "ts": "2023-07-07 14:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 14:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02351CQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:31:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02351CQ"}, "ts": "2023-07-07 14:31:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16526-1"}, "ts": "2023-07-07 14:31:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60732.221.221"}, "ts": "2023-07-07 14:31:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16526-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:31:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60732", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:31:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95436"}, "ts": "2023-07-07 14:32:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95436", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:32:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23764", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:32:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23764"}, "ts": "2023-07-07 14:32:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:32:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29931IJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00055MO"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01055IS"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00056MO"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01534TU"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01995CB"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02273DT"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02747VH"}, "ts": "2023-07-07 14:32:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03313QW"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03756VW"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04602LA"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05302MX"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07265MJ"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10164HD"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10241ED"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10400UC"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13003UU"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14651SS"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15031WB"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16328WV"}, "ts": "2023-07-07 14:32:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:32:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:32:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G38887TM"}, "ts": "2023-07-07 14:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G38887TM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:32:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-07 14:32:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00390GQ"}, "ts": "2023-07-07 14:32:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28287CO"}, "ts": "2023-07-07 14:32:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70649KP"}, "ts": "2023-07-07 14:32:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3D6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:32:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3D6-1"}, "ts": "2023-07-07 14:32:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2KAP6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:33:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2KAP6-1"}, "ts": "2023-07-07 14:33:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27524201", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:34:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27524201", "type": "PubMed"}, "ts": "2023-07-07 14:34:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27816-1"}, "ts": "2023-07-07 14:34:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5W0N0-1"}, "ts": "2023-07-07 14:34:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5W0N0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99KE1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:34:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99KE1-1"}, "ts": "2023-07-07 14:34:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQY0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:35:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQY0"}, "ts": "2023-07-07 14:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:35:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:35:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TE77"}, "ts": "2023-07-07 14:35:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ45"}, "ts": "2023-07-07 14:35:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ45", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:35:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:35:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-07 14:35:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99741", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:35:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99741.384.384"}, "ts": "2023-07-07 14:35:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30598502", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:36:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30598502", "type": "PubMed"}, "ts": "2023-07-07 14:36:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9Q2N0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:36:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9Q2N0"}, "ts": "2023-07-07 14:36:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14844"}, "ts": "2023-07-07 14:36:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14844", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:36:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBX9-1"}, "ts": "2023-07-07 14:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBX9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:36:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60237"}, "ts": "2023-07-07 14:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9492296", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:36:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9492296", "type": "PubMed"}, "ts": "2023-07-07 14:36:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070-1"}, "ts": "2023-07-07 14:36:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12873"}, "ts": "2023-07-07 14:36:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12873", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:36:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32970"}, "ts": "2023-07-07 14:36:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13439-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:36:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13439-1"}, "ts": "2023-07-07 14:36:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RC32-1"}, "ts": "2023-07-07 14:36:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RC32-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30966", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30966"}, "ts": "2023-07-07 14:37:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08609CW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:37:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08609CW"}, "ts": "2023-07-07 14:37:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15205QB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:37:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15205QB"}, "ts": "2023-07-07 14:37:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8U9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8U9"}, "ts": "2023-07-07 14:37:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14770"}, "ts": "2023-07-07 14:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14770", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G52146XU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:37:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G52146XU"}, "ts": "2023-07-07 14:37:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00536"}, "ts": "2023-07-07 14:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00536", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNH8-1"}, "ts": "2023-07-07 14:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNH8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18653RN"}, "ts": "2023-07-07 14:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18653RN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99L47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99L47"}, "ts": "2023-07-07 14:37:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95863", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:37:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95863"}, "ts": "2023-07-07 14:37:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75882", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:37:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-07 14:37:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-07 14:37:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-07 14:37:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-07 14:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88900-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88900-1"}, "ts": "2023-07-07 14:38:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16112"}, "ts": "2023-07-07 14:38:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97878.122.122"}, "ts": "2023-07-07 14:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97878", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:38:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43852", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:38:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43852"}, "ts": "2023-07-07 14:38:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43194.313.313"}, "ts": "2023-07-07 14:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43194", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46926", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:38:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46926"}, "ts": "2023-07-07 14:38:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H4A3"}, "ts": "2023-07-07 14:38:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H4A3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:38:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HA4-1"}, "ts": "2023-07-07 14:38:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HA4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZT16-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:39:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZT16-1"}, "ts": "2023-07-07 14:39:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14181", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:39:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14181.130.130"}, "ts": "2023-07-07 14:39:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AAG8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:39:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AAG8-1"}, "ts": "2023-07-07 14:39:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:39:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:39:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBK3"}, "ts": "2023-07-07 14:39:34 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H0B8", "cluster_type": "unselected"}, "ts": "2023-07-07 14:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0B8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 14:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:39:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0B8", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 14:39:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14145"}, "ts": "2023-07-07 14:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14145", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:39:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35548", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:40:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35548.118.118"}, "ts": "2023-07-07 14:40:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-07 14:40:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:40:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55916"}, "ts": "2023-07-07 14:40:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97414", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:40:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97414.27.27"}, "ts": "2023-07-07 14:40:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "frameworks", "message": "page access"}, "ts": "2023-07-07 14:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "frameworks", "message": "page access"}, "ts": "2023-07-07 14:40:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y263"}, "ts": "2023-07-07 14:41:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:41:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99250.467.467"}, "ts": "2023-07-07 14:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99250", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y263", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27870", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:41:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27870"}, "ts": "2023-07-07 14:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1H267-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:41:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1H267-1"}, "ts": "2023-07-07 14:41:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P37275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:41:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P32322.169.169"}, "ts": "2023-07-07 14:41:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32322", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:41:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54760", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:42:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54760"}, "ts": "2023-07-07 14:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23100IR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:42:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23100IR"}, "ts": "2023-07-07 14:42:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21588"}, "ts": "2023-07-07 14:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XXA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XXA6"}, "ts": "2023-07-07 14:43:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXS4"}, "ts": "2023-07-07 14:43:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22665UT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:43:38 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22665UT"}, "ts": "2023-07-07 14:43:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16671", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:43:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16671.409.409"}, "ts": "2023-07-07 14:43:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:43:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84103", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:43:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84103"}, "ts": "2023-07-07 14:43:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U2R8-1"}, "ts": "2023-07-07 14:44:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U2R8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:44:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZCZ0-1"}, "ts": "2023-07-07 14:44:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZCZ0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:44:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26269WV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:44:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26269WV"}, "ts": "2023-07-07 14:44:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60237", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:44:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 14:45:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DT37"}, "ts": "2023-07-07 14:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DT37", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42665KV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:45:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42665KV"}, "ts": "2023-07-07 14:45:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93579XB"}, "ts": "2023-07-07 14:45:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99932KY"}, "ts": "2023-07-07 14:45:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44131LQ"}, "ts": "2023-07-07 14:45:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZL6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:45:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZL6"}, "ts": "2023-07-07 14:45:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-07 14:45:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q93075"}, "ts": "2023-07-07 14:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q93075", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:46:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DMC3"}, "ts": "2023-07-07 14:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DMC3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ABF5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ABF5-1"}, "ts": "2023-07-07 14:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2TAL5"}, "ts": "2023-07-07 14:46:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3LS21"}, "ts": "2023-07-07 14:46:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3LS21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2TAL5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:46:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:46:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06186"}, "ts": "2023-07-07 14:46:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32418"}, "ts": "2023-07-07 14:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUR5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:47:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUR5"}, "ts": "2023-07-07 14:47:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15077"}, "ts": "2023-07-07 14:47:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15077", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:47:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C0B7-1"}, "ts": "2023-07-07 14:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0B7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:47:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G41943OZ"}, "ts": "2023-07-07 14:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G41943OZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:48:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:48:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42127"}, "ts": "2023-07-07 14:48:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52569.455.455"}, "ts": "2023-07-07 14:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52569", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:48:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75027"}, "ts": "2023-07-07 14:49:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99500"}, "ts": "2023-07-07 14:49:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99500", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:49:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:49:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "g00052mo"}, "ts": "2023-07-07 14:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:49:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60866GG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:49:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17322308", "type": "PubMed"}, "ts": "2023-07-07 14:49:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17322308", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:49:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y281-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969R5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y281-1"}, "ts": "2023-07-07 14:50:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969R5"}, "ts": "2023-07-07 14:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:50:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08833-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08833-1"}, "ts": "2023-07-07 14:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07602-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07602-1"}, "ts": "2023-07-07 14:50:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:50:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:50:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-07 14:50:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49582PC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:50:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19671XU"}, "ts": "2023-07-07 14:50:54 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18717LR"}, "ts": "2023-07-07 14:50:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2TAL5"}, "ts": "2023-07-07 14:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2TAL5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:51:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HCD5.454.454"}, "ts": "2023-07-07 14:51:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:51:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96QE2.35.35"}, "ts": "2023-07-07 14:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QE2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:51:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQP3-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:51:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UQP3-1.1149.1149"}, "ts": "2023-07-07 14:51:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:51:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:51:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20212GT"}, "ts": "2023-07-07 14:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20212GT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:52:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91237TK"}, "ts": "2023-07-07 14:52:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47989", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:52:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47989.412.412"}, "ts": "2023-07-07 14:52:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:52:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CAL5"}, "ts": "2023-07-07 14:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CAL5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91237TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:52:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15109"}, "ts": "2023-07-07 14:52:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15109", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:52:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:52:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56703", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:52:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56703"}, "ts": "2023-07-07 14:52:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99KE1-1"}, "ts": "2023-07-07 14:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99KE1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:52:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61970"}, "ts": "2023-07-07 14:52:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61970", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:52:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-07 14:53:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49582PC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKB8-1"}, "ts": "2023-07-07 14:53:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKB8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIM6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:53:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIM6-1"}, "ts": "2023-07-07 14:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:53:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTN9"}, "ts": "2023-07-07 14:53:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:53:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:54:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15555", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15555"}, "ts": "2023-07-07 14:54:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-07 14:54:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58272ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:54:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83604ZB"}, "ts": "2023-07-07 14:54:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49139YY"}, "ts": "2023-07-07 14:54:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93830FP"}, "ts": "2023-07-07 14:54:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42263"}, "ts": "2023-07-07 14:54:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42263", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:54:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61789.2159.2159"}, "ts": "2023-07-07 14:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61789", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:54:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:55:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:55:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-07 14:55:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49582PC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BY49"}, "ts": "2023-07-07 14:55:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BY49", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:55:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35988"}, "ts": "2023-07-07 14:55:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A096MIV5"}, "ts": "2023-07-07 14:55:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A096MIV5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:55:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BFW9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:56:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BFW9"}, "ts": "2023-07-07 14:56:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02030ZB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 14:56:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SG3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:56:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SG3"}, "ts": "2023-07-07 14:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:56:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08481.215.215"}, "ts": "2023-07-07 14:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKA9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:56:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKA9-1"}, "ts": "2023-07-07 14:56:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98153"}, "ts": "2023-07-07 14:56:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q04756.532.532"}, "ts": "2023-07-07 14:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04756", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 14:56:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:56:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16736493", "type": "PubMed"}, "ts": "2023-07-07 14:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16736493", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 14:56:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2T2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:57:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2T2"}, "ts": "2023-07-07 14:57:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12246-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:57:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12246-1"}, "ts": "2023-07-07 14:57:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70584"}, "ts": "2023-07-07 14:58:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:58:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 14:58:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:58:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75369"}, "ts": "2023-07-07 14:58:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:59:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2K9"}, "ts": "2023-07-07 14:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:59:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13813"}, "ts": "2023-07-07 14:59:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:59:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:59:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-07 14:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:59:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VEJ4"}, "ts": "2023-07-07 14:59:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VEJ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 14:59:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZ76"}, "ts": "2023-07-07 14:59:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZ76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 14:59:47 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 15:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 15:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 15:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 15:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 15:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 15:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78364", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:00:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P78364.802.802"}, "ts": "2023-07-07 15:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXI9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:01:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXI9.273.273"}, "ts": "2023-07-07 15:01:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95425-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:01:18 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58272ZE"}, "ts": "2023-07-07 15:01:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58272ZE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:01:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95425-1"}, "ts": "2023-07-07 15:01:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01589", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:01:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01589.89.89"}, "ts": "2023-07-07 15:01:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZSY5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:01:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZSY5.420.420"}, "ts": "2023-07-07 15:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NH83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:01:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NH83.296.296"}, "ts": "2023-07-07 15:01:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2WGJ9"}, "ts": "2023-07-07 15:01:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:02:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WGJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:02:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98088"}, "ts": "2023-07-07 15:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98088", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00839", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:02:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00839"}, "ts": "2023-07-07 15:02:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-07 15:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G63110FE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:02:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15864IF"}, "ts": "2023-07-07 15:02:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38539SC"}, "ts": "2023-07-07 15:02:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35609TJ"}, "ts": "2023-07-07 15:02:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04437", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:02:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04437"}, "ts": "2023-07-07 15:02:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D31", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:02:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D31"}, "ts": "2023-07-07 15:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:02:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2K1.355.355"}, "ts": "2023-07-07 15:03:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2K1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:03:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQR6"}, "ts": "2023-07-07 15:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQR6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:03:53 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G67988RO"}, "ts": "2023-07-07 15:03:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731"}, "ts": "2023-07-07 15:04:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:04:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:04:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-07 15:04:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:04:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62165"}, "ts": "2023-07-07 15:04:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62165", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:04:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05903DN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:04:33 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05903DN"}, "ts": "2023-07-07 15:04:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A2AWA9.991.991"}, "ts": "2023-07-07 15:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AWA9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:04:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00773-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:04:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00773-1"}, "ts": "2023-07-07 15:04:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45352-1"}, "ts": "2023-07-07 15:04:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45352-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:05:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75027", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:05:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10940933", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:05:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10940933", "type": "PubMed"}, "ts": "2023-07-07 15:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00566", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00566"}, "ts": "2023-07-07 15:05:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15371"}, "ts": "2023-07-07 15:05:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPG2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "g00052mo", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:05:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NPG2.34.34"}, "ts": "2023-07-07 15:05:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CQ73"}, "ts": "2023-07-07 15:05:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CQ73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:06:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X17-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58489ZK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:06:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91X17-1"}, "ts": "2023-07-07 15:06:21 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58489ZK"}, "ts": "2023-07-07 15:06:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58489ZK"}, "ts": "2023-07-07 15:06:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03145-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:06:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q03145-1.736.736"}, "ts": "2023-07-07 15:06:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZW4.130.130"}, "ts": "2023-07-07 15:06:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZW4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:06:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NFF2.439.439"}, "ts": "2023-07-07 15:06:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFF2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:06:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H165"}, "ts": "2023-07-07 15:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H165", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:07:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFL0"}, "ts": "2023-07-07 15:07:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVU7"}, "ts": "2023-07-07 15:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVU7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:07:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00491-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:07:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00491-1"}, "ts": "2023-07-07 15:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:07:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03405", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:07:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25931565", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:07:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25931565", "type": "PubMed"}, "ts": "2023-07-07 15:07:37 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 15:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:07:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01563", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01563"}, "ts": "2023-07-07 15:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28300"}, "ts": "2023-07-07 15:08:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:08:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28300", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:08:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UKZ4.1093.1093"}, "ts": "2023-07-07 15:08:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKZ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:08:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76096"}, "ts": "2023-07-07 15:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76096", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:08:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P087", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:08:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P087"}, "ts": "2023-07-07 15:08:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P6Q2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:09:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P6Q2.21.21"}, "ts": "2023-07-07 15:09:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:09:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253"}, "ts": "2023-07-07 15:09:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13823"}, "ts": "2023-07-07 15:09:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:09:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H694", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:10:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H694.200.200"}, "ts": "2023-07-07 15:10:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10909.396.396"}, "ts": "2023-07-07 15:10:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10909", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:10:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00749"}, "ts": "2023-07-07 15:10:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G53916LT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:10:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G53916LT"}, "ts": "2023-07-07 15:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13790", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:10:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13790.139.139"}, "ts": "2023-07-07 15:10:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VC56"}, "ts": "2023-07-07 15:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VC56", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:11:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6619126", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:11:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "6619126", "type": "PubMed"}, "ts": "2023-07-07 15:11:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15691.17.17"}, "ts": "2023-07-07 15:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13362BC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:11:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15691", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:11:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13362BC"}, "ts": "2023-07-07 15:11:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96081GH"}, "ts": "2023-07-07 15:11:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96081GH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:11:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33231712", "type": "PubMed"}, "ts": "2023-07-07 15:11:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33231712", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33231712", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 15:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:11:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26196"}, "ts": "2023-07-07 15:11:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:12:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24694988", "type": "PubMed"}, "ts": "2023-07-07 15:12:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24694988", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:12:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46684", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:13:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46684"}, "ts": "2023-07-07 15:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17901057", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:13:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17901057", "type": "PubMed"}, "ts": "2023-07-07 15:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:13:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TDD5.280.280"}, "ts": "2023-07-07 15:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62816-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:13:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62816-1"}, "ts": "2023-07-07 15:13:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:13:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZU1"}, "ts": "2023-07-07 15:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q969R5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:13:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q969R5"}, "ts": "2023-07-07 15:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16905106", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:13:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16905106", "type": "PubMed"}, "ts": "2023-07-07 15:13:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15162"}, "ts": "2023-07-07 15:13:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15162", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:13:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99958"}, "ts": "2023-07-07 15:13:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99958", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:14:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96D98", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:14:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96D98"}, "ts": "2023-07-07 15:14:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64581RP"}, "ts": "2023-07-07 15:14:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15001359", "type": "PubMed"}, "ts": "2023-07-07 15:14:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15001359", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:14:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10488WF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:14:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10488WF"}, "ts": "2023-07-07 15:14:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:14:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70284-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:14:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70284-1"}, "ts": "2023-07-07 15:14:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22897", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22897"}, "ts": "2023-07-07 15:15:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6H8Q1"}, "ts": "2023-07-07 15:15:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:15:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6H8Q1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:15:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 15:15:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HB21", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:15:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HB21"}, "ts": "2023-07-07 15:15:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15207.221.221"}, "ts": "2023-07-07 15:15:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15207", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:15:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20699359", "type": "PubMed"}, "ts": "2023-07-07 15:15:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20699359", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:15:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IUD6"}, "ts": "2023-07-07 15:16:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUD6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:16:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10716"}, "ts": "2023-07-07 15:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:17:16 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 15:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:17:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:17:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PC5"}, "ts": "2023-07-07 15:17:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y561", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:17:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y561"}, "ts": "2023-07-07 15:17:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18391RR"}, "ts": "2023-07-07 15:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18391RR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:17:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33993536", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:17:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33993536", "type": "PubMed"}, "ts": "2023-07-07 15:17:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33993536", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 15:17:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LT36-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:17:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LT36-1"}, "ts": "2023-07-07 15:17:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHW0-1"}, "ts": "2023-07-07 15:17:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHW0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:18:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7634337", "type": "PubMed"}, "ts": "2023-07-07 15:18:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7634337", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:18:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WV37", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:18:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WV37.2.2"}, "ts": "2023-07-07 15:18:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G44029SF"}, "ts": "2023-07-07 15:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G44029SF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:19:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14829"}, "ts": "2023-07-07 15:19:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14829", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:19:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924X6"}, "ts": "2023-07-07 15:19:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924X6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:19:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G67988RO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:19:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19493659", "type": "PubMed"}, "ts": "2023-07-07 15:20:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19493659", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWA0"}, "ts": "2023-07-07 15:20:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWA0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:20:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11217"}, "ts": "2023-07-07 15:20:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11217", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:20:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13790-1"}, "ts": "2023-07-07 15:21:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05090-1"}, "ts": "2023-07-07 15:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13790-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:21:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:21:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BW5"}, "ts": "2023-07-07 15:21:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14511"}, "ts": "2023-07-07 15:21:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14511", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12874", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:21:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12874"}, "ts": "2023-07-07 15:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19959814", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:21:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19959814", "type": "PubMed"}, "ts": "2023-07-07 15:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:21:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHR5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:21:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHR5.273.273"}, "ts": "2023-07-07 15:21:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9697832", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:21:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9697832", "type": "PubMed"}, "ts": "2023-07-07 15:21:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05374TU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:22:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05374TU"}, "ts": "2023-07-07 15:22:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60468", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:22:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P60468.9.9"}, "ts": "2023-07-07 15:22:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:22:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B4DS77"}, "ts": "2023-07-07 15:22:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B4DS77", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:22:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37802"}, "ts": "2023-07-07 15:22:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D112", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:23:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D112"}, "ts": "2023-07-07 15:23:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96C10-1"}, "ts": "2023-07-07 15:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96C10-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:23:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A7"}, "ts": "2023-07-07 15:23:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:23:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G62182OO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:24:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G62182OO"}, "ts": "2023-07-07 15:24:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17107VB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:24:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17107VB"}, "ts": "2023-07-07 15:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZH0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:24:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZH0"}, "ts": "2023-07-07 15:24:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11113196", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:25:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11113196", "type": "PubMed"}, "ts": "2023-07-07 15:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:25:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35749"}, "ts": "2023-07-07 15:25:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:25:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9P6"}, "ts": "2023-07-07 15:25:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46937-1"}, "ts": "2023-07-07 15:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99653", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 15:26:11 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99653", "cluster_type": "unselected"}, "ts": "2023-07-07 15:26:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99653", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-07 15:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1Z7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:26:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5U1Z7"}, "ts": "2023-07-07 15:26:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00749", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:26:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9842986", "type": "PubMed"}, "ts": "2023-07-07 15:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9842986", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R2Z5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R2Z5-1"}, "ts": "2023-07-07 15:27:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR75", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:27:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR75"}, "ts": "2023-07-07 15:27:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q1W617.412.412"}, "ts": "2023-07-07 15:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q1W617", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:27:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PEX3-1"}, "ts": "2023-07-07 15:27:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PEX3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:27:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TF42.23.23"}, "ts": "2023-07-07 15:28:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF42", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:28:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81827"}, "ts": "2023-07-07 15:28:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80TG9"}, "ts": "2023-07-07 15:28:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:28:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q17RH7"}, "ts": "2023-07-07 15:28:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:28:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADT2"}, "ts": "2023-07-07 15:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q17RH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:28:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PV4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:29:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PV4"}, "ts": "2023-07-07 15:29:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SQ64", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:29:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SQ64"}, "ts": "2023-07-07 15:29:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99MZ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:29:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99MZ6-1"}, "ts": "2023-07-07 15:29:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G13659RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:29:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G13659RH"}, "ts": "2023-07-07 15:29:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8ND83", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTE8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTE8"}, "ts": "2023-07-07 15:29:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8ND83"}, "ts": "2023-07-07 15:29:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98164", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:29:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98164.1279.1279"}, "ts": "2023-07-07 15:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64581RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:29:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19553991", "type": "PubMed"}, "ts": "2023-07-07 15:29:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19553991", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:29:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61604"}, "ts": "2023-07-07 15:30:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61604", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:30:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZSZ5-4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:30:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZSZ5-4"}, "ts": "2023-07-07 15:30:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NP56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:30:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NP56"}, "ts": "2023-07-07 15:30:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q10980"}, "ts": "2023-07-07 15:30:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08431-1.264.264"}, "ts": "2023-07-07 15:30:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08431-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:30:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5F0"}, "ts": "2023-07-07 15:31:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:31:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08588"}, "ts": "2023-07-07 15:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10716", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:32:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64430-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:32:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64430-1"}, "ts": "2023-07-07 15:32:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9192846", "type": "PubMed"}, "ts": "2023-07-07 15:32:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:32:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9192846", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9192846", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; Googlebot/2.1;  http://www.google.com/bot.html) Chrome/114.0.5735.179 Safari/537.36"}, "ts": "2023-07-07 15:33:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEY7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:33:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TEY7-1"}, "ts": "2023-07-07 15:33:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96DH6.24.24"}, "ts": "2023-07-07 15:33:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DH6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:33:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20489-1"}, "ts": "2023-07-07 15:34:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0I4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:34:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0I4"}, "ts": "2023-07-07 15:34:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JXI5"}, "ts": "2023-07-07 15:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JXI5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:34:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFU7"}, "ts": "2023-07-07 15:34:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFU7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:34:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A5A2"}, "ts": "2023-07-07 15:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A5A2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:35:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85973-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:35:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P85973-1"}, "ts": "2023-07-07 15:35:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "8390533"}, "ts": "2023-07-07 15:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 15:35:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07008", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:35:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07008"}, "ts": "2023-07-07 15:35:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05093-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:35:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05093-1"}, "ts": "2023-07-07 15:35:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99JY4"}, "ts": "2023-07-07 15:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99JY4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:36:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIG2"}, "ts": "2023-07-07 15:36:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIG2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:36:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04439", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:36:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P04439.121.121"}, "ts": "2023-07-07 15:36:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59646"}, "ts": "2023-07-07 15:36:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59646", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:36:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86Y78", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:36:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86Y78"}, "ts": "2023-07-07 15:36:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96081GH"}, "ts": "2023-07-07 15:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96081GH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:36:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P2H3"}, "ts": "2023-07-07 15:36:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2H3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:36:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51787", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:36:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51787"}, "ts": "2023-07-07 15:36:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16222710", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:37:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16222710", "type": "PubMed"}, "ts": "2023-07-07 15:37:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:37:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NA03"}, "ts": "2023-07-07 15:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA03", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N6Y2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:37:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N6Y2"}, "ts": "2023-07-07 15:37:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18250157", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNB5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:37:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18250157", "type": "PubMed"}, "ts": "2023-07-07 15:37:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNB5-1"}, "ts": "2023-07-07 15:37:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86UP2"}, "ts": "2023-07-07 15:37:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZS10", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:37:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZS10"}, "ts": "2023-07-07 15:37:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61937QU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:37:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61937QU"}, "ts": "2023-07-07 15:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CYR0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:37:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CYR0"}, "ts": "2023-07-07 15:37:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20308428", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:37:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20308428", "type": "PubMed"}, "ts": "2023-07-07 15:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14829", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:37:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14829.550.550"}, "ts": "2023-07-07 15:37:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "36735681", "type": "PubMed"}, "ts": "2023-07-07 15:37:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "36735681", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:37:58 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-07 15:38:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 15:38:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 15:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:38:02 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 15:38:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:38:02 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-07 15:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-07 15:38:06 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 15:38:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-07 15:38:23 EDT-0400"}, {"api": "/usecases/species_to_glycoproteins/", "req": {"tax_id": 9606, "evidence_type": "predicted"}, "ts": "2023-07-07 15:38:23 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11679NT"}, "ts": "2023-07-07 15:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75792", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:38:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75792"}, "ts": "2023-07-07 15:38:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8496ef585f9ef47a610ec3ea099bf851", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "Quick Search Question_10 = /9606/[object Object]"}, "ts": "2023-07-07 15:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11679NT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:38:33 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 15:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8496ef585f9ef47a610ec3ea099bf851", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 15:38:33 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "8496ef585f9ef47a610ec3ea099bf851", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 15:38:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48730"}, "ts": "2023-07-07 15:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:38:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05556-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:38:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05556-1"}, "ts": "2023-07-07 15:38:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30769VJ"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70101JE"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79286RS"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25987BV"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00406II"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06110VR"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12313PD"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25079LO"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39619TI"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43769HG"}, "ts": "2023-07-07 15:39:00 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48584BU"}, "ts": "2023-07-07 15:39:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60177UT"}, "ts": "2023-07-07 15:39:01 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62894KT"}, "ts": "2023-07-07 15:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:39:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P2Q9.1875.1875"}, "ts": "2023-07-07 15:39:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2Q9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:39:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU68"}, "ts": "2023-07-07 15:39:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZI1"}, "ts": "2023-07-07 15:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZI1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:39:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPN9"}, "ts": "2023-07-07 15:39:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPN9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:39:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27541374", "type": "PubMed"}, "ts": "2023-07-07 15:40:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27541374", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 15:40:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71013KY"}, "ts": "2023-07-07 15:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27541374", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05365PX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:40:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05365PX"}, "ts": "2023-07-07 15:40:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75506"}, "ts": "2023-07-07 15:41:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75506", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P39880"}, "ts": "2023-07-07 15:41:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P9P6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P9P6"}, "ts": "2023-07-07 15:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXU4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXU4"}, "ts": "2023-07-07 15:41:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10619025", "type": "PubMed"}, "ts": "2023-07-07 15:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10619025", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08729"}, "ts": "2023-07-07 15:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08729", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11230", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11230"}, "ts": "2023-07-07 15:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K6D5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K6D5-1"}, "ts": "2023-07-07 15:41:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46937-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:41:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BSL4"}, "ts": "2023-07-07 15:42:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BSL4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:42:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54098", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:42:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54098.232.232"}, "ts": "2023-07-07 15:42:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22455"}, "ts": "2023-07-07 15:42:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04351"}, "ts": "2023-07-07 15:42:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79286RS"}, "ts": "2023-07-07 15:42:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66163OV"}, "ts": "2023-07-07 15:42:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-07 15:42:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25987BV"}, "ts": "2023-07-07 15:42:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-07 15:42:41 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-07 15:42:45 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 15:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-07 15:42:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "Performing Quick Search"}, "ts": "2023-07-07 15:42:58 EDT-0400"}, {"api": "/usecases/species_to_glycoproteins/", "req": {"tax_id": 9606, "evidence_type": "both"}, "ts": "2023-07-07 15:42:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">969ba2cf86f22175795575b9750e415b", "user": "Anonymous", "type": "user", "page": "quick-search", "message": "Quick Search Question_10 = /9606/[object Object]"}, "ts": "2023-07-07 15:43:18 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 15:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "969ba2cf86f22175795575b9750e415b", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 15:43:18 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "969ba2cf86f22175795575b9750e415b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 15:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SF2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:43:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86SF2"}, "ts": "2023-07-07 15:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 15:43:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15954", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:43:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15954"}, "ts": "2023-07-07 15:43:24 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P08934", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 15:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08934", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 15:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-07 15:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:43:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0MZ66"}, "ts": "2023-07-07 15:43:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0MZ66", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:43:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08649"}, "ts": "2023-07-07 15:43:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:43:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55347"}, "ts": "2023-07-07 15:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07091", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:44:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07091"}, "ts": "2023-07-07 15:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29901779", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:44:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29901779", "type": "PubMed"}, "ts": "2023-07-07 15:44:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZP9.318.318"}, "ts": "2023-07-07 15:44:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZP9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:44:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:44:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWU5"}, "ts": "2023-07-07 15:44:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "969ba2cf86f22175795575b9750e415b", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 15:45:15 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 15:45:15 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "969ba2cf86f22175795575b9750e415b", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 15:45:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QZA6"}, "ts": "2023-07-07 15:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QZA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:45:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50990-1"}, "ts": "2023-07-07 15:45:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8668213", "type": "PubMed"}, "ts": "2023-07-07 15:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8668213", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04275-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:45:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04275-1"}, "ts": "2023-07-07 15:45:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04784US"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07799LX"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06330RB"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08293MJ"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11629QQ"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15038BD"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15169WU"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20312EM"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29279QO"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33567AB"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39595FH"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41044JW"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 15:45:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51413EV"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75568BH"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77582RK"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16175ZV"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-07 15:45:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q66HA4-1"}, "ts": "2023-07-07 15:45:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q66HA4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:46:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43116"}, "ts": "2023-07-07 15:46:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06787.194.194"}, "ts": "2023-07-07 15:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06787", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:46:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9192846", "type": "PubMed"}, "ts": "2023-07-07 15:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9192846", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:46:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9192846", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 15:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q10980", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:46:37 EDT-0400"}, {"api": "/job/init/", "req": {}, "ts": "2023-07-07 15:47:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "page access"}, "ts": "2023-07-07 15:47:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43303"}, "ts": "2023-07-07 15:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:47:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R7I5-1"}, "ts": "2023-07-07 15:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R7I5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59649-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:47:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59649-1"}, "ts": "2023-07-07 15:47:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00338"}, "ts": "2023-07-07 15:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "blast", "message": "Performing Blast Search.Blast Search query={\"jobtype\":\"blastp\",\"parameters\":{\"seq\":\"CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED\",\"targetdb\":\"canonicalsequences_all\",\"evalue\":0.001,\"num_alignments\":250}}"}, "ts": "2023-07-07 15:48:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41236", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:48:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41236.73.73"}, "ts": "2023-07-07 15:48:00 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "blastp", "parameters": {"seq": "CGTPCNLCCRSLSYPDEECNEACLGECFCPPGLYRERGDCVPKAQCPCYYDGEIFQPED", "targetdb": "canonicalsequences_all", "evalue": 0.001, "num_alignments": 250}}}, "ts": "2023-07-07 15:48:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P97438.348.348"}, "ts": "2023-07-07 15:48:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97438", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:48:02 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 11}, "ts": "2023-07-07 15:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">11", "user": "Anonymous", "type": "user", "page": "blast", "message": "Blast Search query=11"}, "ts": "2023-07-07 15:48:03 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 11}, "ts": "2023-07-07 15:48:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11", "user": "Anonymous", "type": "user", "page": "blast-result", "message": "page access"}, "ts": "2023-07-07 15:48:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11", "user": "Anonymous", "type": "error", "page": "blast-result", "message": "Protein object with no sequences array: P04275-1, Q8CIZ8-1, Q7Z5P9-1, Q6PZE0-1, Q8CG65-1, Q700K0-1, A2VEC9-1, Q80T03-1, A0A0G2K8X5-1, E9QAQ8-1, Q6W4X9-1, F1LY16-1, Q6ZRI0-1, E9Q9C6-1, F7A4A7-1, Q9Y6R7-1, Q9VU94-1, D3ZJF8-1, E9Q5I3-1, Q9HC84-1, Q02817-1, Q3ZCN5-1, D4A6I9-1, Q9EPU5-1, Q80Z19-1, D3ZF92-1"}, "ts": "2023-07-07 15:48:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y653.324.324"}, "ts": "2023-07-07 15:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y653", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:48:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:48:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7.1764.1764"}, "ts": "2023-07-07 15:48:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08588", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:48:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52194.595.595"}, "ts": "2023-07-07 15:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52194", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:48:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16270"}, "ts": "2023-07-07 15:48:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16270", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:48:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16096642", "type": "PubMed"}, "ts": "2023-07-07 15:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16096642", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:48:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BJE2"}, "ts": "2023-07-07 15:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJE2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:49:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61421-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:49:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61421-1"}, "ts": "2023-07-07 15:49:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19151RP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:49:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:49:43 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19151RP"}, "ts": "2023-07-07 15:49:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25114259", "type": "PubMed"}, "ts": "2023-07-07 15:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25114259", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:49:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06731"}, "ts": "2023-07-07 15:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXX5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXX5"}, "ts": "2023-07-07 15:50:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3N1"}, "ts": "2023-07-07 15:50:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3N1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:50:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20489-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:50:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BZT9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BZT9"}, "ts": "2023-07-07 15:50:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13061"}, "ts": "2023-07-07 15:51:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22003"}, "ts": "2023-07-07 15:51:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-07 15:51:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:51:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UM44.103.103"}, "ts": "2023-07-07 15:51:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM44", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:51:20 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-07 15:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98809PE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:52:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98809PE"}, "ts": "2023-07-07 15:52:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G71516NY"}, "ts": "2023-07-07 15:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G71516NY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:52:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:52:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N349.260.260"}, "ts": "2023-07-07 15:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N349", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXI9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:52:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UXI9.273.273"}, "ts": "2023-07-07 15:52:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01139"}, "ts": "2023-07-07 15:52:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07759-1"}, "ts": "2023-07-07 15:52:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17685635", "type": "PubMed"}, "ts": "2023-07-07 15:53:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17685635", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:53:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZAB3-1"}, "ts": "2023-07-07 15:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZAB3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:53:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07602-1"}, "ts": "2023-07-07 15:53:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07602-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:53:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00335DM"}, "ts": "2023-07-07 15:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00335DM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:53:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3X0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:54:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3X0-1"}, "ts": "2023-07-07 15:54:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2TAL5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:54:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2TAL5"}, "ts": "2023-07-07 15:54:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42262"}, "ts": "2023-07-07 15:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42262", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:54:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09382"}, "ts": "2023-07-07 15:54:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09382", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:54:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80X19.94.94"}, "ts": "2023-07-07 15:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80X19", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:54:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15073379", "type": "PubMed"}, "ts": "2023-07-07 15:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15073379", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:55:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZRI9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 15:55:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZRI9"}, "ts": "2023-07-07 15:55:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6YHK3.513.513"}, "ts": "2023-07-07 15:55:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6YHK3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:55:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48552"}, "ts": "2023-07-07 15:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A9U6-1"}, "ts": "2023-07-07 15:56:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A9U6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:56:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99677", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:56:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99677.367.367"}, "ts": "2023-07-07 15:56:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47871", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:56:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P47871.209.209"}, "ts": "2023-07-07 15:56:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56390QA"}, "ts": "2023-07-07 15:56:58 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 15:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56390QA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:56:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-07 15:56:59 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 15:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 15:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 15:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A961-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:57:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A961-1"}, "ts": "2023-07-07 15:57:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39880", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:57:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32418"}, "ts": "2023-07-07 15:57:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32418", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:57:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZT1-1.1337.1337"}, "ts": "2023-07-07 15:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZT1-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-07 15:57:18 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 15:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 15:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:57:38 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 15:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 15:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 15:57:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26283732", "type": "PubMed"}, "ts": "2023-07-07 15:57:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26283732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:57:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96DU3.178.178"}, "ts": "2023-07-07 15:57:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96DU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:57:51 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked"}, "ts": "2023-07-07 15:58:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 15:58:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\"}"}, "ts": "2023-07-07 15:58:06 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 15:58:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49854OS"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16370GQ"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00033MO"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64973KT"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47180UC"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94435QH"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11457RF"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12396GB"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07677VL"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60890ZT"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42797SX"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56682BC"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97345NY"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46748BU"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70994MS"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00031MO"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01614ZM"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65562ZE"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 15:58:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29068FM"}, "ts": "2023-07-07 15:58:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 15:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 15:58:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G11563PZ"}, "ts": "2023-07-07 15:58:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G11563PZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:58:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JKK7"}, "ts": "2023-07-07 15:58:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JKK7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04351", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00033MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:58:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 21, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 15:58:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85608AG"}, "ts": "2023-07-07 15:58:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00035MO"}, "ts": "2023-07-07 15:58:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59126YU"}, "ts": "2023-07-07 15:58:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77477NL"}, "ts": "2023-07-07 15:58:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32723SL"}, "ts": "2023-07-07 15:58:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94514IB"}, "ts": "2023-07-07 15:58:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34100DU"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25780HH"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63334FZ"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94217FB"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01457KB"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86537AD"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25323VU"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91875JA"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33508VK"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41245OZ"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04765GH"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30871VQ"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41424HD"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43059PA"}, "ts": "2023-07-07 15:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 15:59:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-07 15:59:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8132774", "type": "PubMed"}, "ts": "2023-07-07 15:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8132774", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 15:59:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08254"}, "ts": "2023-07-07 15:59:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08254", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:59:28 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 15:59:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 15:59:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 15:59:32 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G75789AR"}, "ts": "2023-07-07 15:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 15:59:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G75789AR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 15:59:33 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 1"}, "ts": "2023-07-07 15:59:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 15:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36>56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 1\"}"}, "ts": "2023-07-07 15:59:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 15:59:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 15:59:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32948PW"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63110FE"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21507RO"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09480OP"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97263AV"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26341TZ"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48818KL"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54499HR"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10225UW"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49582PC"}, "ts": "2023-07-07 15:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 15:59:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35916.292.292"}, "ts": "2023-07-07 15:59:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35916", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 15:59:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02311IE"}, "ts": "2023-07-07 15:59:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 16:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 16:00:01 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:00:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 16:00:02 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 16:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 16:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 16:00:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AD5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 16:00:09 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96AD5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 16:00:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "page access"}, "ts": "2023-07-07 16:00:20 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 16:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 16:00:22 EDT-0400"}, {"api": "/protein/search_simple/", "req": {"operation": "AND", "query_type": "protein_search_simple", "term": "P14210", "term_category": "any"}, "ts": "2023-07-07 16:00:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"protein_search_simple\",\"term\":\"P14210\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 16:00:23 EDT-0400"}, {"api": "/protein/search_init/", "req": {}, "ts": "2023-07-07 16:00:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "user": "Anonymous", "type": "user", "page": "protein-list", "message": "page access"}, "ts": "2023-07-07 16:00:23 EDT-0400"}, {"api": "/protein/list/", "req": {"id": "7e3135295dec0af9332438bb84be0ded", "offset": 1, "limit": 20, "order": "desc", "sort": "hit_score", "filters": []}, "ts": "2023-07-07 16:00:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:00:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-07 16:00:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00441"}, "ts": "2023-07-07 16:00:30 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19059PI"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52126RR"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48414YA"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57789QC"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60542VK"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64394MX"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74239ZQ"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89664KV"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93656SY"}, "ts": "2023-07-07 16:00:34 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 16:00:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-07 16:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-07 16:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-07 16:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83385WA"}, "ts": "2023-07-07 16:00:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69616RY"}, "ts": "2023-07-07 16:00:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQB8"}, "ts": "2023-07-07 16:00:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:00:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:00:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02787", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:00:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P02787.491.491"}, "ts": "2023-07-07 16:00:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q05084-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:01:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q05084-1"}, "ts": "2023-07-07 16:01:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CRA0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:01:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CRA0"}, "ts": "2023-07-07 16:01:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:01:14 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G42039FI"}, "ts": "2023-07-07 16:01:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G42039FI", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07920ZX"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08679EM"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21513QX"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14888AE"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11745XZ"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22571UF"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26264SQ"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26800YB"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34508UC"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34946TH"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49089LF"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50159UX"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50278HE"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52946YT"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56749GV"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57149TQ"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16276PY"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57647XA"}, "ts": "2023-07-07 16:01:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20559VV"}, "ts": "2023-07-07 16:01:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50990-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:01:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75475"}, "ts": "2023-07-07 16:01:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75475", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:01:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-07 16:01:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:01:35 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H6U8.465.465"}, "ts": "2023-07-07 16:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6U8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:01:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LW07"}, "ts": "2023-07-07 16:01:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LW07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:01:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75154.619.619"}, "ts": "2023-07-07 16:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75154", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:01:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G77252PU", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:01:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G77252PU"}, "ts": "2023-07-07 16:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8612632", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:01:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49174JP"}, "ts": "2023-07-07 16:01:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97599MN"}, "ts": "2023-07-07 16:01:55 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73366EA"}, "ts": "2023-07-07 16:01:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8612632", "type": "PubMed"}, "ts": "2023-07-07 16:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14210-1", "user": "Anonymous", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:02:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14210-1"}, "ts": "2023-07-07 16:02:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "I1YAP6"}, "ts": "2023-07-07 16:02:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "I1YAP6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:02:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:02:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5A9"}, "ts": "2023-07-07 16:02:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:02:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64487", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:02:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64487"}, "ts": "2023-07-07 16:02:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBB6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:02:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UBB6.2.2"}, "ts": "2023-07-07 16:02:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JJP6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:02:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JJP6-1"}, "ts": "2023-07-07 16:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWY3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:02:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WWY3"}, "ts": "2023-07-07 16:02:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01543ZX", "user": "Anonymous", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:02:48 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01543ZX"}, "ts": "2023-07-07 16:02:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25569EP"}, "ts": "2023-07-07 16:02:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58076ER"}, "ts": "2023-07-07 16:02:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44246UD"}, "ts": "2023-07-07 16:02:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10228OD"}, "ts": "2023-07-07 16:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62765SF"}, "ts": "2023-07-07 16:03:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16150CJ"}, "ts": "2023-07-07 16:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85037", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:03:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P85037.651.651"}, "ts": "2023-07-07 16:03:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60829", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:03:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60829.7.7"}, "ts": "2023-07-07 16:03:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00338", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:03:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10432285", "type": "PubMed"}, "ts": "2023-07-07 16:04:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10432285", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:04:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10432285", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 16:04:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:04:08 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 2"}, "ts": "2023-07-07 16:04:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36>94b8778ba354d23833e8125befc5186e", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 2\"}"}, "ts": "2023-07-07 16:04:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "94b8778ba354d23833e8125befc5186e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:04:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "94b8778ba354d23833e8125befc5186e", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:04:09 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:04:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:04:20 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 3"}, "ts": "2023-07-07 16:04:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:04:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36>8a527fd18dffa0f24e3fe5a7cc2280c6", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 3\"}"}, "ts": "2023-07-07 16:04:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8a527fd18dffa0f24e3fe5a7cc2280c6", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:04:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8a527fd18dffa0f24e3fe5a7cc2280c6", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:04:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23438NR"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61889LW"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45939NL"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39247UK"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07932PU"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73423PD"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03494YC"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51140AE"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38684VZ"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69233PF"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03674DU"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23870PO"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03172PR"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30304IT"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49277CJ"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64931FF"}, "ts": "2023-07-07 16:04:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15247289", "type": "PubMed"}, "ts": "2023-07-07 16:04:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15247289", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:04:36 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:04:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:04:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:04:46 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 4"}, "ts": "2023-07-07 16:04:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36>4d572199ea93f0484520ad7be11b32ed", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 4\"}"}, "ts": "2023-07-07 16:04:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4d572199ea93f0484520ad7be11b32ed", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:04:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4d572199ea93f0484520ad7be11b32ed", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:04:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51984GX"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47325XO"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71990XF"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38466KL"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70528XB"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85282JA"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85243CH"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96416NB"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31317XB"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80690PN"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23990GP"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40778XV"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97561SL"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97463WM"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98007XA"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58240EV"}, "ts": "2023-07-07 16:04:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89720WL"}, "ts": "2023-07-07 16:04:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49874UX"}, "ts": "2023-07-07 16:04:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60145BJ"}, "ts": "2023-07-07 16:04:48 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:04:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:04:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RD67-1"}, "ts": "2023-07-07 16:04:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RD67-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:04:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9688835", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:05:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9688835", "type": "PubMed"}, "ts": "2023-07-07 16:05:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HA47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:05:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HA47"}, "ts": "2023-07-07 16:05:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQ86"}, "ts": "2023-07-07 16:05:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQ86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:05:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01796-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:05:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01796-1"}, "ts": "2023-07-07 16:05:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49419"}, "ts": "2023-07-07 16:05:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49419", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBV8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:05:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBV8"}, "ts": "2023-07-07 16:05:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G98199HS"}, "ts": "2023-07-07 16:05:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G98199HS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:05:31 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 16:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 16:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 16:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75616", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:05:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75616"}, "ts": "2023-07-07 16:05:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NRM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:05:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NRM6"}, "ts": "2023-07-07 16:05:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27540"}, "ts": "2023-07-07 16:05:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27540", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:06:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P069", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:06:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P069"}, "ts": "2023-07-07 16:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TAX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:06:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TAX3"}, "ts": "2023-07-07 16:06:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P68036", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:06:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P68036"}, "ts": "2023-07-07 16:06:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03344", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:06:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00031MO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:06:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5L9.383.383"}, "ts": "2023-07-07 16:06:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03344"}, "ts": "2023-07-07 16:06:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5L9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:06:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RE11-1"}, "ts": "2023-07-07 16:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RE11-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:07:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14166.157.157"}, "ts": "2023-07-07 16:07:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14166", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:07:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CR67-1"}, "ts": "2023-07-07 16:07:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CR67-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:07:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15274.269.269"}, "ts": "2023-07-07 16:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15274", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:07:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G27391WQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:07:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVM5"}, "ts": "2023-07-07 16:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVM5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:07:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Anonymous", "type": "user", "page": "resources", "message": "page access"}, "ts": "2023-07-07 16:07:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5J3L4"}, "ts": "2023-07-07 16:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5J3L4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:08:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P20036.158.158"}, "ts": "2023-07-07 16:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20036", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A1W2P7T6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:08:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A1W2P7T6"}, "ts": "2023-07-07 16:08:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29317"}, "ts": "2023-07-07 16:08:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12393471", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:08:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12393471", "type": "PubMed"}, "ts": "2023-07-07 16:08:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28286305", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:08:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28286305", "type": "PubMed"}, "ts": "2023-07-07 16:08:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:08:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40306"}, "ts": "2023-07-07 16:08:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40306", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6U3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:08:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6U3"}, "ts": "2023-07-07 16:08:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01139", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07759-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:08:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2387072", "type": "PubMed"}, "ts": "2023-07-07 16:09:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2387072", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:09:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3860845", "type": "PubMed"}, "ts": "2023-07-07 16:09:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3860845", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:09:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91542NW"}, "ts": "2023-07-07 16:09:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99805"}, "ts": "2023-07-07 16:10:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10958673", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:10:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10958673", "type": "PubMed"}, "ts": "2023-07-07 16:10:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15726", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:10:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15726"}, "ts": "2023-07-07 16:10:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72539IR"}, "ts": "2023-07-07 16:10:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72539IR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:10:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95045", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:10:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95045"}, "ts": "2023-07-07 16:10:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62414-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:11:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62414-1"}, "ts": "2023-07-07 16:11:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G45209NR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:11:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75396.172.172"}, "ts": "2023-07-07 16:11:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75396", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:11:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58340", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:11:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58340"}, "ts": "2023-07-07 16:11:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48552", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:12:01 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 16:12:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 16:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 16:12:27 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:12:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1699755", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:12:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1699755", "type": "PubMed"}, "ts": "2023-07-07 16:12:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22124266", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:13:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22124266", "type": "PubMed"}, "ts": "2023-07-07 16:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25367879", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:13:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25367879", "type": "PubMed"}, "ts": "2023-07-07 16:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47993", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:13:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47993"}, "ts": "2023-07-07 16:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K592-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:13:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K592-1"}, "ts": "2023-07-07 16:13:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42127"}, "ts": "2023-07-07 16:13:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88888", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:13:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O88888.168.168"}, "ts": "2023-07-07 16:13:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42127", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:13:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62246-1"}, "ts": "2023-07-07 16:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62246-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:14:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5RKG6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:14:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5RKG6-1"}, "ts": "2023-07-07 16:14:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3GSH5-1"}, "ts": "2023-07-07 16:14:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02563-1"}, "ts": "2023-07-07 16:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02563-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3GSH5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:14:24 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96921ZU"}, "ts": "2023-07-07 16:14:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7X2"}, "ts": "2023-07-07 16:14:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7X2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:14:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XXA6"}, "ts": "2023-07-07 16:14:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XXA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16508246", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:14:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16508246", "type": "PubMed"}, "ts": "2023-07-07 16:14:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G03757EK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:14:45 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G03757EK"}, "ts": "2023-07-07 16:14:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BW1"}, "ts": "2023-07-07 16:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:14:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94907"}, "ts": "2023-07-07 16:15:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94907", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:15:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09118"}, "ts": "2023-07-07 16:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09118", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00487-1"}, "ts": "2023-07-07 16:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00487-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Substructure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:o-dglc-HEX-0:0|1:aldi\\n2s:n-acetyl\\n3b:b-dgal-HEX-1:5\\n4s:n-acetyl\\n5s:sulfate\\nLIN\\n1:1d(2 1)2n\\n2:1o(4 1)3d\\n3:3d(2 1)4n\\n4:3d(4 1)5n\",\"align\":\"substructure\"}}"}, "ts": "2023-07-07 16:15:51 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:o-dglc-HEX-0:0|1:aldi\n2s:n-acetyl\n3b:b-dgal-HEX-1:5\n4s:n-acetyl\n5s:sulfate\nLIN\n1:1d(2+1)2n\n2:1o(4+1)3d\n3:3d(2+1)4n\n4:3d(4+1)5n", "align": "substructure"}}}, "ts": "2023-07-07 16:15:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A1Z1-1"}, "ts": "2023-07-07 16:15:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A1Z1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:15:58 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 12}, "ts": "2023-07-07 16:15:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1U4.207.207"}, "ts": "2023-07-07 16:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1U4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02311IE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "No results. Substructure Search query=12"}, "ts": "2023-07-07 16:15:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 16:16:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKV8", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 16:16:23 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UKV8", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 16:16:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00441", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08727", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:16:30 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06552FO"}, "ts": "2023-07-07 16:16:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06552FO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:16:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08727"}, "ts": "2023-07-07 16:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N488", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:16:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N488.227.227"}, "ts": "2023-07-07 16:16:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G78059CC"}, "ts": "2023-07-07 16:17:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51168"}, "ts": "2023-07-07 16:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51168", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:17:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Structure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:b-dglc-HEX-1:5\\n2s:n-acetyl\\n3b:b-dgal-HEX-1:5\\n4s:n-acetyl\\n5s:sulfate\\nLIN\\n1:1d(2 1)2n\\n2:1o(4 1)3d\\n3:3d(2 1)4n\\n4:3d(4 1)5n\",\"align\":\"wholeglycan\"}}"}, "ts": "2023-07-07 16:17:37 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:b-dglc-HEX-1:5\n2s:n-acetyl\n3b:b-dgal-HEX-1:5\n4s:n-acetyl\n5s:sulfate\nLIN\n1:1d(2+1)2n\n2:1o(4+1)3d\n3:3d(2+1)4n\n4:3d(4+1)5n", "align": "wholeglycan"}}}, "ts": "2023-07-07 16:17:37 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 13}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 13}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">13", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Structure Search query=13 undefined undefined"}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "e790c150d846420fcb5b9b735647bf3e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "e790c150d846420fcb5b9b735647bf3e", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31301MT"}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95944BZ"}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09409BX"}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87413DB"}, "ts": "2023-07-07 16:17:40 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:17:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L15", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:17:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96L15.196.196"}, "ts": "2023-07-07 16:17:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWQ3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:18:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWQ3"}, "ts": "2023-07-07 16:18:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Substructure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:b-dglc-HEX-1:5\\n2s:n-acetyl\\n3b:b-dgal-HEX-1:5\\n4s:n-acetyl\\n5s:sulfate\\nLIN\\n1:1d(2 1)2n\\n2:1o(4 1)3d\\n3:3d(2 1)4n\\n4:3d(4 1)5n\",\"align\":\"substructure\"}}"}, "ts": "2023-07-07 16:18:19 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:b-dglc-HEX-1:5\n2s:n-acetyl\n3b:b-dgal-HEX-1:5\n4s:n-acetyl\n5s:sulfate\nLIN\n1:1d(2+1)2n\n2:1o(4+1)3d\n3:3d(2+1)4n\n4:3d(4+1)5n", "align": "substructure"}}}, "ts": "2023-07-07 16:18:19 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 14}, "ts": "2023-07-07 16:18:21 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 14}, "ts": "2023-07-07 16:18:23 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 14}, "ts": "2023-07-07 16:18:25 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 14}, "ts": "2023-07-07 16:18:27 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 14}, "ts": "2023-07-07 16:18:29 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 14}, "ts": "2023-07-07 16:18:31 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 14}, "ts": "2023-07-07 16:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">14", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Substructure Search query=14 undefined undefined"}, "ts": "2023-07-07 16:18:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7c99246b71ab331ef93e12802a27f152", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:18:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "7c99246b71ab331ef93e12802a27f152", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:18:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4A8-1"}, "ts": "2023-07-07 16:18:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4A8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:18:40 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G31301MT"}, "ts": "2023-07-07 16:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G31301MT", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LDN", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan", "message": "Performing Global Search"}, "ts": "2023-07-07 16:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-07 16:18:53 EDT-0400"}, {"api": "/globalsearch/search/", "req": {"term": "LDN"}, "ts": "2023-07-07 16:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "global-search-result", "message": "page access"}, "ts": "2023-07-07 16:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "LDN", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "global-search-result", "message": "Global search term=LDN"}, "ts": "2023-07-07 16:18:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "6449f4de8204e3592a79b2da6117f4fa", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "6449f4de8204e3592a79b2da6117f4fa", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:18:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02240AO"}, "ts": "2023-07-07 16:18:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20123966", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:18:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20123966", "type": "PubMed"}, "ts": "2023-07-07 16:18:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00469"}, "ts": "2023-07-07 16:19:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00469", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G02240AO"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G02240AO", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "images", "message": "page access"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000016"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000017"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80413LB"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06042JP"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91358XO"}, "ts": "2023-07-07 16:19:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08648-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08648-1"}, "ts": "2023-07-07 16:19:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P40240"}, "ts": "2023-07-07 16:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:15 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-07 16:19:21 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-07 16:19:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5HYW2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5HYW2"}, "ts": "2023-07-07 16:19:25 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 16:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 16:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:19:28 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:19:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14207", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 16:19:29 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14207", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 16:19:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UXG3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UXG3"}, "ts": "2023-07-07 16:19:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K0P1-1"}, "ts": "2023-07-07 16:19:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K0P1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Simple Search"}, "ts": "2023-07-07 16:19:38 EDT-0400"}, {"api": "/glycan/search_simple/", "req": {"operation": "AND", "query_type": "glycan_search_simple", "term": "LacdiNAc", "term_category": "any"}, "ts": "2023-07-07 16:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Simple Search query={\"operation\":\"AND\",\"query_type\":\"glycan_search_simple\",\"term\":\"LacdiNAc\",\"term_category\":\"any\"}"}, "ts": "2023-07-07 16:19:38 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:19:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:19:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24413UY"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32659RY"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43346PX"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10258MC"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95658PH"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39540XG"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60963AS"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23484GM"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63065KG"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88417ED"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52676LZ"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25835MT"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53985AY"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54956ME"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85542KD"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68758PE"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76136FD"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23626NI"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88948CY"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09150LP"}, "ts": "2023-07-07 16:19:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:19:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}]}, "ts": "2023-07-07 16:19:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99897FQ"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78890OB"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29676WX"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56271TF"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45700OA"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49743VF"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43984TE"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50487BS"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G69113LL"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34330HT"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99225RS"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72406BE"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27262AE"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43767FS"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81915YU"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24812WY"}, "ts": "2023-07-07 16:19:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-07 16:19:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDW0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:19:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDW0-1"}, "ts": "2023-07-07 16:19:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43235"}, "ts": "2023-07-07 16:20:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6R7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:20:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6R7.1022.1022"}, "ts": "2023-07-07 16:20:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43235"}, "ts": "2023-07-07 16:20:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5S9.42.42"}, "ts": "2023-07-07 16:20:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5S9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:20:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6S4-1"}, "ts": "2023-07-07 16:20:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6S4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:20:21 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 16:20:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15824OV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:20:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15824OV"}, "ts": "2023-07-07 16:20:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:20:24 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}]}, "ts": "2023-07-07 16:20:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21884984", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:20:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21884984", "type": "PubMed"}, "ts": "2023-07-07 16:20:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:20:28 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}, {"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 16:20:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17344FG"}, "ts": "2023-07-07 16:20:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72018SI"}, "ts": "2023-07-07 16:20:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65117HG"}, "ts": "2023-07-07 16:20:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58807XI"}, "ts": "2023-07-07 16:20:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68955EJ"}, "ts": "2023-07-07 16:20:29 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23647WB"}, "ts": "2023-07-07 16:20:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80WD1"}, "ts": "2023-07-07 16:20:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80WD1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:20:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:20:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}, {"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined", "Incomplete"]}]}, "ts": "2023-07-07 16:20:44 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G18609BT"}, "ts": "2023-07-07 16:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G18609BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:20:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:20:49 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["N-linked"]}, {"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined", "Incomplete"]}, {"id": "by_data", "operator": "OR", "selected": ["Publication"]}]}, "ts": "2023-07-07 16:20:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G24413UY"}, "ts": "2023-07-07 16:20:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G24413UY", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:20:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000034"}, "ts": "2023-07-07 16:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000001"}, "ts": "2023-07-07 16:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29137YF"}, "ts": "2023-07-07 16:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000049"}, "ts": "2023-07-07 16:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31916CH"}, "ts": "2023-07-07 16:20:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49299UK"}, "ts": "2023-07-07 16:20:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JX92"}, "ts": "2023-07-07 16:21:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JX92", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:21:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:21:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:21:33 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:21:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:21:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:21:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P25490"}, "ts": "2023-07-07 16:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25490", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:21:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}]}, "ts": "2023-07-07 16:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:21:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14161", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:21:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14161.492.492"}, "ts": "2023-07-07 16:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:21:48 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "58f3630a26c8d0f383808f4cd0ba2411", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_monosaccharide", "operator": "OR", "selected": ["s"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["Other"]}]}, "ts": "2023-07-07 16:21:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00547ZN"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19106CR"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20905JK"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33129LQ"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00017IP"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34163WN"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18464VS"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41556UU"}, "ts": "2023-07-07 16:21:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZUT3"}, "ts": "2023-07-07 16:21:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZUT3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:21:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42226"}, "ts": "2023-07-07 16:21:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q80TZ9.56.56"}, "ts": "2023-07-07 16:21:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80TZ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:22:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WUA8"}, "ts": "2023-07-07 16:22:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WUA8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15831", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:23:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15831.189.189"}, "ts": "2023-07-07 16:23:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NXF1"}, "ts": "2023-07-07 16:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NXF1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3MII6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:23:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3MII6.166.166"}, "ts": "2023-07-07 16:23:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P28660"}, "ts": "2023-07-07 16:23:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23945"}, "ts": "2023-07-07 16:23:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UNS2.149.149"}, "ts": "2023-07-07 16:24:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNS2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:24:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X19", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 16:24:17 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q86X19", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 16:24:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NYV4.597.597"}, "ts": "2023-07-07 16:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NYV4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:24:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15289-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:24:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15289-1"}, "ts": "2023-07-07 16:24:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29317", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:24:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G06359BI"}, "ts": "2023-07-07 16:24:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G06359BI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:24:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28641113", "type": "PubMed"}, "ts": "2023-07-07 16:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28641113", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X19", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (compatible; YandexBot/3.0;  http://yandex.com/bots) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/108.0.0.0"}, "ts": "2023-07-07 16:24:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62609"}, "ts": "2023-07-07 16:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62609", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18202719", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:25:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18202719", "type": "PubMed"}, "ts": "2023-07-07 16:25:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:26:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15123", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:26:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15123"}, "ts": "2023-07-07 16:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z417", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:26:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z417"}, "ts": "2023-07-07 16:26:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q61644-1"}, "ts": "2023-07-07 16:26:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61644-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:26:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BUY8"}, "ts": "2023-07-07 16:26:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BUY8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96P16", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:26:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96P16.285.285"}, "ts": "2023-07-07 16:26:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q31615"}, "ts": "2023-07-07 16:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q31615", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:26:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UK55"}, "ts": "2023-07-07 16:26:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UK55", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:26:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14921"}, "ts": "2023-07-07 16:27:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14975"}, "ts": "2023-07-07 16:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18800763", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:27:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18800763", "type": "PubMed"}, "ts": "2023-07-07 16:27:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEP3"}, "ts": "2023-07-07 16:28:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:28:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZJA7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:28:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZJA7-1"}, "ts": "2023-07-07 16:28:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35226"}, "ts": "2023-07-07 16:30:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12821", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:30:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P12821.760.760"}, "ts": "2023-07-07 16:30:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811B1"}, "ts": "2023-07-07 16:30:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811B1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:30:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96921ZU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:30:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22003"}, "ts": "2023-07-07 16:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:30:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12923.101.101"}, "ts": "2023-07-07 16:30:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12586351", "type": "PubMed"}, "ts": "2023-07-07 16:31:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05090.172.172"}, "ts": "2023-07-07 16:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05090", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:31:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5EXX3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:31:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5EXX3"}, "ts": "2023-07-07 16:31:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NR30.386.386"}, "ts": "2023-07-07 16:31:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR30", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:31:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JRQ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:32:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JRQ6-1"}, "ts": "2023-07-07 16:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26254965", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:32:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26254965", "type": "PubMed"}, "ts": "2023-07-07 16:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32983115", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:32:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32983115", "type": "PubMed"}, "ts": "2023-07-07 16:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32983115", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 16:32:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HA1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:32:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96HA1.971.971"}, "ts": "2023-07-07 16:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31618756", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:32:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31618756", "type": "PubMed"}, "ts": "2023-07-07 16:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:33:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FWF4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294-1"}, "ts": "2023-07-07 16:33:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FWF4"}, "ts": "2023-07-07 16:33:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15294-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:33:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:33:41 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 5"}, "ts": "2023-07-07 16:33:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:33:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36>c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 5\"}"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45388GV"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05235KE"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81016SV"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97834OQ"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92734HI"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28960YA"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00039MO"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15144TI"}, "ts": "2023-07-07 16:33:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25426PD"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72291OX"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32550BI"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71838YU"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22355FZ"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47681UP"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95865ZB"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60554YG"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58001LT"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88713AC"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94583DZ"}, "ts": "2023-07-07 16:33:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06210"}, "ts": "2023-07-07 16:33:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:33:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 16:33:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85977BN"}, "ts": "2023-07-07 16:33:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:34:10 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 16:34:10 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:34:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:34:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:34:33 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 1"}, "ts": "2023-07-07 16:34:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:34:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36>56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 1\"}"}, "ts": "2023-07-07 16:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:34:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:34:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:34:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 16:34:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99315PE"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17126MK"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63443GA"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G41321IO"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15173TI"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91775YA"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06460LD"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40269CS"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84906ML"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80577OW"}, "ts": "2023-07-07 16:34:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35186-1"}, "ts": "2023-07-07 16:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35186-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:34:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:35:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CH1"}, "ts": "2023-07-07 16:35:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CH1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:35:07 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 100, "order": "desc", "filters": [{"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 16:35:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62015ZM"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02020YO"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58645HA"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65285QO"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57144YM"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64712UU"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01316HN"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05187DJ"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86718YQ"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01534TU"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50709IS"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30590EC"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03796EF"}, "ts": "2023-07-07 16:35:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G84906AJ"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04608YG"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36480VP"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27967WE"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83412LT"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22976NF"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86861MW"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08465VN"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73760YR"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55459MJ"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16609LV"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71549TN"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98689EK"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07164WO"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75472OU"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88313DY"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04267XF"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13258AZ"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85079IJ"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00287UD"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78475DU"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09859LE"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24970IL"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32112SX"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00891GP"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34168KI"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03049NB"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65704VY"}, "ts": "2023-07-07 16:35:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63242HY"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66576RC"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17039ZC"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90901EO"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39422JF"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60138JZ"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87444MS"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39611QP"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32968SR"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42154JB"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72729HN"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61094XY"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97213ID"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26121MN"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21297DP"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78928PU"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44342ZF"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63342TJ"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89585FG"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54461SS"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29348FH"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64981YW"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00063MO"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66967KV"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17326TY"}, "ts": "2023-07-07 16:35:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93470LV"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G51020FB"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17758YV"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29326OK"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77481LZ"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02353KU"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56067ON"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98654DA"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57007FO"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20210OT"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90689AW"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:35:51 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93636BY"}, "ts": "2023-07-07 16:35:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17480GI"}, "ts": "2023-07-07 16:35:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50178BS"}, "ts": "2023-07-07 16:35:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43235", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:36:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJF5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:36:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6PJF5.97.97"}, "ts": "2023-07-07 16:36:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HAN9-1"}, "ts": "2023-07-07 16:36:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HAN9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:36:32 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 1"}, "ts": "2023-07-07 16:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55>56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 1\"}"}, "ts": "2023-07-07 16:36:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:36:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:36:34 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 200, "order": "desc", "filters": []}, "ts": "2023-07-07 16:36:37 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86130AV"}, "ts": "2023-07-07 16:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42537PG"}, "ts": "2023-07-07 16:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55559HZ"}, "ts": "2023-07-07 16:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02752WS"}, "ts": "2023-07-07 16:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17041QN"}, "ts": "2023-07-07 16:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98535LH"}, "ts": "2023-07-07 16:36:38 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29587NV"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52706RS"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68008QO"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49632WD"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26493RP"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48905NO"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71165VR"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02368JK"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47190LU"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17236TT"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77597MJ"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01351CD"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46252BF"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06116KH"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86221TG"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61886WA"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37891WT"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18220BL"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45637XA"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14227RA"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15714MJ"}, "ts": "2023-07-07 16:36:39 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74724QE"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78768PN"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19813SH"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18717LR"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45827ZM"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80111QD"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24637VC"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13041EF"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14669DU"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76950LE"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73319KU"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81006GJ"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74722FL"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G94854LT"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29931IJ"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63628AV"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29880MM"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81295CK"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74430RZ"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31685JQ"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G79568CQ"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G78790NZ"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27945LI"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70418MS"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53434XO"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76163CP"}, "ts": "2023-07-07 16:36:40 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47967RK"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60038ZA"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49644CL"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64162JC"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23729WG"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88779RV"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17015OC"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46831QF"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98896IU"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87384DY"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75365RL"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57317CE"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G87051GH"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50073PQ"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19379ID"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80475RE"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35029YA"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28681TP"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10339FR"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20956ZV"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65184UU"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72787SB"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G73004SD"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93579XB"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G40523QS"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76154QC"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74945NC"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35842UG"}, "ts": "2023-07-07 16:36:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:36:44 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 200, "order": "desc", "filters": [{"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 16:36:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75032PM"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35778AN"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23560WQ"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24516WB"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38078TR"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33841YH"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96067FK"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22733YM"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G64527IJ"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G44199IU"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75717AV"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G62146JX"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23314QX"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66654PP"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68615TX"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60883HN"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18855WX"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76607YV"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G89194TJ"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49527BY"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58980RJ"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22222BH"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57568CV"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G66191UP"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70693FX"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34824ZD"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56946CM"}, "ts": "2023-07-07 16:36:45 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46026IB"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49603LL"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96715CG"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81832CY"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45333UL"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07988QE"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11373TT"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07479EG"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97160DA"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02288EO"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68820TX"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38075PP"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G92399PD"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65602FX"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82267MT"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99041WC"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G35437KG"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G80416YI"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18841NY"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01546PE"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11236BB"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11061VC"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68412PR"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67274NW"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58815WR"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53922OR"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57672ST"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96631UP"}, "ts": "2023-07-07 16:36:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49437KN"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G45709SU"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05374TU"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G42434UV"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82881HF"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04483QG"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58695FX"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36258NK"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24768CX"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G90719NY"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65376QI"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24508MA"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47867DI"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22487KJ"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BSJ1.19.19"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01822KD"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00467QU"}, "ts": "2023-07-07 16:36:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14250HG"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G46758LT"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75168BA"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70919RK"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSJ1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G08700OQ"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10325PN"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98745FI"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53522BA"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G60729FR"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26725PG"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G95715FI"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20482JP"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21586NB"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58450MK"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23494UZ"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75121VU"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27520PV"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33286MK"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G30011VO"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25705WX"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03847RK"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70568SB"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34479QF"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16598VU"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98698LI"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27817KG"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04522ZB"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G88376DR"}, "ts": "2023-07-07 16:36:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70579MZ"}, "ts": "2023-07-07 16:36:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61106", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:37:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P61106.97.97"}, "ts": "2023-07-07 16:37:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17426"}, "ts": "2023-07-07 16:37:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17426", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:37:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:37:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33241"}, "ts": "2023-07-07 16:37:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33241", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:37:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22105"}, "ts": "2023-07-07 16:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22105", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51991", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:37:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51991"}, "ts": "2023-07-07 16:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYH6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:37:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QYH6"}, "ts": "2023-07-07 16:37:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P253"}, "ts": "2023-07-07 16:37:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48735"}, "ts": "2023-07-07 16:37:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07350"}, "ts": "2023-07-07 16:37:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:37:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99041WC"}, "ts": "2023-07-07 16:38:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99041WC", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:38:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03098VW"}, "ts": "2023-07-07 16:38:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91777HP"}, "ts": "2023-07-07 16:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:38:40 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:38:41 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72025CC"}, "ts": "2023-07-07 16:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72025CC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:38:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:38:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_sequence_details", "operator": "OR", "selected": ["Topology"]}]}, "ts": "2023-07-07 16:38:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32830IJ"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G63461XJ"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29388XG"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38861VL"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15209ON"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G76243MI"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G93278FL"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G77259GO"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G28616IZ"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56676XV"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57610OS"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75248WN"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39115ZT"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11234AI"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68914XE"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12785ZM"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18372EE"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56829ZH"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56493QM"}, "ts": "2023-07-07 16:38:53 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "geoip", "message": "page access"}, "ts": "2023-07-07 16:38:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NY99.391.391"}, "ts": "2023-07-07 16:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY99", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:39:04 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:39:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:39:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:39:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:39:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14563", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:39:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14563.713.713"}, "ts": "2023-07-07 16:39:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11215-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:39:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11215-1"}, "ts": "2023-07-07 16:39:25 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 2"}, "ts": "2023-07-07 16:39:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:39:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40190.226.226"}, "ts": "2023-07-07 16:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40190", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55>94b8778ba354d23833e8125befc5186e", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 2\"}"}, "ts": "2023-07-07 16:39:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "94b8778ba354d23833e8125befc5186e", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:39:31 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "94b8778ba354d23833e8125befc5186e", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:39:31 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:39:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:39:46 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:39:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:39:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PB7"}, "ts": "2023-07-07 16:39:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PB7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23945", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:39:57 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 3"}, "ts": "2023-07-07 16:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55>8a527fd18dffa0f24e3fe5a7cc2280c6", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 3\"}"}, "ts": "2023-07-07 16:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8a527fd18dffa0f24e3fe5a7cc2280c6", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:39:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8a527fd18dffa0f24e3fe5a7cc2280c6", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TPM6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:40:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TPM6"}, "ts": "2023-07-07 16:40:03 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:40:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:40:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:40:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NEW0"}, "ts": "2023-07-07 16:40:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NEW0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:40:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01130-1"}, "ts": "2023-07-07 16:40:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:40:19 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 4"}, "ts": "2023-07-07 16:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01130-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55>4d572199ea93f0484520ad7be11b32ed", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 4\"}"}, "ts": "2023-07-07 16:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4d572199ea93f0484520ad7be11b32ed", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:40:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "4d572199ea93f0484520ad7be11b32ed", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:40:20 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:40:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:40:27 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:40:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21957315", "type": "PubMed"}, "ts": "2023-07-07 16:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21957315", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:40:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:40:28 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 5"}, "ts": "2023-07-07 16:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55>c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 5\"}"}, "ts": "2023-07-07 16:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:40:35 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:40:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q923L3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 16:40:36 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q923L3", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 16:40:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3244354", "type": "PubMed"}, "ts": "2023-07-07 16:40:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3244354", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:40:37 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:40:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:40:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20543840", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:40:44 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20543840", "type": "PubMed"}, "ts": "2023-07-07 16:40:45 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 6"}, "ts": "2023-07-07 16:40:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55>b663b02fd462ab8d340e56fb5b9a96a2", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 6\"}"}, "ts": "2023-07-07 16:40:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:40:52 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26915XM"}, "ts": "2023-07-07 16:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85228QD"}, "ts": "2023-07-07 16:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36447PT"}, "ts": "2023-07-07 16:40:52 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54567CI"}, "ts": "2023-07-07 16:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14260UH"}, "ts": "2023-07-07 16:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47318KU"}, "ts": "2023-07-07 16:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10256JP"}, "ts": "2023-07-07 16:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31936TA"}, "ts": "2023-07-07 16:40:53 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50757KG"}, "ts": "2023-07-07 16:40:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04080"}, "ts": "2023-07-07 16:40:59 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:41:04 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:41:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:41:05 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 7"}, "ts": "2023-07-07 16:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55>1f1986198e580917b98f1ce1c0d4cbec", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 7\"}"}, "ts": "2023-07-07 16:41:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1f1986198e580917b98f1ce1c0d4cbec", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:41:13 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "1f1986198e580917b98f1ce1c0d4cbec", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:41:13 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56987FT"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48081MJ"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G82947LB"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00044MO"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23854HB"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13458KB"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49313FU"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50432RB"}, "ts": "2023-07-07 16:41:14 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:41:20 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:41:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H5I5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:41:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H5I5"}, "ts": "2023-07-07 16:41:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:41:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24098488", "type": "PubMed"}, "ts": "2023-07-07 16:41:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24098488", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:41:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:41:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08481.424.424"}, "ts": "2023-07-07 16:41:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "56b78071202d1da11544990a808d5a55", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:42:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "56b78071202d1da11544990a808d5a55", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:42:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TMA2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TMA2-1"}, "ts": "2023-07-07 16:42:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PJG9"}, "ts": "2023-07-07 16:42:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:42:24 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:42:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:42:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:42:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z739", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:42:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Search modification initiated"}, "ts": "2023-07-07 16:42:33 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked"}, "ts": "2023-07-07 16:42:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 16:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36>26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\"}"}, "ts": "2023-07-07 16:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:42:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:42:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z739"}, "ts": "2023-07-07 16:42:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91XZ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:43:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91XZ6-1"}, "ts": "2023-07-07 16:43:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:43:05 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 16:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:43:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "26ebe10a747e4bd063f9f03a6ad65d36", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-07 16:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CJ12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:43:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CJ12"}, "ts": "2023-07-07 16:43:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CUU3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:43:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CUU3.518.518"}, "ts": "2023-07-07 16:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70531-1"}, "ts": "2023-07-07 16:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70531-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14975", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:43:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14921", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:43:30 EDT-0400"}, {"api": "/usecases/search_init/", "req": {}, "ts": "2023-07-07 16:43:31 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "quick-search", "message": "page access"}, "ts": "2023-07-07 16:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 16:43:39 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 16:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52803-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:43:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52803-1"}, "ts": "2023-07-07 16:43:43 EDT-0400"}, {"api": "/supersearch/init/", "req": {}, "ts": "2023-07-07 16:43:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-07 16:43:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "super-search", "message": "page access"}, "ts": "2023-07-07 16:43:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46100"}, "ts": "2023-07-07 16:44:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46100", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:44:15 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-07 16:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-07 16:44:21 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-07 16:44:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000042"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000036"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000020"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000018"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000005"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000002"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000015"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000019"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000045"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000004"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000038"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000035"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000021"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000031"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000050"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000024"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000051"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000006"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000044"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000033"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000043"}, "ts": "2023-07-07 16:44:22 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000037"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000026"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000032"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000029"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000041"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000039"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000047"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000058"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000027"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000040"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000046"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000252"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000030"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000057"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000025"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000074"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000118"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000095"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000100"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000064"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000055"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000078"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000091"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000089"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000104"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000060"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000085"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000108"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000110"}, "ts": "2023-07-07 16:44:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000121"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000059"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000012"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000081"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000068"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000114"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000070"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000099"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000084"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000109"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000111"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000075"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000120"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000013"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000080"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000069"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000115"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000071"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000098"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000119"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000094"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000007"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000101"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000065"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000054"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000079"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000088"}, "ts": "2023-07-07 16:44:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000105"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000061"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000086"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000113"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000077"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000122"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000011"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000082"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000009"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000117"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000073"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000096"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000103"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000067"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000056"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000092"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000028"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000107"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000063"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000097"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000102"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000066"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000093"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000053"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000106"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000062"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000087"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000014"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000112"}, "ts": "2023-07-07 16:44:25 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000076"}, "ts": "2023-07-07 16:44:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000010"}, "ts": "2023-07-07 16:44:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000083"}, "ts": "2023-07-07 16:44:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000008"}, "ts": "2023-07-07 16:44:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000116"}, "ts": "2023-07-07 16:44:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000072"}, "ts": "2023-07-07 16:44:26 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000049", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-07 16:44:30 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000049", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000049", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00230CO"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00582VL"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00636QL"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00740UU"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01681JC"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04846SY"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05151WT"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05377HJ"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05611SB"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06216UH"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06927UM"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07123BN"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10235QZ"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12243WN"}, "ts": "2023-07-07 16:44:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14695KF"}, "ts": "2023-07-07 16:44:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G15719NX"}, "ts": "2023-07-07 16:44:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16058FI"}, "ts": "2023-07-07 16:44:32 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16230QU"}, "ts": "2023-07-07 16:44:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24130490", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:44:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24130490", "type": "PubMed"}, "ts": "2023-07-07 16:44:36 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-07 16:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-07 16:44:39 EDT-0400"}, {"api": "/motif/list/", "req": {"offset": 1, "sort": "glycan_count", "limit": 150, "order": "desc"}, "ts": "2023-07-07 16:44:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9346901", "type": "PubMed"}, "ts": "2023-07-07 16:44:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9346901", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:44:41 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 16:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:45:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 16:45:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C9JQL5-1"}, "ts": "2023-07-07 16:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JQL5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:45:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35226", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:45:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23275"}, "ts": "2023-07-07 16:45:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5T1R4.106.106"}, "ts": "2023-07-07 16:46:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1R4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:46:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00288QM"}, "ts": "2023-07-07 16:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00288QM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:46:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31151"}, "ts": "2023-07-07 16:46:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A5I9-1"}, "ts": "2023-07-07 16:46:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A5I9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:46:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98160", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98160"}, "ts": "2023-07-07 16:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P995"}, "ts": "2023-07-07 16:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P995", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:46:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Substructure Search query={\"jobtype\":\"structure_search\",\"parameters\":{\"seq\":\"RES\\n1b:a-dgal-HEX-1:5\\n2s:n-acetyl\\nLIN\\n1:1d(2 1)2n\",\"align\":\"core\"}}"}, "ts": "2023-07-07 16:46:48 EDT-0400"}, {"api": "/job/addnew/", "req": {"query": {"jobtype": "structure_search", "parameters": {"seq": "RES\n1b:a-dgal-HEX-1:5\n2s:n-acetyl\nLIN\n1:1d(2+1)2n", "align": "core"}}}, "ts": "2023-07-07 16:46:48 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 15}, "ts": "2023-07-07 16:46:50 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 15}, "ts": "2023-07-07 16:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P85844-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:46:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P85844-1"}, "ts": "2023-07-07 16:46:53 EDT-0400"}, {"api": "/job/status/", "req": {"jobid": 15}, "ts": "2023-07-07 16:46:58 EDT-0400"}, {"api": "/job/results/", "req": {"jobid": 15}, "ts": "2023-07-07 16:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">15", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Substructure Search query=15 undefined undefined"}, "ts": "2023-07-07 16:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:46:58 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 16:46:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 16:46:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36123IU"}, "ts": "2023-07-07 16:46:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 16:46:59 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000042", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-07 16:46:59 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000042", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-07 16:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000042", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-07 16:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-07 16:47:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A147-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:47:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A147-1"}, "ts": "2023-07-07 16:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:47:08 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}]}, "ts": "2023-07-07 16:47:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8I9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:47:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8I9-1"}, "ts": "2023-07-07 16:47:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "geoip", "message": "page access"}, "ts": "2023-07-07 16:47:15 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G91360AG"}, "ts": "2023-07-07 16:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G91360AG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01169IB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:47:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G01169IB"}, "ts": "2023-07-07 16:47:29 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07483YN"}, "ts": "2023-07-07 16:47:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LYH5-1"}, "ts": "2023-07-07 16:47:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LYH5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:47:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31000-1"}, "ts": "2023-07-07 16:48:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31000-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:48:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:48:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G87067NW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:48:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G87067NW"}, "ts": "2023-07-07 16:48:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40492MP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:48:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40492MP"}, "ts": "2023-07-07 16:48:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU54"}, "ts": "2023-07-07 16:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU54", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:48:53 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UBM7", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 16:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBM7", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 16:48:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0RAI9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:49:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0RAI9-1"}, "ts": "2023-07-07 16:49:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ01"}, "ts": "2023-07-07 16:49:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:49:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:49:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5FVC5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:49:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5FVC5-1"}, "ts": "2023-07-07 16:49:43 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 16:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06210", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:49:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZM5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:49:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZM5.93.93"}, "ts": "2023-07-07 16:49:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33639338", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:49:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33639338", "type": "PubMed"}, "ts": "2023-07-07 16:49:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33639338", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 16:49:53 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IV63.59.59"}, "ts": "2023-07-07 16:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IV63", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:50:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17812", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:50:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01857-1"}, "ts": "2023-07-07 16:50:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01857-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:50:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17812.571.571"}, "ts": "2023-07-07 16:50:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZA3"}, "ts": "2023-07-07 16:51:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:51:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VGC3-1"}, "ts": "2023-07-07 16:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VGC3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:51:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43916"}, "ts": "2023-07-07 16:51:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CII8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:51:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CII8"}, "ts": "2023-07-07 16:51:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGL7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:52:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGL7.6.6"}, "ts": "2023-07-07 16:52:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3540948", "type": "PubMed"}, "ts": "2023-07-07 16:52:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "3540948", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:52:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2A7"}, "ts": "2023-07-07 16:53:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2A7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:53:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 16:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07350", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:53:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R757-1"}, "ts": "2023-07-07 16:54:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R757-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:54:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C009", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:54:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9C009"}, "ts": "2023-07-07 16:54:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13114", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:54:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13114"}, "ts": "2023-07-07 16:54:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G58429RC"}, "ts": "2023-07-07 16:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G58429RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:54:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UY11", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:54:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UY11"}, "ts": "2023-07-07 16:54:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32960270", "type": "PubMed"}, "ts": "2023-07-07 16:54:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q812G0"}, "ts": "2023-07-07 16:54:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32960270", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:54:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q812G0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:54:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 16:54:50 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "f6ed010033af448f1c395ab2146f7bb8", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_glycan_type", "operator": "OR", "selected": ["O-linked"]}, {"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 16:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CIZ8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:54:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CIZ8"}, "ts": "2023-07-07 16:54:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72539IR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:55:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72539IR"}, "ts": "2023-07-07 16:55:00 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G64527OM"}, "ts": "2023-07-07 16:55:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3SHH9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:55:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3SHH9"}, "ts": "2023-07-07 16:55:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZLZ1-1"}, "ts": "2023-07-07 16:55:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZLZ1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:55:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:55:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BD0"}, "ts": "2023-07-07 16:55:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49748"}, "ts": "2023-07-07 16:55:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95352-1"}, "ts": "2023-07-07 16:55:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95352-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:56:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23100IR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:56:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23100IR"}, "ts": "2023-07-07 16:56:08 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G26690QG"}, "ts": "2023-07-07 16:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G26690QG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 16:56:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:56:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06731", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:56:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06731.480.480"}, "ts": "2023-07-07 16:56:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75578"}, "ts": "2023-07-07 16:56:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75578", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:56:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18532-1"}, "ts": "2023-07-07 16:56:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18532-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:56:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04080", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:56:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11278945", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:57:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11278945", "type": "PubMed"}, "ts": "2023-07-07 16:57:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LU7.719.719"}, "ts": "2023-07-07 16:57:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LU7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:57:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TDV0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:58:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TDV0"}, "ts": "2023-07-07 16:58:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:58:27 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39738WL"}, "ts": "2023-07-07 16:58:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32300124", "type": "PubMed"}, "ts": "2023-07-07 16:58:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32300124", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 16:58:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P25918.346.346"}, "ts": "2023-07-07 16:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P25918", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:58:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADP7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 16:58:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADP7"}, "ts": "2023-07-07 16:58:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95965"}, "ts": "2023-07-07 16:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95965", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:58:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O54707"}, "ts": "2023-07-07 16:58:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXD2"}, "ts": "2023-07-07 16:58:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60673", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:58:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P60673.68.68"}, "ts": "2023-07-07 16:59:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75369"}, "ts": "2023-07-07 16:59:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75369", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:59:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C7M3-1"}, "ts": "2023-07-07 16:59:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C7M3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:59:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K6X2-1"}, "ts": "2023-07-07 16:59:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K6X2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 16:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16270", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 16:59:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16270.118.118"}, "ts": "2023-07-07 16:59:50 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 17:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 17:00:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 17:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 17:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 17:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 17:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O88778"}, "ts": "2023-07-07 17:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:00:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "M0R6L4-1"}, "ts": "2023-07-07 17:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "M0R6L4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:00:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99698.758.758"}, "ts": "2023-07-07 17:00:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99698", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:00:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N884.339.339"}, "ts": "2023-07-07 17:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N884", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:01:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WTP9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WTP9"}, "ts": "2023-07-07 17:01:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A397-1"}, "ts": "2023-07-07 17:01:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A397-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:01:31 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G98559XP"}, "ts": "2023-07-07 17:01:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23275", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:01:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00335DM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:02:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00335DM"}, "ts": "2023-07-07 17:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31151", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:02:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56563-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:02:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56563-1"}, "ts": "2023-07-07 17:02:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPH3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:02:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPH3"}, "ts": "2023-07-07 17:02:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQ70", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:02:31 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BQ70.251.251"}, "ts": "2023-07-07 17:02:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P587", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:02:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P587.71.71"}, "ts": "2023-07-07 17:02:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G57321FI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:02:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35663"}, "ts": "2023-07-07 17:03:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07483YN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:03:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19652"}, "ts": "2023-07-07 17:04:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19652", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:04:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M8P4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:04:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M8P4-1"}, "ts": "2023-07-07 17:04:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98155.71.71"}, "ts": "2023-07-07 17:05:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:05:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EP88"}, "ts": "2023-07-07 17:05:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP88", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:05:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P81278-1"}, "ts": "2023-07-07 17:05:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XIE9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P81278-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:05:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XIE9-1"}, "ts": "2023-07-07 17:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP88", "user": "Undecided", "type": "error", "page": "protVista", "message": "Network error. ProtVista Detail api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 17:05:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVT2"}, "ts": "2023-07-07 17:06:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVT2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:06:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62424"}, "ts": "2023-07-07 17:06:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62424", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:06:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16820410", "type": "PubMed"}, "ts": "2023-07-07 17:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16820410", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:06:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2WGJ9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:06:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2WGJ9"}, "ts": "2023-07-07 17:06:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 17:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF74", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 17:07:03 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8TF74", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 17:07:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G29857RC"}, "ts": "2023-07-07 17:07:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43916", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:07:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P57678"}, "ts": "2023-07-07 17:07:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43776", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:07:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43776"}, "ts": "2023-07-07 17:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6QI36", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:08:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6QI36"}, "ts": "2023-07-07 17:08:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11718558", "type": "PubMed"}, "ts": "2023-07-07 17:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11718558", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2L5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:08:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2L5.655.655"}, "ts": "2023-07-07 17:08:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16553.99.99"}, "ts": "2023-07-07 17:08:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16553", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:08:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03930BU"}, "ts": "2023-07-07 17:09:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NVV3"}, "ts": "2023-07-07 17:09:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NVV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:09:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G56655CC"}, "ts": "2023-07-07 17:09:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G56655CC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:09:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PRD1"}, "ts": "2023-07-07 17:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PRD1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:10:58 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G61334IA"}, "ts": "2023-07-07 17:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:10:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q71UI9"}, "ts": "2023-07-07 17:10:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71UI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G64527OM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1H2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:11:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3T1H2-1"}, "ts": "2023-07-07 17:11:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21439", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:11:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21439"}, "ts": "2023-07-07 17:11:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17339379", "type": "PubMed"}, "ts": "2023-07-07 17:11:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17339379", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:11:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49748", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:11:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H6E5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:12:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6E5"}, "ts": "2023-07-07 17:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZH40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:12:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZH40"}, "ts": "2023-07-07 17:12:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NG77", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:13:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NG77.146.146"}, "ts": "2023-07-07 17:13:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9205125", "type": "PubMed"}, "ts": "2023-07-07 17:13:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBH5"}, "ts": "2023-07-07 17:13:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9205125", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBH5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:13:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HCC8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:13:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HCC8"}, "ts": "2023-07-07 17:13:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42702"}, "ts": "2023-07-07 17:14:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42702", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16695", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:14:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16695"}, "ts": "2023-07-07 17:14:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQN1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:14:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PQN1-1"}, "ts": "2023-07-07 17:14:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O54707", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:14:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42229", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:14:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P42229.2.2"}, "ts": "2023-07-07 17:14:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12849978", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:14:59 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12849978", "type": "PubMed"}, "ts": "2023-07-07 17:15:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6W5"}, "ts": "2023-07-07 17:15:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6W5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 17:16:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A2Z4LIS9-1"}, "ts": "2023-07-07 17:17:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A2Z4LIS9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:17:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20864038", "type": "PubMed"}, "ts": "2023-07-07 17:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20864038", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:18:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05026ZL"}, "ts": "2023-07-07 17:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05026ZL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:18:46 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19234OH"}, "ts": "2023-07-07 17:18:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27391WQ"}, "ts": "2023-07-07 17:18:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54064OC"}, "ts": "2023-07-07 17:18:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G05026ZL"}, "ts": "2023-07-07 17:18:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BJM7-1"}, "ts": "2023-07-07 17:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BJM7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:19:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25701463", "type": "PubMed"}, "ts": "2023-07-07 17:19:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25701463", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16109", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:19:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:19:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P16109.411.411"}, "ts": "2023-07-07 17:19:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:20:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBJ7"}, "ts": "2023-07-07 17:20:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3B3"}, "ts": "2023-07-07 17:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3B3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:20:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9CX66.177.177"}, "ts": "2023-07-07 17:20:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CX66", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:20:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07357", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:20:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07357"}, "ts": "2023-07-07 17:20:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43320", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:20:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43320"}, "ts": "2023-07-07 17:20:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P03952"}, "ts": "2023-07-07 17:21:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P03952", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:21:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15791-1"}, "ts": "2023-07-07 17:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15791-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:22:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16849"}, "ts": "2023-07-07 17:22:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16849", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:22:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P0C7U0.349.349"}, "ts": "2023-07-07 17:22:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7U0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:22:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NGJ2.11.11"}, "ts": "2023-07-07 17:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGJ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:22:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2361015", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:22:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2361015", "type": "PubMed"}, "ts": "2023-07-07 17:22:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53365", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53365"}, "ts": "2023-07-07 17:22:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9722561", "type": "PubMed"}, "ts": "2023-07-07 17:22:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9722561", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:23:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99403QU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:23:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G29857RC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:23:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99403QU"}, "ts": "2023-07-07 17:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P57678", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21986944", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:23:48 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21986944", "type": "PubMed"}, "ts": "2023-07-07 17:23:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KJ4"}, "ts": "2023-07-07 17:24:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KJ4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:24:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZQ06.160.160"}, "ts": "2023-07-07 17:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZQ06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:24:15 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 17:24:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 17:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32P44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:24:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CG47", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CG47"}, "ts": "2023-07-07 17:24:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q32P44"}, "ts": "2023-07-07 17:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H343"}, "ts": "2023-07-07 17:24:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H343", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:24:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G90333CG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:25:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G90333CG"}, "ts": "2023-07-07 17:25:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BZM1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:25:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BZM1"}, "ts": "2023-07-07 17:25:41 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 17:26:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 17:26:02 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 3"}, "ts": "2023-07-07 17:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 17:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">8a527fd18dffa0f24e3fe5a7cc2280c6", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 3\"}"}, "ts": "2023-07-07 17:26:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8a527fd18dffa0f24e3fe5a7cc2280c6", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 17:26:13 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "8a527fd18dffa0f24e3fe5a7cc2280c6", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 17:26:13 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 17:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 17:26:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZA76-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:26:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZA76-1"}, "ts": "2023-07-07 17:26:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 17:26:32 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 5"}, "ts": "2023-07-07 17:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 5\"}"}, "ts": "2023-07-07 17:26:32 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 17:26:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 17:26:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 17:26:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 17:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G61334IA", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62827", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:26:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62827"}, "ts": "2023-07-07 17:26:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91W59", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:27:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91W59"}, "ts": "2023-07-07 17:27:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CBW3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:27:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CBW3"}, "ts": "2023-07-07 17:27:12 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 100, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G96636JK"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G54095CK"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G72539TP"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00040MO"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70323JV"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29081QO"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G59505RO"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G17359VK"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43482PE"}, "ts": "2023-07-07 17:27:15 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27317MD"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53004PR"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G03155HR"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25541JU"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G67375UD"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85564NH"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G36694YR"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83997EZ"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20595AV"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G99747RT"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G58852GK"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26162MM"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G29176XQ"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G71743JP"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G74273EE"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G65070RM"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G07707ZV"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G32547FO"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14851AV"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G70058BA"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57089SI"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38638KM"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G31629OB"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68985JM"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G16136AD"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48586RX"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61337RI"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34516JZ"}, "ts": "2023-07-07 17:27:16 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12456LJ"}, "ts": "2023-07-07 17:27:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G85811SG"}, "ts": "2023-07-07 17:27:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81915OX"}, "ts": "2023-07-07 17:27:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G26550KF"}, "ts": "2023-07-07 17:27:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G97228ZY"}, "ts": "2023-07-07 17:27:17 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G49155EM"}, "ts": "2023-07-07 17:27:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:27:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTI5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:27:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NTI5.825.825"}, "ts": "2023-07-07 17:27:19 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "offset": 1, "sort": "hit_score", "limit": 100, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 17:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "c6e39c3d9d19964566e8d5edb21bdc75", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 17:27:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14523", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:27:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O14523.417.417"}, "ts": "2023-07-07 17:27:29 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 17:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 17:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 17:27:33 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 17:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 17:27:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0V8T5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:27:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0V8T5"}, "ts": "2023-07-07 17:27:36 EDT-0400"}, {"api": "/glycan/search/", "req": {"operation": "AND", "query_type": "search_glycan", "glycan_name": "", "glycan_type": "O-linked", "glycan_subtype": "Core 6"}, "ts": "2023-07-07 17:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Performing Advanced Search"}, "ts": "2023-07-07 17:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": ">b663b02fd462ab8d340e56fb5b9a96a2", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-search", "message": "Advanced Search query={\"operation\":\"AND\",\"query_type\":\"search_glycan\",\"glycan_name\":\"\",\"glycan_type\":\"O-linked\",\"glycan_subtype\":\"Core 6\"}"}, "ts": "2023-07-07 17:27:42 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": []}, "ts": "2023-07-07 17:27:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 17:27:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 17:27:45 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}]}, "ts": "2023-07-07 17:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "user": "mivftnkfq84qb3lbajlt00opan84xii4", "type": "user", "page": "glycan-list", "message": "page access"}, "ts": "2023-07-07 17:27:47 EDT-0400"}, {"api": "/glycan/list/", "req": {"id": "b663b02fd462ab8d340e56fb5b9a96a2", "offset": 1, "sort": "hit_score", "limit": 20, "order": "desc", "filters": [{"id": "by_organism", "operator": "OR", "selected": ["Homo sapiens"]}, {"id": "by_sequence_details", "operator": "OR", "selected": ["Fully defined"]}]}, "ts": "2023-07-07 17:27:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G61730RY"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00041MO"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27431EQ"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10110YZ"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G53206FD"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50068TE"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G48440GN"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13179DW"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G21312EA"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18878GS"}, "ts": "2023-07-07 17:27:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21845-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:27:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21845-1"}, "ts": "2023-07-07 17:27:55 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23863VK"}, "ts": "2023-07-07 17:29:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22843503", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:30:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22843503", "type": "PubMed"}, "ts": "2023-07-07 17:30:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NQS5"}, "ts": "2023-07-07 17:30:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NQS5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:30:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KK5"}, "ts": "2023-07-07 17:31:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:31:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QD11", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:31:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5QD11.5.5"}, "ts": "2023-07-07 17:31:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VCM8"}, "ts": "2023-07-07 17:32:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VCM8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:32:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZKP1-1"}, "ts": "2023-07-07 17:32:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IZF0"}, "ts": "2023-07-07 17:32:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZKP1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZF0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35613", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:32:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35613.325.325"}, "ts": "2023-07-07 17:32:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08966-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:33:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08966-1"}, "ts": "2023-07-07 17:33:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVH8-1"}, "ts": "2023-07-07 17:33:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14814"}, "ts": "2023-07-07 17:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVH8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:33:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80XD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:34:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80XD9"}, "ts": "2023-07-07 17:34:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P40121.242.242"}, "ts": "2023-07-07 17:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P40121", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:34:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D8V0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:34:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D8V0"}, "ts": "2023-07-07 17:34:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04062", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:35:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TAD4"}, "ts": "2023-07-07 17:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TAD4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:35:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N2B3-1"}, "ts": "2023-07-07 17:35:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N2B3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:35:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78330"}, "ts": "2023-07-07 17:35:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08195.120.120"}, "ts": "2023-07-07 17:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08195", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:36:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WV92", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:37:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WV92.76.76"}, "ts": "2023-07-07 17:37:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-07 17:37:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3B8Q3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:37:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3B8Q3-1"}, "ts": "2023-07-07 17:37:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00395"}, "ts": "2023-07-07 17:37:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07742"}, "ts": "2023-07-07 17:38:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07742", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:38:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43791-1"}, "ts": "2023-07-07 17:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43791-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:38:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:39:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.97.97"}, "ts": "2023-07-07 17:39:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:39:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXK0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:39:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXK0"}, "ts": "2023-07-07 17:39:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 17:39:35 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q99653", "cluster_type": "unselected"}, "ts": "2023-07-07 17:39:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16880", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99653", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 17:39:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16880.333.333"}, "ts": "2023-07-07 17:39:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99653", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 17:39:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5GH72", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:39:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5GH72.534.534"}, "ts": "2023-07-07 17:39:54 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000020", "offset": 1, "sort": "glytoucan_ac", "limit": 20, "order": "asc"}, "ts": "2023-07-07 17:39:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-07 17:39:56 EDT-0400"}, {"api": "/motif/detail/", "req": {"motif_ac": "GGM.000020", "offset": 1, "limit": 20, "order": "asc"}, "ts": "2023-07-07 17:39:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "GGM.000020", "user": "Undecided", "type": "user", "page": "motif", "message": "page access"}, "ts": "2023-07-07 17:39:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:40:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9582194", "type": "PubMed"}, "ts": "2023-07-07 17:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9582194", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:40:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IXH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:40:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IXH7"}, "ts": "2023-07-07 17:40:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08810-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:40:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08810-1"}, "ts": "2023-07-07 17:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14145", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:41:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14145.103.103"}, "ts": "2023-07-07 17:41:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBP4"}, "ts": "2023-07-07 17:41:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBP4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:41:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NIH7"}, "ts": "2023-07-07 17:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NIH7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:41:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS91", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:41:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NS91.280.280"}, "ts": "2023-07-07 17:41:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:42:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16666.418.418"}, "ts": "2023-07-07 17:42:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SK2"}, "ts": "2023-07-07 17:42:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SK2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:42:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12595489", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:42:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12595489", "type": "PubMed"}, "ts": "2023-07-07 17:42:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20171-1"}, "ts": "2023-07-07 17:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20171-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:42:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60258", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:43:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60258"}, "ts": "2023-07-07 17:43:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75578", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:43:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75578.1041.1041"}, "ts": "2023-07-07 17:43:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84489FR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:43:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84489FR"}, "ts": "2023-07-07 17:43:46 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q5VV42", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 17:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV42", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 17:44:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18843296", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:44:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18843296", "type": "PubMed"}, "ts": "2023-07-07 17:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19652-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:44:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19652-1.88.88"}, "ts": "2023-07-07 17:44:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVX2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:44:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BVX2"}, "ts": "2023-07-07 17:44:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23863VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:45:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06280"}, "ts": "2023-07-07 17:45:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35520"}, "ts": "2023-07-07 17:45:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10126"}, "ts": "2023-07-07 17:45:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10126", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:45:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49108TO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:46:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49108TO"}, "ts": "2023-07-07 17:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26039939", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:46:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26039939", "type": "PubMed"}, "ts": "2023-07-07 17:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZZ0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:47:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9GZZ0.97.97"}, "ts": "2023-07-07 17:47:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NV12"}, "ts": "2023-07-07 17:47:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NV12", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWL8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:47:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWL8"}, "ts": "2023-07-07 17:47:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NVV3"}, "ts": "2023-07-07 17:47:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NVV3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:47:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70255", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:48:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P70255.323.323"}, "ts": "2023-07-07 17:48:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11818334", "type": "PubMed"}, "ts": "2023-07-07 17:48:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11818334", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:48:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZJ5"}, "ts": "2023-07-07 17:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPF3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:48:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPF3"}, "ts": "2023-07-07 17:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZJ5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:48:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:49:03 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 17:49:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23199280", "type": "PubMed"}, "ts": "2023-07-07 17:49:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23199280", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:49:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14814", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:49:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43155"}, "ts": "2023-07-07 17:49:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3"}, "ts": "2023-07-07 17:49:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:49:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7579796", "type": "PubMed"}, "ts": "2023-07-07 17:50:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7579796", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:50:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96MW5"}, "ts": "2023-07-07 17:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96MW5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:50:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EU6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:50:52 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96EU6.245.245"}, "ts": "2023-07-07 17:50:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9931445", "type": "PubMed"}, "ts": "2023-07-07 17:51:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9931445", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:51:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60353", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:51:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60353.606.606"}, "ts": "2023-07-07 17:51:11 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 17:51:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19525"}, "ts": "2023-07-07 17:51:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5M5.509.509"}, "ts": "2023-07-07 17:51:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5M5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:51:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H0W9"}, "ts": "2023-07-07 17:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0W9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B0BNG2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:52:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B0BNG2-1"}, "ts": "2023-07-07 17:52:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08253", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:52:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08253"}, "ts": "2023-07-07 17:52:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10019LZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:52:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10019LZ"}, "ts": "2023-07-07 17:52:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08481", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:52:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q08481.679.679"}, "ts": "2023-07-07 17:52:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14843DJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 17:53:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5TA50", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:53:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5TA50"}, "ts": "2023-07-07 17:53:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00395", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:53:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60949"}, "ts": "2023-07-07 17:54:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60949", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 17:54:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-07 17:55:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01031-1"}, "ts": "2023-07-07 17:55:10 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G20030CU"}, "ts": "2023-07-07 17:55:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00488"}, "ts": "2023-07-07 17:55:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AQA7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:55:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1AQA7"}, "ts": "2023-07-07 17:55:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q811X5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q811X5-1"}, "ts": "2023-07-07 17:56:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45379"}, "ts": "2023-07-07 17:57:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43818-1"}, "ts": "2023-07-07 17:57:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43818-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99KI0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:57:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99KI0"}, "ts": "2023-07-07 17:57:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21410790", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:58:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21410790", "type": "PubMed"}, "ts": "2023-07-07 17:58:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1LWF3"}, "ts": "2023-07-07 17:58:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1LWF3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:58:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34867212", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 17:58:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34867212", "type": "PubMed"}, "ts": "2023-07-07 17:58:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3L2-1"}, "ts": "2023-07-07 17:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3L2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:59:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94953"}, "ts": "2023-07-07 17:59:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94953", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 17:59:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46013", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 17:59:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P46013.1042.1042"}, "ts": "2023-07-07 17:59:50 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 18:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 18:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 18:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 18:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 18:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 18:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5F2L2"}, "ts": "2023-07-07 18:00:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5F2L2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:00:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:00:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13905", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:00:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13905.293.293"}, "ts": "2023-07-07 18:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27030794", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:00:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27030794", "type": "PubMed"}, "ts": "2023-07-07 18:00:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:01:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZK4"}, "ts": "2023-07-07 18:01:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZK4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:01:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35520", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P18163-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:01:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P18163-1"}, "ts": "2023-07-07 18:01:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9N8"}, "ts": "2023-07-07 18:02:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9N8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:02:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00613"}, "ts": "2023-07-07 18:02:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UM22"}, "ts": "2023-07-07 18:03:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UM22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:03:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJV9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:03:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJV9"}, "ts": "2023-07-07 18:03:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11384984", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:04:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11384984", "type": "PubMed"}, "ts": "2023-07-07 18:04:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45448", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:04:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P45448"}, "ts": "2023-07-07 18:04:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00560"}, "ts": "2023-07-07 18:04:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62271", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:05:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62271"}, "ts": "2023-07-07 18:05:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43155", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:05:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4ADB4"}, "ts": "2023-07-07 18:05:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4ADB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:05:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14373"}, "ts": "2023-07-07 18:05:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62807"}, "ts": "2023-07-07 18:06:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62807", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:06:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NH11", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:06:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NH11.207.207"}, "ts": "2023-07-07 18:06:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PCX9"}, "ts": "2023-07-07 18:06:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PCX9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:06:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17689DH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 18:07:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19525", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:07:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y2V2.32.32"}, "ts": "2023-07-07 18:07:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2V2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:07:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12313PD"}, "ts": "2023-07-07 18:07:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:07:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6F9"}, "ts": "2023-07-07 18:07:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6F9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:07:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9758550", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:07:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9758550", "type": "PubMed"}, "ts": "2023-07-07 18:07:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2V4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:08:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2V4.557.557"}, "ts": "2023-07-07 18:08:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G72344YZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 18:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 18:08:13 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G72344YZ"}, "ts": "2023-07-07 18:08:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UI26.510.510"}, "ts": "2023-07-07 18:08:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UI26", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:08:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGX3"}, "ts": "2023-07-07 18:08:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGX3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:08:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15085", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:08:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15085.27.27"}, "ts": "2023-07-07 18:08:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3T1H2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:09:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3T1H2"}, "ts": "2023-07-07 18:09:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3ULM6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:09:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3ULM6"}, "ts": "2023-07-07 18:09:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00206", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:10:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O00206.205.205"}, "ts": "2023-07-07 18:10:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13807", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:10:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13807"}, "ts": "2023-07-07 18:10:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00387.30.30"}, "ts": "2023-07-07 18:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00387", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2D0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:11:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2D0.1316.1316"}, "ts": "2023-07-07 18:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:11:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G10486CT"}, "ts": "2023-07-07 18:11:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G02030ZB"}, "ts": "2023-07-07 18:11:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G38663NM"}, "ts": "2023-07-07 18:11:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25418HZ"}, "ts": "2023-07-07 18:11:12 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G12580WI"}, "ts": "2023-07-07 18:11:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18175340", "type": "PubMed"}, "ts": "2023-07-07 18:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18175340", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:11:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C4Q6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:11:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C4Q6"}, "ts": "2023-07-07 18:12:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02750"}, "ts": "2023-07-07 18:12:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:12:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZL4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:12:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZL4"}, "ts": "2023-07-07 18:12:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BMP6-1"}, "ts": "2023-07-07 18:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BMP6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:12:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12706885", "type": "PubMed"}, "ts": "2023-07-07 18:12:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12706885", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:12:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VFD3"}, "ts": "2023-07-07 18:12:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VFD3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:12:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "1316765"}, "ts": "2023-07-07 18:13:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 18:13:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:13:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10524255", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:13:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10524255", "type": "PubMed"}, "ts": "2023-07-07 18:13:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P45379", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:13:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UW49", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:13:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6UW49.345.345"}, "ts": "2023-07-07 18:13:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6XYQ8.489.489"}, "ts": "2023-07-07 18:13:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XYQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:13:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95864", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:13:43 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95864.239.239"}, "ts": "2023-07-07 18:13:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92604", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:13:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92604"}, "ts": "2023-07-07 18:13:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q3UH06.161.161"}, "ts": "2023-07-07 18:14:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UH06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:14:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05112"}, "ts": "2023-07-07 18:14:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10525162", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:14:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10525162", "type": "PubMed"}, "ts": "2023-07-07 18:14:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P752-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:14:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P752-1"}, "ts": "2023-07-07 18:14:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35278-1"}, "ts": "2023-07-07 18:15:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35278-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:15:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:15:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22301", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:15:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22301"}, "ts": "2023-07-07 18:15:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "13681368", "type": "PubMed"}, "ts": "2023-07-07 18:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "13681368", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28030866", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:16:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28030866", "type": "PubMed"}, "ts": "2023-07-07 18:16:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15298678", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:16:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15298678", "type": "PubMed"}, "ts": "2023-07-07 18:16:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92804", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 18:16:52 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q92804", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 18:16:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:17:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00747-1"}, "ts": "2023-07-07 18:17:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00747-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:17:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 18:17:45 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q32MZ4", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 18:17:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q32MZ4", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 18:17:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M936-1"}, "ts": "2023-07-07 18:18:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M936-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:18:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55809", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:18:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4E1"}, "ts": "2023-07-07 18:18:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00613", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:18:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55809"}, "ts": "2023-07-07 18:18:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JTN6"}, "ts": "2023-07-07 18:18:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JTN6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:18:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17948-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:18:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17948-1.238.238"}, "ts": "2023-07-07 18:18:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPQ0"}, "ts": "2023-07-07 18:19:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35476", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:19:47 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 18:19:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35476"}, "ts": "2023-07-07 18:19:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20471030", "type": "PubMed"}, "ts": "2023-07-07 18:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20471030", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:19:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q71RJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:20:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:20:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00736"}, "ts": "2023-07-07 18:20:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00736", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:20:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86VP3"}, "ts": "2023-07-07 18:20:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86VP3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:20:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.128.128"}, "ts": "2023-07-07 18:20:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A5YKK6.1189.1189"}, "ts": "2023-07-07 18:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A5YKK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:21:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26041"}, "ts": "2023-07-07 18:21:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26041", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:21:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14373", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:21:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF72", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:21:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF72"}, "ts": "2023-07-07 18:21:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12176666", "type": "PubMed"}, "ts": "2023-07-07 18:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12176666", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9565585", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:21:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9565585", "type": "PubMed"}, "ts": "2023-07-07 18:21:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22082675", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:22:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22082675", "type": "PubMed"}, "ts": "2023-07-07 18:22:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4C8.609.609"}, "ts": "2023-07-07 18:22:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:22:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75509-1"}, "ts": "2023-07-07 18:22:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75509-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:22:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q86X59"}, "ts": "2023-07-07 18:22:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86X59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DF91", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:23:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "B5DF91.202.202"}, "ts": "2023-07-07 18:23:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61202"}, "ts": "2023-07-07 18:23:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61202", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:23:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16503878", "type": "PubMed"}, "ts": "2023-07-07 18:23:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16503878", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:23:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20909"}, "ts": "2023-07-07 18:24:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2RU67"}, "ts": "2023-07-07 18:24:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2RU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:25:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VWK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:25:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VWK5"}, "ts": "2023-07-07 18:25:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18227064", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:25:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18227064", "type": "PubMed"}, "ts": "2023-07-07 18:25:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12892531", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:25:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12892531", "type": "PubMed"}, "ts": "2023-07-07 18:25:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 18:26:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99950SF", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 18:26:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99950SF"}, "ts": "2023-07-07 18:26:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23526.68.68"}, "ts": "2023-07-07 18:26:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23526", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:26:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00422"}, "ts": "2023-07-07 18:26:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:26:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00422", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:26:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15381699", "type": "PubMed"}, "ts": "2023-07-07 18:26:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15381699", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:26:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QD5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:27:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96QD5.356.356"}, "ts": "2023-07-07 18:27:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23284758", "type": "PubMed"}, "ts": "2023-07-07 18:27:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23284758", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:27:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q09328"}, "ts": "2023-07-07 18:27:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09328", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:28:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30531"}, "ts": "2023-07-07 18:28:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q08AF8"}, "ts": "2023-07-07 18:28:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q08AF8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:28:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02679"}, "ts": "2023-07-07 18:28:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60664"}, "ts": "2023-07-07 18:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48742", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:29:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P48742.340.340"}, "ts": "2023-07-07 18:29:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYP8"}, "ts": "2023-07-07 18:29:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:29:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6EMK4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:29:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6EMK4.26.26"}, "ts": "2023-07-07 18:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05538", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:30:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05538"}, "ts": "2023-07-07 18:30:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05112", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:30:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12655319", "type": "PubMed"}, "ts": "2023-07-07 18:31:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12655319", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:31:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96LW9.100.100"}, "ts": "2023-07-07 18:31:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96LW9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22307-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:31:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22307-1"}, "ts": "2023-07-07 18:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:32:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PIU2"}, "ts": "2023-07-07 18:32:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PIU2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:32:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C6A2"}, "ts": "2023-07-07 18:32:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C6A2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:32:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G05724UK"}, "ts": "2023-07-07 18:32:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G39188ZX"}, "ts": "2023-07-07 18:33:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12805"}, "ts": "2023-07-07 18:33:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:33:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01860"}, "ts": "2023-07-07 18:33:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56A07", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:33:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q56A07.192.192"}, "ts": "2023-07-07 18:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:34:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43790.249.249"}, "ts": "2023-07-07 18:35:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43790", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:35:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06507-1"}, "ts": "2023-07-07 18:35:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06507-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:35:23 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G25451PN"}, "ts": "2023-07-07 18:36:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WXE1.224.224"}, "ts": "2023-07-07 18:36:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXE1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:36:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23708187", "type": "PubMed"}, "ts": "2023-07-07 18:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23708187", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:37:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NUM3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NUM3"}, "ts": "2023-07-07 18:37:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:38:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-07 18:38:10 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G12398HZ"}, "ts": "2023-07-07 18:38:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBG0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:40:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01588-1"}, "ts": "2023-07-07 18:40:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30082"}, "ts": "2023-07-07 18:41:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:42:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJP0"}, "ts": "2023-07-07 18:42:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31059263", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:42:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31059263", "type": "PubMed"}, "ts": "2023-07-07 18:42:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VD1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:43:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VD1-1"}, "ts": "2023-07-07 18:43:13 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9CTG6", "cluster_type": "unselected"}, "ts": "2023-07-07 18:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CTG6", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 18:43:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CTG6", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 18:43:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95741", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95741"}, "ts": "2023-07-07 18:43:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C0L4"}, "ts": "2023-07-07 18:43:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C0L4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:43:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:44:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NY99", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:44:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NY99"}, "ts": "2023-07-07 18:44:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:44:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CS3"}, "ts": "2023-07-07 18:44:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BYJ9.173.173"}, "ts": "2023-07-07 18:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYJ9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60664", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:44:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:45:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99466", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:45:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99466.682.682"}, "ts": "2023-07-07 18:45:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000079"}, "ts": "2023-07-07 18:46:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVT6"}, "ts": "2023-07-07 18:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:46:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:46:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92922"}, "ts": "2023-07-07 18:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92922", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1X6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:47:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28240246", "type": "PubMed"}, "ts": "2023-07-07 18:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28240246", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:47:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8R1X6.126.126"}, "ts": "2023-07-07 18:47:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:47:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16054034", "type": "PubMed"}, "ts": "2023-07-07 18:47:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16054034", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:47:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70700"}, "ts": "2023-07-07 18:47:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70700", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:47:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBJ7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:48:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NBJ7"}, "ts": "2023-07-07 18:48:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D5A9"}, "ts": "2023-07-07 18:48:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D5A9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:48:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P42260"}, "ts": "2023-07-07 18:48:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P42260", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:48:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G05724UK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 18:48:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12805", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:49:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00526-1"}, "ts": "2023-07-07 18:49:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00526-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:49:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2470007", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:49:37 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2470007", "type": "PubMed"}, "ts": "2023-07-07 18:49:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61146.368.368"}, "ts": "2023-07-07 18:51:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61146", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:51:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41438", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:51:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41438.472.472"}, "ts": "2023-07-07 18:51:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00688-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:52:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00688-1"}, "ts": "2023-07-07 18:52:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NA31", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:52:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NA31.48.48"}, "ts": "2023-07-07 18:52:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z0K7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:52:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z0K7"}, "ts": "2023-07-07 18:52:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22625SJ"}, "ts": "2023-07-07 18:52:31 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34511173", "type": "PubMed"}, "ts": "2023-07-07 18:52:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34511173", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:52:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34511173", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 18:52:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13867-1"}, "ts": "2023-07-07 18:53:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QY96", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:53:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QY96"}, "ts": "2023-07-07 18:53:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q07782", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:53:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q07782"}, "ts": "2023-07-07 18:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43602", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:53:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43602"}, "ts": "2023-07-07 18:53:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62386"}, "ts": "2023-07-07 18:54:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G12398HZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 18:54:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7833916", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:54:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7833916", "type": "PubMed"}, "ts": "2023-07-07 18:54:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PHB0"}, "ts": "2023-07-07 18:54:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WU67"}, "ts": "2023-07-07 18:54:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4C0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:54:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y4C0.1189.1189"}, "ts": "2023-07-07 18:54:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PHB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9GZP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:54:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51570"}, "ts": "2023-07-07 18:54:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9GZP0"}, "ts": "2023-07-07 18:54:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WU67", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:55:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14174"}, "ts": "2023-07-07 18:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11423977", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 18:55:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11423977", "type": "PubMed"}, "ts": "2023-07-07 18:55:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52565-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:55:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52565-1"}, "ts": "2023-07-07 18:55:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92847"}, "ts": "2023-07-07 18:55:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60934", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:56:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60934"}, "ts": "2023-07-07 18:56:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01588-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:56:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKL0"}, "ts": "2023-07-07 18:56:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWZ8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:56:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXI9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:56:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWZ8"}, "ts": "2023-07-07 18:56:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXI9"}, "ts": "2023-07-07 18:56:28 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G04792UK"}, "ts": "2023-07-07 18:56:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:56:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UEW8"}, "ts": "2023-07-07 18:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UEW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:56:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5T1H1"}, "ts": "2023-07-07 18:56:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5T1H1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9B5", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 18:57:42 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q8N9B5", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 18:57:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30082", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:57:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84086", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:57:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84086"}, "ts": "2023-07-07 18:57:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13572", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 18:58:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13572"}, "ts": "2023-07-07 18:58:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06576"}, "ts": "2023-07-07 18:58:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95707-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:58:26 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95707-1.10.10"}, "ts": "2023-07-07 18:58:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VC44", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 18:58:48 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q4VC44.21.21"}, "ts": "2023-07-07 18:58:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95983"}, "ts": "2023-07-07 18:59:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:59:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 18:59:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95983"}, "ts": "2023-07-07 18:59:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:00:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:00:00 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 19:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 19:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 19:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 19:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 19:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 19:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BYD3"}, "ts": "2023-07-07 19:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BYD3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:00:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95983"}, "ts": "2023-07-07 19:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95983", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:00:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q92823.508.508"}, "ts": "2023-07-07 19:00:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92823", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCR3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:00:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCR3"}, "ts": "2023-07-07 19:00:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:00:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15456940", "type": "PubMed"}, "ts": "2023-07-07 19:00:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15456940", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:00:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13315"}, "ts": "2023-07-07 19:00:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10828"}, "ts": "2023-07-07 19:00:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "7643126", "type": "PubMed"}, "ts": "2023-07-07 19:01:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "7643126", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:01:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8QZV4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:01:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8QZV4"}, "ts": "2023-07-07 19:01:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31997"}, "ts": "2023-07-07 19:01:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31997", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:01:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92552-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92552-1"}, "ts": "2023-07-07 19:01:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41145"}, "ts": "2023-07-07 19:02:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41145", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:02:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TC44-1"}, "ts": "2023-07-07 19:02:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TC44-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:02:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NTZ6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:02:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NTZ6"}, "ts": "2023-07-07 19:02:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:02:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12923.1936.1936"}, "ts": "2023-07-07 19:02:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12923", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:02:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17828275", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:02:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17828275", "type": "PubMed"}, "ts": "2023-07-07 19:02:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96PD5"}, "ts": "2023-07-07 19:03:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PD5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:03:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15761"}, "ts": "2023-07-07 19:03:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15761", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:03:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CW46", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:03:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CW46"}, "ts": "2023-07-07 19:03:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82081LV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:03:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82081LV"}, "ts": "2023-07-07 19:03:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:03:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60494"}, "ts": "2023-07-07 19:03:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60494", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:04:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5S8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:04:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5S8.443.443"}, "ts": "2023-07-07 19:04:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13504-1"}, "ts": "2023-07-07 19:04:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13952", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:05:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13952.182.182"}, "ts": "2023-07-07 19:05:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08575"}, "ts": "2023-07-07 19:05:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13646.49.49"}, "ts": "2023-07-07 19:05:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13646", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:05:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "list-of-motifs", "message": "page access"}, "ts": "2023-07-07 19:05:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P15924"}, "ts": "2023-07-07 19:05:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01583"}, "ts": "2023-07-07 19:06:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4V8G8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:06:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4V8G8"}, "ts": "2023-07-07 19:06:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A4D1F6"}, "ts": "2023-07-07 19:07:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D1F6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:07:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:08:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12887"}, "ts": "2023-07-07 19:08:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75352"}, "ts": "2023-07-07 19:08:42 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G18183SM"}, "ts": "2023-07-07 19:08:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13867-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:09:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51174"}, "ts": "2023-07-07 19:10:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62386", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13504-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:10:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6DFZ1"}, "ts": "2023-07-07 19:10:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6DFZ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q687X5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:10:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q687X5.217.217"}, "ts": "2023-07-07 19:10:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:10:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51570", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6R2P8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6R2P8"}, "ts": "2023-07-07 19:11:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UPA5"}, "ts": "2023-07-07 19:11:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UPA5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:11:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92847", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:11:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20534430", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:12:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20534430", "type": "PubMed"}, "ts": "2023-07-07 19:12:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZ52", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:12:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZ52"}, "ts": "2023-07-07 19:12:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15897452", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:13:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15897452", "type": "PubMed"}, "ts": "2023-07-07 19:13:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:13:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UWP7"}, "ts": "2023-07-07 19:13:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UWP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:13:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06576", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:14:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18650440", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:14:23 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18650440", "type": "PubMed"}, "ts": "2023-07-07 19:14:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B5DFJ4-1"}, "ts": "2023-07-07 19:14:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B5DFJ4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NVN8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:14:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NVN8"}, "ts": "2023-07-07 19:14:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01876", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:14:34 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01876.249.249"}, "ts": "2023-07-07 19:14:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01860"}, "ts": "2023-07-07 19:14:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:14:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96HR8"}, "ts": "2023-07-07 19:14:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CG09"}, "ts": "2023-07-07 19:15:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31327"}, "ts": "2023-07-07 19:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8620897", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:15:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8620897", "type": "PubMed"}, "ts": "2023-07-07 19:15:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06830", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:16:14 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q06830.32.32"}, "ts": "2023-07-07 19:16:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P47211", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:16:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P47211"}, "ts": "2023-07-07 19:16:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WWQ8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:16:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WWQ8.567.567"}, "ts": "2023-07-07 19:16:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24600566", "type": "PubMed"}, "ts": "2023-07-07 19:16:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24600566", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:16:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13315", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:16:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10828", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:16:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:17:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96HC4.156.156"}, "ts": "2023-07-07 19:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HC4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:17:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29291351", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:17:17 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29291351", "type": "PubMed"}, "ts": "2023-07-07 19:17:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:17:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01116"}, "ts": "2023-07-07 19:17:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 19:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00751-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:17:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:18:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00751-1"}, "ts": "2023-07-07 19:18:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98073"}, "ts": "2023-07-07 19:18:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99075.75.75"}, "ts": "2023-07-07 19:18:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99075", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKL0"}, "ts": "2023-07-07 19:18:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:18:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:19:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43347", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:19:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43347.195.195"}, "ts": "2023-07-07 19:19:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDC0"}, "ts": "2023-07-07 19:19:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDC0", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:19:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1C9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:20:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1C9"}, "ts": "2023-07-07 19:20:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A197-1"}, "ts": "2023-07-07 19:21:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A197-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:21:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13003", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:21:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13003.61.61"}, "ts": "2023-07-07 19:21:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08575", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:21:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15924", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:21:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01583", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:22:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G01614ZM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:22:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:22:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z6Z7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:22:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z6Z7"}, "ts": "2023-07-07 19:22:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q498D1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:22:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q498D1"}, "ts": "2023-07-07 19:22:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11215", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:22:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11215.1052.1052"}, "ts": "2023-07-07 19:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11802-1"}, "ts": "2023-07-07 19:22:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11802-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:22:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CP6"}, "ts": "2023-07-07 19:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CP6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:23:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48549"}, "ts": "2023-07-07 19:23:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48549", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:23:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:23:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O95155.136.136"}, "ts": "2023-07-07 19:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K3Y6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:23:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K3Y6"}, "ts": "2023-07-07 19:23:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60673", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:24:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60673"}, "ts": "2023-07-07 19:24:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31750", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:24:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31750"}, "ts": "2023-07-07 19:24:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "site_view.html", "message": "page access"}, "ts": "2023-07-07 19:24:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75352", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:24:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13637"}, "ts": "2023-07-07 19:24:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52630"}, "ts": "2023-07-07 19:24:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52630", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:25:02 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G09724ZC"}, "ts": "2023-07-07 19:25:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19054061", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:25:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19054061", "type": "PubMed"}, "ts": "2023-07-07 19:25:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33986189", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:25:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33986189", "type": "PubMed"}, "ts": "2023-07-07 19:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51174", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:26:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CG09", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:26:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBK8-2"}, "ts": "2023-07-07 19:26:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBK8-2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:26:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33639214", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:26:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33639214", "type": "PubMed"}, "ts": "2023-07-07 19:26:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99KE1"}, "ts": "2023-07-07 19:26:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99KE1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:26:54 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G60660BN"}, "ts": "2023-07-07 19:27:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16656"}, "ts": "2023-07-07 19:27:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02655"}, "ts": "2023-07-07 19:27:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:27:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JRS4"}, "ts": "2023-07-07 19:27:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JRS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43149", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:27:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O43149.29.29"}, "ts": "2023-07-07 19:27:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50391", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:28:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P50391.21.21"}, "ts": "2023-07-07 19:28:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z7A1.1674.1674"}, "ts": "2023-07-07 19:28:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7A1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:28:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00653-1"}, "ts": "2023-07-07 19:28:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13131"}, "ts": "2023-07-07 19:29:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51689", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:29:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P51689.221.221"}, "ts": "2023-07-07 19:29:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 19:30:20 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O43660", "cluster_type": "unselected"}, "ts": "2023-07-07 19:30:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43660", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 19:30:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:30:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5K2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:30:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5K2"}, "ts": "2023-07-07 19:30:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NCC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:30:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NCC5"}, "ts": "2023-07-07 19:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97303", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:31:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97303"}, "ts": "2023-07-07 19:31:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94989", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:31:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O94989.572.572"}, "ts": "2023-07-07 19:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:31:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10398604", "type": "PubMed"}, "ts": "2023-07-07 19:31:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10398604", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:31:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33645007", "type": "PubMed"}, "ts": "2023-07-07 19:32:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33645007", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:32:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:32:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NWK9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:32:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NWK9"}, "ts": "2023-07-07 19:32:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75179.156.156"}, "ts": "2023-07-07 19:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75179", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:32:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22452784", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:33:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22452784", "type": "PubMed"}, "ts": "2023-07-07 19:33:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VV41", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:33:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VV41"}, "ts": "2023-07-07 19:33:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K440"}, "ts": "2023-07-07 19:33:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K440", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:33:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51124"}, "ts": "2023-07-07 19:33:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51124", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R1V4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:33:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AC1"}, "ts": "2023-07-07 19:33:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AC1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:33:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R1V4"}, "ts": "2023-07-07 19:33:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00395TQ"}, "ts": "2023-07-07 19:33:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:34:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99500", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:34:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99500"}, "ts": "2023-07-07 19:34:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53634"}, "ts": "2023-07-07 19:34:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53634", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:34:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05231"}, "ts": "2023-07-07 19:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05231", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09668", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:34:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09668"}, "ts": "2023-07-07 19:34:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:35:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2R5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:35:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2R5-1"}, "ts": "2023-07-07 19:35:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A4D0S4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:35:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A4D0S4.359.359"}, "ts": "2023-07-07 19:35:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:35:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9JIP7.439.439"}, "ts": "2023-07-07 19:35:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D312"}, "ts": "2023-07-07 19:36:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D312", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:36:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZPN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:36:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZPN1"}, "ts": "2023-07-07 19:36:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P46459"}, "ts": "2023-07-07 19:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95864", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:37:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95864"}, "ts": "2023-07-07 19:37:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:37:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ1"}, "ts": "2023-07-07 19:37:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A1B0GVH4"}, "ts": "2023-07-07 19:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A1B0GVH4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:37:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14550", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:37:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14550.38.38"}, "ts": "2023-07-07 19:37:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96KB5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:37:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96KB5"}, "ts": "2023-07-07 19:37:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 19:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60749", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:38:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60749.101.101"}, "ts": "2023-07-07 19:38:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q03431", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:38:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q03431"}, "ts": "2023-07-07 19:38:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P41229.287.287"}, "ts": "2023-07-07 19:38:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41229", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:38:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24941", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:38:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P24941"}, "ts": "2023-07-07 19:38:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00161"}, "ts": "2023-07-07 19:38:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:38:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:38:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A597", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:39:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8123671", "type": "PubMed"}, "ts": "2023-07-07 19:39:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8123671", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:39:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P17812"}, "ts": "2023-07-07 19:39:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G81315DD"}, "ts": "2023-07-07 19:39:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15024-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:39:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15024-1"}, "ts": "2023-07-07 19:39:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29444170", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:39:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29444170", "type": "PubMed"}, "ts": "2023-07-07 19:39:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14733"}, "ts": "2023-07-07 19:40:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:40:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08146BT"}, "ts": "2023-07-07 19:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38571", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:40:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P38571"}, "ts": "2023-07-07 19:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26640", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:41:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P26640"}, "ts": "2023-07-07 19:41:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15691", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:41:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q15691.17.17"}, "ts": "2023-07-07 19:41:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11521686", "type": "PubMed"}, "ts": "2023-07-07 19:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11521686", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:41:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09416", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:41:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P09416.58.58"}, "ts": "2023-07-07 19:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NC51", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:41:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NC51"}, "ts": "2023-07-07 19:41:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75636"}, "ts": "2023-07-07 19:42:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75636", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:42:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60660BN", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:43:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G50616BB"}, "ts": "2023-07-07 19:43:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02655", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20385583", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:43:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20385583", "type": "PubMed"}, "ts": "2023-07-07 19:43:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21147462", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:43:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21147462", "type": "PubMed"}, "ts": "2023-07-07 19:43:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12968"}, "ts": "2023-07-07 19:43:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49116"}, "ts": "2023-07-07 19:43:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49116", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08730", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08730"}, "ts": "2023-07-07 19:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12968"}, "ts": "2023-07-07 19:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12968"}, "ts": "2023-07-07 19:44:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VGD9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:44:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VGD9"}, "ts": "2023-07-07 19:44:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12968"}, "ts": "2023-07-07 19:44:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12968"}, "ts": "2023-07-07 19:44:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12968"}, "ts": "2023-07-07 19:44:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A9UHW6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A9UHW6-1"}, "ts": "2023-07-07 19:44:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23280"}, "ts": "2023-07-07 19:44:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12968"}, "ts": "2023-07-07 19:44:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12968", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00653-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:44:55 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12074582", "type": "PubMed"}, "ts": "2023-07-07 19:45:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12074582", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:45:22 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12626403", "type": "PubMed"}, "ts": "2023-07-07 19:45:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12626403", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:45:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6NUJ2"}, "ts": "2023-07-07 19:46:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6NUJ2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:46:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21497122", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:46:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21497122", "type": "PubMed"}, "ts": "2023-07-07 19:46:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N9V2"}, "ts": "2023-07-07 19:46:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9V2", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:46:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:46:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1N7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:46:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H1N7"}, "ts": "2023-07-07 19:46:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TCJ2.616.616"}, "ts": "2023-07-07 19:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCJ2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:46:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EQD0"}, "ts": "2023-07-07 19:47:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EQD0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P4T2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P4T2"}, "ts": "2023-07-07 19:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z2T2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z2T2"}, "ts": "2023-07-07 19:47:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20761"}, "ts": "2023-07-07 19:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20761", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHJ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:47:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JHJ0"}, "ts": "2023-07-07 19:47:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28065600", "type": "PubMed"}, "ts": "2023-07-07 19:47:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28065600", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:47:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DP23"}, "ts": "2023-07-07 19:48:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DP23", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:48:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8QZY4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:48:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8QZY4-1"}, "ts": "2023-07-07 19:48:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62188", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:48:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62188"}, "ts": "2023-07-07 19:48:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A3KN83.755.755"}, "ts": "2023-07-07 19:48:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q56A07", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:48:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q56A07"}, "ts": "2023-07-07 19:48:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A3KN83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:48:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15260-1.79.79"}, "ts": "2023-07-07 19:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15260-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:48:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5VZ46", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:49:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5VZ46"}, "ts": "2023-07-07 19:49:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZRP7"}, "ts": "2023-07-07 19:49:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZRP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:49:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60507"}, "ts": "2023-07-07 19:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q75NI5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:49:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75NI5-1"}, "ts": "2023-07-07 19:49:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00395TQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:49:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RY56"}, "ts": "2023-07-07 19:49:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RY56", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:02 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28065471", "type": "PubMed"}, "ts": "2023-07-07 19:50:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28065471", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:50:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y616", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:21 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y616"}, "ts": "2023-07-07 19:50:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P34978"}, "ts": "2023-07-07 19:50:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P34978", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2A8L5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2A8L5"}, "ts": "2023-07-07 19:50:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04446"}, "ts": "2023-07-07 19:50:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04446", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IWB1"}, "ts": "2023-07-07 19:50:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IWB1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00241-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00241-1"}, "ts": "2023-07-07 19:50:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "29423877", "type": "PubMed"}, "ts": "2023-07-07 19:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "29423877", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 19:50:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WW01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WW01"}, "ts": "2023-07-07 19:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NC60"}, "ts": "2023-07-07 19:51:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NC60", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:51:04 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N9I0.23.23"}, "ts": "2023-07-07 19:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N9I0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:51:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVM7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:51:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVM7.24.24"}, "ts": "2023-07-07 19:51:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q569C3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q569C3"}, "ts": "2023-07-07 19:52:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7FG68"}, "ts": "2023-07-07 19:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7FG68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:52:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P46459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21802-1"}, "ts": "2023-07-07 19:53:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21802-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q62522"}, "ts": "2023-07-07 19:53:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62522", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14641"}, "ts": "2023-07-07 19:53:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14641", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94972"}, "ts": "2023-07-07 19:53:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15144"}, "ts": "2023-07-07 19:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15144", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94972", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:54:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O14894", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:54:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O14894"}, "ts": "2023-07-07 19:54:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G43417UB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:54:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17927", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 19:54:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17927.1312.1312"}, "ts": "2023-07-07 19:54:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q921V7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:55:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q921V7"}, "ts": "2023-07-07 19:55:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G81315DD", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:55:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17812", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:55:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05362"}, "ts": "2023-07-07 19:55:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05362", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:55:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BUN1"}, "ts": "2023-07-07 19:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BUN1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:55:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXA9"}, "ts": "2023-07-07 19:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXA9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23946-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23946-1"}, "ts": "2023-07-07 19:56:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14733", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:56:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96BY6"}, "ts": "2023-07-07 19:56:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96BY6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:56:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZBK4"}, "ts": "2023-07-07 19:56:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZBK4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 19:56:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08146BT", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 19:56:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZA6"}, "ts": "2023-07-07 19:57:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64478", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64478"}, "ts": "2023-07-07 19:57:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "C9JLW8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "C9JLW8"}, "ts": "2023-07-07 19:57:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99N43", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16777"}, "ts": "2023-07-07 19:57:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99N43"}, "ts": "2023-07-07 19:57:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16777", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HA82", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HA82"}, "ts": "2023-07-07 19:57:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56856"}, "ts": "2023-07-07 19:57:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q75NI5-1"}, "ts": "2023-07-07 19:58:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F7ESD4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:59:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F7ESD4-1"}, "ts": "2023-07-07 19:59:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GR2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 19:59:46 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 20:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 20:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 20:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 20:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 20:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GR2"}, "ts": "2023-07-07 20:00:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49643"}, "ts": "2023-07-07 20:00:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D244", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D244"}, "ts": "2023-07-07 20:00:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P8K8"}, "ts": "2023-07-07 20:00:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BS40"}, "ts": "2023-07-07 20:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P8K8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P84074"}, "ts": "2023-07-07 20:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P84074", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49643"}, "ts": "2023-07-07 20:00:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49643", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2U1-1"}, "ts": "2023-07-07 20:00:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2U1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:00:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95677"}, "ts": "2023-07-07 20:01:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95677", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:01:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08962"}, "ts": "2023-07-07 20:01:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08962", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:01:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULX7"}, "ts": "2023-07-07 20:02:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULX7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:02:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G50045TK"}, "ts": "2023-07-07 20:02:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BQA1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:03:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BQA1"}, "ts": "2023-07-07 20:03:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21709"}, "ts": "2023-07-07 20:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21709", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:03:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96H15"}, "ts": "2023-07-07 20:03:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:03:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13501"}, "ts": "2023-07-07 20:03:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96H15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:03:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41743", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:03:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41743"}, "ts": "2023-07-07 20:03:59 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000022"}, "ts": "2023-07-07 20:04:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G55051BJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:04:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G55051BJ"}, "ts": "2023-07-07 20:04:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54886", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:05:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54886"}, "ts": "2023-07-07 20:05:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q01959"}, "ts": "2023-07-07 20:05:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2W7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:05:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P2W7"}, "ts": "2023-07-07 20:05:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3F8"}, "ts": "2023-07-07 20:06:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N3F8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:06:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51679"}, "ts": "2023-07-07 20:06:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:06:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D687", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:06:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9D687.627.627"}, "ts": "2023-07-07 20:07:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BM92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:07:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:07:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BM92"}, "ts": "2023-07-07 20:07:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q0P6H9"}, "ts": "2023-07-07 20:07:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q0P6H9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:07:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96ST3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:07:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96ST3.537.537"}, "ts": "2023-07-07 20:07:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5F8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:07:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y5F8.597.597"}, "ts": "2023-07-07 20:07:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23887LS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:07:49 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23887LS"}, "ts": "2023-07-07 20:07:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-07 20:07:51 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9UGR2", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 20:07:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGR2", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 20:07:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGR2", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 20:07:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96FW1"}, "ts": "2023-07-07 20:09:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96FW1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:09:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NPP4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NPP4-1"}, "ts": "2023-07-07 20:10:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BHN3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BHN3-1"}, "ts": "2023-07-07 20:10:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:10:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22422861", "type": "PubMed"}, "ts": "2023-07-07 20:10:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22422861", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:10:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKR3"}, "ts": "2023-07-07 20:10:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01732"}, "ts": "2023-07-07 20:10:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKR3"}, "ts": "2023-07-07 20:10:32 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34223979", "type": "PubMed"}, "ts": "2023-07-07 20:10:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34223979", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:10:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKR3"}, "ts": "2023-07-07 20:10:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKR3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:10:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKR3"}, "ts": "2023-07-07 20:10:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZMB0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:11:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6ZMB0.73.73"}, "ts": "2023-07-07 20:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L50-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:11:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L50-1"}, "ts": "2023-07-07 20:11:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63HN8"}, "ts": "2023-07-07 20:11:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63HN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:11:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9C0D2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:11:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:11:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NGY1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:11:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NGY1"}, "ts": "2023-07-07 20:11:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84467IZ"}, "ts": "2023-07-07 20:11:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y616"}, "ts": "2023-07-07 20:12:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y616", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:12:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49327"}, "ts": "2023-07-07 20:12:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:12:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P98161"}, "ts": "2023-07-07 20:12:46 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-07 20:13:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-07 20:13:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56856", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B2RZD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:13:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B2RZD2"}, "ts": "2023-07-07 20:13:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLC4"}, "ts": "2023-07-07 20:14:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NHC4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NHC4"}, "ts": "2023-07-07 20:15:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80Z19"}, "ts": "2023-07-07 20:15:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80Z19", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:15:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99NB3"}, "ts": "2023-07-07 20:15:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99NB3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRT6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:16:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRT6"}, "ts": "2023-07-07 20:16:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR96", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 20:16:41 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9NR96", "cluster_type": "unselected"}, "ts": "2023-07-07 20:16:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NR96", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 20:16:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10585853", "type": "PubMed"}, "ts": "2023-07-07 20:16:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10585853", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:16:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54132.633.633"}, "ts": "2023-07-07 20:16:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:16:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01225"}, "ts": "2023-07-07 20:16:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13029", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:17:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13029"}, "ts": "2023-07-07 20:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:17:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51692"}, "ts": "2023-07-07 20:17:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51692", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:17:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99LS3"}, "ts": "2023-07-07 20:17:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99LS3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:17:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31825138", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:18:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31825138", "type": "PubMed"}, "ts": "2023-07-07 20:18:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78310"}, "ts": "2023-07-07 20:18:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78310", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:18:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "23570977"}, "ts": "2023-07-07 20:18:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:18:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 20:18:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A813", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:18:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A813"}, "ts": "2023-07-07 20:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G50045TK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:18:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G35926TG"}, "ts": "2023-07-07 20:19:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license", "message": "page access"}, "ts": "2023-07-07 20:19:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "license", "message": "page access"}, "ts": "2023-07-07 20:19:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:20:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09056"}, "ts": "2023-07-07 20:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09056", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:20:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 20:20:43 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 20:20:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07954"}, "ts": "2023-07-07 20:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07954", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:21:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q01959", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:21:37 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96881BQ"}, "ts": "2023-07-07 20:21:50 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P15151.9.9"}, "ts": "2023-07-07 20:22:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P15151", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:22:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51679", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:22:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12794"}, "ts": "2023-07-07 20:23:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12794", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:23:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86UP3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:23:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86UP3.159.159"}, "ts": "2023-07-07 20:23:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G49424IS"}, "ts": "2023-07-07 20:23:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G49424IS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:23:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13237-1"}, "ts": "2023-07-07 20:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13237-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:23:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VG89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:23:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VG89"}, "ts": "2023-07-07 20:23:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZST9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:24:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZST9"}, "ts": "2023-07-07 20:24:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A5I4"}, "ts": "2023-07-07 20:25:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A5I4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:25:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VHK5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:25:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VHK5"}, "ts": "2023-07-07 20:25:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54132", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:25:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P54132.633.633"}, "ts": "2023-07-07 20:25:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18258790", "type": "PubMed"}, "ts": "2023-07-07 20:26:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18258790", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:26:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:26:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96L91"}, "ts": "2023-07-07 20:26:39 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G10773YW"}, "ts": "2023-07-07 20:26:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96L91", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:26:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15294"}, "ts": "2023-07-07 20:26:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16070"}, "ts": "2023-07-07 20:26:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15637"}, "ts": "2023-07-07 20:26:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:26:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07996", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:27:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07996"}, "ts": "2023-07-07 20:27:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01701"}, "ts": "2023-07-07 20:27:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01701"}, "ts": "2023-07-07 20:27:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84467IZ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:27:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4VBD2"}, "ts": "2023-07-07 20:27:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4VBD2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:28:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z401", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:28:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z401"}, "ts": "2023-07-07 20:28:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98161", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:28:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19958IL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:29:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G91301DM"}, "ts": "2023-07-07 20:29:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G19958IL"}, "ts": "2023-07-07 20:29:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G83460ZZ"}, "ts": "2023-07-07 20:29:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27502BJ"}, "ts": "2023-07-07 20:29:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:29:16 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G99306JE"}, "ts": "2023-07-07 20:29:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G99306JE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:29:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17275788", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:29:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17275788", "type": "PubMed"}, "ts": "2023-07-07 20:29:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6STE5"}, "ts": "2023-07-07 20:30:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6STE5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:30:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:30:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75023", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:30:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75023"}, "ts": "2023-07-07 20:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4AE62", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:30:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4AE62"}, "ts": "2023-07-07 20:30:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O70418-1"}, "ts": "2023-07-07 20:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O70418-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:30:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08887"}, "ts": "2023-07-07 20:30:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:31:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75900"}, "ts": "2023-07-07 20:31:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P5Q4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:31:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P5Q4"}, "ts": "2023-07-07 20:31:38 EDT-0400"}, {"api": "/glycan/search_init/", "req": {}, "ts": "2023-07-07 20:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 20:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan-search", "message": "page access"}, "ts": "2023-07-07 20:31:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y267", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:32:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BGA3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:32:20 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G24954UD"}, "ts": "2023-07-07 20:32:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BGA3"}, "ts": "2023-07-07 20:32:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9HBB8"}, "ts": "2023-07-07 20:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HBB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:32:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7RTX0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:32:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7RTX0-1"}, "ts": "2023-07-07 20:32:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01225", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:32:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34274446", "type": "PubMed"}, "ts": "2023-07-07 20:34:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34274446", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:34:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50135"}, "ts": "2023-07-07 20:34:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P50135", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:34:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G35926TG", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:35:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14209"}, "ts": "2023-07-07 20:36:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NFP4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:36:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:36:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NFP4-1"}, "ts": "2023-07-07 20:36:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A2AKB4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:36:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A2AKB4"}, "ts": "2023-07-07 20:36:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04637"}, "ts": "2023-07-07 20:37:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BVL2.490.490"}, "ts": "2023-07-07 20:37:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:37:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BVL2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:37:05 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G37881RL"}, "ts": "2023-07-07 20:37:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K76", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:37:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K76"}, "ts": "2023-07-07 20:37:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96881BQ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:37:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91VR8"}, "ts": "2023-07-07 20:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91VR8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:38:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVN8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:38:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVN8.178.178"}, "ts": "2023-07-07 20:38:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G10773YW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:38:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q704Y3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q704Y3"}, "ts": "2023-07-07 20:39:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92793-1"}, "ts": "2023-07-07 20:39:31 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G08997GC"}, "ts": "2023-07-07 20:39:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BXP8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:40:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BXP8"}, "ts": "2023-07-07 20:40:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y2M5"}, "ts": "2023-07-07 20:40:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y2M5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78371", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:41:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97499"}, "ts": "2023-07-07 20:41:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78371"}, "ts": "2023-07-07 20:41:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97499", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:41:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9CXU9"}, "ts": "2023-07-07 20:41:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9CXU9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:41:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P8K3"}, "ts": "2023-07-07 20:42:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P8K3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:42:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16254458", "type": "PubMed"}, "ts": "2023-07-07 20:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16254458", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:42:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16070", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:42:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TED4"}, "ts": "2023-07-07 20:43:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TED4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:43:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01701", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:43:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P33993-1"}, "ts": "2023-07-07 20:44:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVT0"}, "ts": "2023-07-07 20:44:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVT0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:44:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80WT5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:44:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80WT5"}, "ts": "2023-07-07 20:44:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6MFY6-1"}, "ts": "2023-07-07 20:45:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MFY6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:45:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:45:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95047", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95047"}, "ts": "2023-07-07 20:45:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08003"}, "ts": "2023-07-07 20:45:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08003", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:45:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53778"}, "ts": "2023-07-07 20:45:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JRM2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:46:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JRM2.88.88"}, "ts": "2023-07-07 20:46:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08887", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:46:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "D3ZQP6-1.256.256"}, "ts": "2023-07-07 20:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQP6-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:47:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CH93", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:47:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CH93"}, "ts": "2023-07-07 20:47:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91V01", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:47:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q91V01"}, "ts": "2023-07-07 20:47:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G14843DJ"}, "ts": "2023-07-07 20:48:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ULY5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:48:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ULY5"}, "ts": "2023-07-07 20:48:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18320024", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:48:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18320024", "type": "PubMed"}, "ts": "2023-07-07 20:48:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22103961", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:49:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22103961", "type": "PubMed"}, "ts": "2023-07-07 20:49:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29122"}, "ts": "2023-07-07 20:50:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q62656", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:50:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q62656.595.595"}, "ts": "2023-07-07 20:50:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14209", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:51:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O35717"}, "ts": "2023-07-07 20:52:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O35717", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:52:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G37881RL", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:52:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20200153", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04637", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:53:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20200153", "type": "PubMed"}, "ts": "2023-07-07 20:53:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14151-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 20:53:16 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P14151-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 20:53:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49000", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:53:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49000"}, "ts": "2023-07-07 20:53:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13995.127.127"}, "ts": "2023-07-07 20:53:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13995", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:53:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QS3-1"}, "ts": "2023-07-07 20:53:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QS3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:53:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19484.135.135"}, "ts": "2023-07-07 20:53:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19484", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:53:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11247.711.711"}, "ts": "2023-07-07 20:54:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11247", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:54:04 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32852799", "type": "PubMed"}, "ts": "2023-07-07 20:54:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32852799", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:54:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95400"}, "ts": "2023-07-07 20:54:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95400", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:54:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6W3E5"}, "ts": "2023-07-07 20:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59743JO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:55:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59743JO"}, "ts": "2023-07-07 20:55:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49840", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:55:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49840"}, "ts": "2023-07-07 20:55:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:55:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13942"}, "ts": "2023-07-07 20:55:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P656"}, "ts": "2023-07-07 20:55:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95347"}, "ts": "2023-07-07 20:55:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:55:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G08997GC", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 20:55:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22344298", "type": "PubMed"}, "ts": "2023-07-07 20:55:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22344298", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 20:55:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EP86"}, "ts": "2023-07-07 20:56:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:56:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04439"}, "ts": "2023-07-07 20:56:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04439", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EP86", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:56:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "L7N293"}, "ts": "2023-07-07 20:56:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "L7N293", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:56:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PRE5", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:57:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5PRE5"}, "ts": "2023-07-07 20:57:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00584", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:57:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00584"}, "ts": "2023-07-07 20:57:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q920L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:58:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q920L1"}, "ts": "2023-07-07 20:58:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00488", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:58:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P00488.347.347"}, "ts": "2023-07-07 20:58:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:58:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08590"}, "ts": "2023-07-07 20:58:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51946", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:58:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H0E7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:58:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O60346.611.611"}, "ts": "2023-07-07 20:58:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60346", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 20:58:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11940"}, "ts": "2023-07-07 20:58:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P82808", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 20:58:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P82808"}, "ts": "2023-07-07 20:58:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PGF5"}, "ts": "2023-07-07 20:58:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PGF5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 20:58:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-07 20:58:58 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 21:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 21:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 21:00:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10253-1"}, "ts": "2023-07-07 21:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 21:00:07 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 21:00:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 21:00:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P33993-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:00:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94988", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:00:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O94988"}, "ts": "2023-07-07 21:00:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B1AS42"}, "ts": "2023-07-07 21:00:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B1AS42", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:00:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT30"}, "ts": "2023-07-07 21:00:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT30", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:00:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G20291UE"}, "ts": "2023-07-07 21:01:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G20291UE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 21:01:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53778", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:01:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54130"}, "ts": "2023-07-07 21:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54130", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:02:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0C7H8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0C7H8"}, "ts": "2023-07-07 21:03:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZF92"}, "ts": "2023-07-07 21:03:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZF92", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:03:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NMS3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:04:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:04:18 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NMS3.5.5"}, "ts": "2023-07-07 21:04:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53992"}, "ts": "2023-07-07 21:04:27 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96577RX"}, "ts": "2023-07-07 21:05:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P09919"}, "ts": "2023-07-07 21:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P09919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:05:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29122", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:06:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P51689"}, "ts": "2023-07-07 21:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P51689", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:06:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:07:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7KZ85", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:07:29 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7KZ85.75.75"}, "ts": "2023-07-07 21:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UX72-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:07:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UX72-1"}, "ts": "2023-07-07 21:07:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20340"}, "ts": "2023-07-07 21:07:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20340", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:08:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27007576", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:08:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27007576", "type": "PubMed"}, "ts": "2023-07-07 21:08:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27007576", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 21:08:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35354", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:08:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35354.130.130"}, "ts": "2023-07-07 21:08:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21860"}, "ts": "2023-07-07 21:09:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0DTC2-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0DTC2-1"}, "ts": "2023-07-07 21:09:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3KQP7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:09:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3KQP7"}, "ts": "2023-07-07 21:09:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PZI3"}, "ts": "2023-07-07 21:10:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PZI3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:10:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31560728", "type": "PubMed"}, "ts": "2023-07-07 21:10:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31560728", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:10:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9R160.378.378"}, "ts": "2023-07-07 21:10:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9R160", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:10:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P62266"}, "ts": "2023-07-07 21:10:58 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8NBF2.58.58"}, "ts": "2023-07-07 21:11:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NBF2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:11:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41271-1"}, "ts": "2023-07-07 21:11:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6UW63-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:11:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6UW63-1"}, "ts": "2023-07-07 21:11:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P97742"}, "ts": "2023-07-07 21:11:33 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11279-1"}, "ts": "2023-07-07 21:12:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11348"}, "ts": "2023-07-07 21:12:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11348", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NMS3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:13:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A6NMS3.5.5"}, "ts": "2023-07-07 21:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5K6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:13:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y5K6"}, "ts": "2023-07-07 21:13:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11024295", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:14:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11024295", "type": "PubMed"}, "ts": "2023-07-07 21:14:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08590", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:14:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11940", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:14:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A6NGU5"}, "ts": "2023-07-07 21:14:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A6NGU5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:14:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15230", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:15:00 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O15230.849.849"}, "ts": "2023-07-07 21:15:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00734"}, "ts": "2023-07-07 21:15:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P70280", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:15:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P70280"}, "ts": "2023-07-07 21:15:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6P179.340.340"}, "ts": "2023-07-07 21:16:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P179", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:16:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29322", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:16:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P29322.291.291"}, "ts": "2023-07-07 21:16:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21829356", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:16:35 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21829356", "type": "PubMed"}, "ts": "2023-07-07 21:16:35 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000003"}, "ts": "2023-07-07 21:16:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q12797.280.280"}, "ts": "2023-07-07 21:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12797", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:16:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95347", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:17:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95347"}, "ts": "2023-07-07 21:17:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91X17", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 21:18:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P1J9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:18:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34697216", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:18:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34697216", "type": "PubMed"}, "ts": "2023-07-07 21:18:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A0A0B4J234.82.82"}, "ts": "2023-07-07 21:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0B4J234", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:18:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O88778-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 21:19:00 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O88778-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 21:19:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:19:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05089"}, "ts": "2023-07-07 21:19:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05089", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:19:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2J7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:19:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2J7.345.345"}, "ts": "2023-07-07 21:19:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99527", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:19:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99527.32.32"}, "ts": "2023-07-07 21:19:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:20:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M7H6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:20:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M7H6"}, "ts": "2023-07-07 21:20:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P98153", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:20:16 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P98153.381.381"}, "ts": "2023-07-07 21:20:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53992", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:20:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHC9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:20:38 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHC9.138.138"}, "ts": "2023-07-07 21:20:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30533", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:20:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30533"}, "ts": "2023-07-07 21:20:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4U2R8"}, "ts": "2023-07-07 21:20:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4U2R8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:21:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13835.121.121"}, "ts": "2023-07-07 21:21:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13835", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:21:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96577RX", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 21:21:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20823"}, "ts": "2023-07-07 21:21:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6IA69"}, "ts": "2023-07-07 21:21:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6IA69", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:21:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BT73"}, "ts": "2023-07-07 21:21:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BT73", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:21:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13610", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:21:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13610.57.57"}, "ts": "2023-07-07 21:21:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15542058", "type": "PubMed"}, "ts": "2023-07-07 21:21:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q2KHR3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:21:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15542058", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:21:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q2KHR3-1"}, "ts": "2023-07-07 21:21:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P22059"}, "ts": "2023-07-07 21:21:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SNT2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:21:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5SNT2.360.360"}, "ts": "2023-07-07 21:21:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8K3P1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:22:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8K3P1"}, "ts": "2023-07-07 21:22:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P05164.729.729"}, "ts": "2023-07-07 21:22:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P58335", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:22:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P58335"}, "ts": "2023-07-07 21:22:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31056744", "type": "PubMed"}, "ts": "2023-07-07 21:23:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31056744", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:23:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13634.50.50"}, "ts": "2023-07-07 21:23:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13634", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:23:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60507"}, "ts": "2023-07-07 21:23:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60507", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:23:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "how-to-cite", "message": "page access"}, "ts": "2023-07-07 21:24:00 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14511651", "type": "PubMed"}, "ts": "2023-07-07 21:24:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14511651", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06737"}, "ts": "2023-07-07 21:24:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P86790"}, "ts": "2023-07-07 21:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P86790", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:24:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UBU7"}, "ts": "2023-07-07 21:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UBU7", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:24:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:25:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G15050SW"}, "ts": "2023-07-07 21:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G15050SW", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 21:25:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A1L4L8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:25:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A1L4L8"}, "ts": "2023-07-07 21:25:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86U06.93.93"}, "ts": "2023-07-07 21:25:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86U06", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:25:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86SQ4.70.70"}, "ts": "2023-07-07 21:25:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86SQ4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:25:49 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9HD45.329.329"}, "ts": "2023-07-07 21:26:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9HD45", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:26:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAS1"}, "ts": "2023-07-07 21:26:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAS1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:26:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P62266", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:27:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14867.138.138"}, "ts": "2023-07-07 21:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14867", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:27:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41271-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:27:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P97742", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30190470", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:29:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30190470", "type": "PubMed"}, "ts": "2023-07-07 21:29:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q09666", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:30:27 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q09666.268.268"}, "ts": "2023-07-07 21:30:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P00734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:31:22 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G59743JO"}, "ts": "2023-07-07 21:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G59743JO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 21:31:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:31:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07951", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:31:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07951"}, "ts": "2023-07-07 21:31:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDI4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:32:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDI4"}, "ts": "2023-07-07 21:32:04 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 21:32:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8CEE0"}, "ts": "2023-07-07 21:32:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8CEE0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:32:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N3C7"}, "ts": "2023-07-07 21:32:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:33:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25121749", "type": "PubMed"}, "ts": "2023-07-07 21:33:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25121749", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:33:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WVV5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:33:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8WVV5.509.509"}, "ts": "2023-07-07 21:33:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UQ84"}, "ts": "2023-07-07 21:34:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UQ84", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:34:26 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20020531", "type": "PubMed"}, "ts": "2023-07-07 21:34:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20020531", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:34:47 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21709252", "type": "PubMed"}, "ts": "2023-07-07 21:35:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21709252", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:35:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BSR8-1"}, "ts": "2023-07-07 21:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BSR8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:35:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "E9PU77-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:35:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "E9PU77-1"}, "ts": "2023-07-07 21:35:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "28871036", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:36:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "28871036", "type": "PubMed"}, "ts": "2023-07-07 21:36:11 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H813.133.133"}, "ts": "2023-07-07 21:36:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H813", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:36:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20823", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:37:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01008"}, "ts": "2023-07-07 21:37:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9442054", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:37:33 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9442054", "type": "PubMed"}, "ts": "2023-07-07 21:37:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22059", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:37:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 21:37:53 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q96HR3", "cluster_type": "unselected"}, "ts": "2023-07-07 21:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR3", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 21:37:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96HR3", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 21:37:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02751-15"}, "ts": "2023-07-07 21:37:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10997"}, "ts": "2023-07-07 21:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10997", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:38:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:38:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BKS4"}, "ts": "2023-07-07 21:38:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BKS4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:38:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05164", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:38:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43021", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:38:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43021"}, "ts": "2023-07-07 21:38:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29322-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:39:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29322-1"}, "ts": "2023-07-07 21:39:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TF68", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:39:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8TF68"}, "ts": "2023-07-07 21:39:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06737", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:40:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:40:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P656"}, "ts": "2023-07-07 21:40:18 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9658408"}, "ts": "2023-07-07 21:40:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:40:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 21:40:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JLP1-1"}, "ts": "2023-07-07 21:40:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JLP1-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:40:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z4F1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:40:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z4F1"}, "ts": "2023-07-07 21:40:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17142736", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:40:46 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17142736", "type": "PubMed"}, "ts": "2023-07-07 21:40:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:42:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43251", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:42:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43251"}, "ts": "2023-07-07 21:42:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZC06", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:43:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZC06"}, "ts": "2023-07-07 21:43:11 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13224"}, "ts": "2023-07-07 21:43:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q924N4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q924N4"}, "ts": "2023-07-07 21:43:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4AAD6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:44:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4AAD6"}, "ts": "2023-07-07 21:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6K5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:44:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52630", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:45:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P52630.15.15"}, "ts": "2023-07-07 21:45:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8C8S3"}, "ts": "2023-07-07 21:45:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8C8S3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:45:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRK5"}, "ts": "2023-07-07 21:45:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRK5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:45:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R5L7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:45:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R5L7-1"}, "ts": "2023-07-07 21:45:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2U1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:46:19 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H2U1.185.185"}, "ts": "2023-07-07 21:46:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "807573", "type": "PubMed"}, "ts": "2023-07-07 21:46:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "807573", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:46:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D0M5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:47:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D0M5"}, "ts": "2023-07-07 21:47:01 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P32243"}, "ts": "2023-07-07 21:47:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P32243", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59540", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:47:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59540"}, "ts": "2023-07-07 21:47:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G22310AV", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 21:48:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5JSZ5.222.222"}, "ts": "2023-07-07 21:48:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JSZ5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:48:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R3D1"}, "ts": "2023-07-07 21:49:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R3D1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:49:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75179.50.50"}, "ts": "2023-07-07 21:49:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75179", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:49:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3C7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:49:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3C7"}, "ts": "2023-07-07 21:49:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NSD5-1"}, "ts": "2023-07-07 21:49:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NSD5-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:49:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23731542", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:49:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23731542", "type": "PubMed"}, "ts": "2023-07-07 21:49:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z7A4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:50:28 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z7A4.18.18"}, "ts": "2023-07-07 21:50:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P00156-1"}, "ts": "2023-07-07 21:50:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31511561", "type": "PubMed"}, "ts": "2023-07-07 21:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31511561", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:50:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y289"}, "ts": "2023-07-07 21:50:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04001-1"}, "ts": "2023-07-07 21:50:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04001-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:50:50 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G84452RH"}, "ts": "2023-07-07 21:50:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "9030613"}, "ts": "2023-07-07 21:50:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SJ8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:50:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SJ8"}, "ts": "2023-07-07 21:50:50 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000062"}, "ts": "2023-07-07 21:50:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P50294"}, "ts": "2023-07-07 21:51:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02496", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:52:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q02496.174.174"}, "ts": "2023-07-07 21:52:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10645", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:52:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10645.181.181"}, "ts": "2023-07-07 21:52:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z589"}, "ts": "2023-07-07 21:52:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z589", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:53:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35222"}, "ts": "2023-07-07 21:53:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 21:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O94856-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 21:53:28 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "O94856-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 21:53:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02751-15", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:53:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:53:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43734"}, "ts": "2023-07-07 21:53:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06909-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 21:55:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06909-1.1061.1061"}, "ts": "2023-07-07 21:55:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIL8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:55:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIL8"}, "ts": "2023-07-07 21:55:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60840", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:55:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60840"}, "ts": "2023-07-07 21:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34230127", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 21:55:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34230127", "type": "PubMed"}, "ts": "2023-07-07 21:55:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34230127", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 21:55:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JIP0"}, "ts": "2023-07-07 21:55:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JIP0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:55:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:55:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TEQ0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:55:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16822"}, "ts": "2023-07-07 21:56:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16822", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:56:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU89"}, "ts": "2023-07-07 21:56:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU89", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:56:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5SZZ8"}, "ts": "2023-07-07 21:57:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5SZZ8", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:57:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21731", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:57:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21731"}, "ts": "2023-07-07 21:57:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:58:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43631"}, "ts": "2023-07-07 21:58:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43631", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:58:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5DX21"}, "ts": "2023-07-07 21:58:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5DX21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:58:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P30953", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:58:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P30953"}, "ts": "2023-07-07 21:58:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BY89-1"}, "ts": "2023-07-07 21:58:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BY89-1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:59:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A908", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 21:59:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A908"}, "ts": "2023-07-07 21:59:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13224", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 21:59:45 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 22:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 22:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 22:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 22:00:02 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 22:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 22:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86T13", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:00:08 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86T13.381.381"}, "ts": "2023-07-07 22:00:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "9169423", "type": "PubMed"}, "ts": "2023-07-07 22:00:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "9169423", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:00:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G19517GM"}, "ts": "2023-07-07 22:00:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G19517GM", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:00:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y6K5"}, "ts": "2023-07-07 22:00:42 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "A3KN83.126.126"}, "ts": "2023-07-07 22:00:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A3KN83", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:00:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18205178", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:00:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18205178", "type": "PubMed"}, "ts": "2023-07-07 22:00:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZIK6"}, "ts": "2023-07-07 22:00:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZIK6", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:00:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75390"}, "ts": "2023-07-07 22:01:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96CB8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:01:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96CB8"}, "ts": "2023-07-07 22:01:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20843378", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:02:16 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20843378", "type": "PubMed"}, "ts": "2023-07-07 22:02:17 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14047PA"}, "ts": "2023-07-07 22:02:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3V063-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:02:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3V063-1"}, "ts": "2023-07-07 22:02:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O76095-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O76095-1"}, "ts": "2023-07-07 22:02:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96SM3-1"}, "ts": "2023-07-07 22:03:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96SM3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:03:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17810KS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:03:07 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-07 22:03:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11585921", "type": "PubMed"}, "ts": "2023-07-07 22:04:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11585921", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:04:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q4ZIN3"}, "ts": "2023-07-07 22:04:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q4ZIN3", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:04:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30914501", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:05:21 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30914501", "type": "PubMed"}, "ts": "2023-07-07 22:05:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30914501", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 22:05:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P37840-1"}, "ts": "2023-07-07 22:05:23 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P10155.201.201"}, "ts": "2023-07-07 22:05:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P10155", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:05:47 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15031"}, "ts": "2023-07-07 22:05:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8824804", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:06:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G84452RH", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:06:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8824804", "type": "PubMed"}, "ts": "2023-07-07 22:06:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK65", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:06:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53680"}, "ts": "2023-07-07 22:06:48 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9Y5Y9", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 22:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y5Y9", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 22:07:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99523-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:07:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99523-1.814.814"}, "ts": "2023-07-07 22:07:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P23919"}, "ts": "2023-07-07 22:07:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:07:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D240"}, "ts": "2023-07-07 22:07:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZQ60", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:08:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZQ60"}, "ts": "2023-07-07 22:08:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P59594", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:08:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P59594"}, "ts": "2023-07-07 22:08:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27916661", "type": "PubMed"}, "ts": "2023-07-07 22:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27916661", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:08:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:09:19 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14573534", "type": "PubMed"}, "ts": "2023-07-07 22:09:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14573534", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:09:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P05186"}, "ts": "2023-07-07 22:10:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P05186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:10:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WVC5"}, "ts": "2023-07-07 22:10:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WVC5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:10:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:10:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14258", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:10:55 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14258.91.91"}, "ts": "2023-07-07 22:10:55 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y3C4"}, "ts": "2023-07-07 22:10:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y3C4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:10:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O60603"}, "ts": "2023-07-07 22:11:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:11:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16009714", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:11:12 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16009714", "type": "PubMed"}, "ts": "2023-07-07 22:11:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34131132", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:11:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34131132", "type": "PubMed"}, "ts": "2023-07-07 22:11:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21845", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:11:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21845"}, "ts": "2023-07-07 22:11:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNJ4"}, "ts": "2023-07-07 22:13:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNJ4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:13:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P27699-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:14:00 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P27699-1"}, "ts": "2023-07-07 22:14:01 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22898666", "type": "PubMed"}, "ts": "2023-07-07 22:14:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22898666", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:14:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "1517238", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:14:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "1517238", "type": "PubMed"}, "ts": "2023-07-07 22:14:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H6X2"}, "ts": "2023-07-07 22:15:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21383078", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:15:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21383078", "type": "PubMed"}, "ts": "2023-07-07 22:15:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23434322", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:16:42 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23434322", "type": "PubMed"}, "ts": "2023-07-07 22:16:42 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6ZPL9-1"}, "ts": "2023-07-07 22:16:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6ZPL9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:17:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96NW4", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:17:01 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96NW4.1027.1027"}, "ts": "2023-07-07 22:17:01 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G96977YE"}, "ts": "2023-07-07 22:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G96977YE", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:17:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13285", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:17:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13285.203.203"}, "ts": "2023-07-07 22:17:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01042-1"}, "ts": "2023-07-07 22:17:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33121311", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:18:30 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33121311", "type": "PubMed"}, "ts": "2023-07-07 22:18:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5M824-1"}, "ts": "2023-07-07 22:20:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5M824-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:20:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10478845", "type": "PubMed"}, "ts": "2023-07-07 22:21:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10478845", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:21:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10066782", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:22:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10066782", "type": "PubMed"}, "ts": "2023-07-07 22:22:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7TNB2"}, "ts": "2023-07-07 22:22:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7TNB2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:22:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14415", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:23:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P14415.118.118"}, "ts": "2023-07-07 22:23:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23919", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9EPZ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:23:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9EPZ7-1"}, "ts": "2023-07-07 22:23:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2JRQ6-1"}, "ts": "2023-07-07 22:24:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3TC72", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:24:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2JRQ6-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:24:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3TC72"}, "ts": "2023-07-07 22:24:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17810KS"}, "ts": "2023-07-07 22:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G17810KS", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QXZ9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:25:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9QXZ9"}, "ts": "2023-07-07 22:25:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXG9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:25:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXG9"}, "ts": "2023-07-07 22:25:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8BX22", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:25:19 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8BX22"}, "ts": "2023-07-07 22:25:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96Q15-1"}, "ts": "2023-07-07 22:25:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96Q15-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:25:40 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "8305732", "type": "PubMed"}, "ts": "2023-07-07 22:26:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G23109YO"}, "ts": "2023-07-07 22:26:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G23109YO", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:26:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q02809-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "8305732", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:26:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q02809-1"}, "ts": "2023-07-07 22:26:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O60603", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:26:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7L5A8"}, "ts": "2023-07-07 22:27:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7L5A8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:27:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19838-1"}, "ts": "2023-07-07 22:27:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9DAN8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:27:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9DAN8"}, "ts": "2023-07-07 22:27:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69411IG"}, "ts": "2023-07-07 22:27:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Z205", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:27:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Z205"}, "ts": "2023-07-07 22:28:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O09126", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:28:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O09126"}, "ts": "2023-07-07 22:28:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WXI7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WXI7"}, "ts": "2023-07-07 22:29:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P60903", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:30:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P60903"}, "ts": "2023-07-07 22:30:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15203215", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:30:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15203215", "type": "PubMed"}, "ts": "2023-07-07 22:30:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13291", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:31:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13291"}, "ts": "2023-07-07 22:31:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:31:26 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G14796IU"}, "ts": "2023-07-07 22:31:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G14796IU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:31:27 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9JHU4-1", "cluster_type": "unselected"}, "ts": "2023-07-07 22:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHU4-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 22:31:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JHU4-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 22:31:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q16555-1"}, "ts": "2023-07-07 22:32:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:32:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QE2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:32:17 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QE2"}, "ts": "2023-07-07 22:32:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TCT8.307.307"}, "ts": "2023-07-07 22:32:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TCT8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:32:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8WZ42"}, "ts": "2023-07-07 22:32:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G68318VE"}, "ts": "2023-07-07 22:32:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8WZ42", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:32:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02766"}, "ts": "2023-07-07 22:32:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P21581"}, "ts": "2023-07-07 22:34:51 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G70323CJ"}, "ts": "2023-07-07 22:35:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UH99", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:35:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UH99.30.30"}, "ts": "2023-07-07 22:35:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:35:25 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UHC6.263.263"}, "ts": "2023-07-07 22:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UHC6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:35:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19474", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:35:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14541", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:35:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q14541"}, "ts": "2023-07-07 22:35:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P0CC10-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:35:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P0CC10-1"}, "ts": "2023-07-07 22:35:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P19474.266.266"}, "ts": "2023-07-07 22:35:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZZE0-1"}, "ts": "2023-07-07 22:36:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZZE0-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:36:25 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G69032HY"}, "ts": "2023-07-07 22:36:42 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G40702WU"}, "ts": "2023-07-07 22:36:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O08721"}, "ts": "2023-07-07 22:37:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16675", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 22:37:26 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P16675", "cluster_type": "unselected"}, "ts": "2023-07-07 22:37:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35363"}, "ts": "2023-07-07 22:37:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16675", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 22:37:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8R5F8"}, "ts": "2023-07-07 22:37:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8R5F8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:37:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01732", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:37:49 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43417UB"}, "ts": "2023-07-07 22:37:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IZS8.954.954"}, "ts": "2023-07-07 22:38:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IZS8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:38:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5PQM2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:39:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q5PQM2.565.565"}, "ts": "2023-07-07 22:39:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:39:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8N8W4-1"}, "ts": "2023-07-07 22:39:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N8W4-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:39:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96RT1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:39:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96RT1"}, "ts": "2023-07-07 22:39:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49187-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:40:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49187-1"}, "ts": "2023-07-07 22:40:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12050667", "type": "PubMed"}, "ts": "2023-07-07 22:40:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12050667", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:40:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IX90", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:41:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IX90"}, "ts": "2023-07-07 22:41:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NS40", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:41:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "25043012", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:42:38 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "25043012", "type": "PubMed"}, "ts": "2023-07-07 22:42:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6P2H3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:43:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6P2H3"}, "ts": "2023-07-07 22:43:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19838-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:43:31 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75751", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:43:40 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75751.298.298"}, "ts": "2023-07-07 22:43:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q60769-1"}, "ts": "2023-07-07 22:43:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q60769-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:43:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06330"}, "ts": "2023-07-07 22:44:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13790.139.139"}, "ts": "2023-07-07 22:44:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13790", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:44:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UL63"}, "ts": "2023-07-07 22:45:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UL63", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:45:07 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "31881170", "type": "PubMed"}, "ts": "2023-07-07 22:45:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "31881170", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:45:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-07 22:46:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13617", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:46:32 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75506"}, "ts": "2023-07-07 22:46:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75506", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:46:44 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q13617.452.452"}, "ts": "2023-07-07 22:46:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02656"}, "ts": "2023-07-07 22:46:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02656", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:47:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8TE57.141.141"}, "ts": "2023-07-07 22:47:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8TE57", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:47:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11036079", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:47:27 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11036079", "type": "PubMed"}, "ts": "2023-07-07 22:47:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z5V6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:47:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q7Z5V6.365.365"}, "ts": "2023-07-07 22:47:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11531", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:47:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96QU1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:47:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96QU1"}, "ts": "2023-07-07 22:47:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P11531"}, "ts": "2023-07-07 22:47:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16555-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:48:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q91ZX7-1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:48:39 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q91ZX7-1.2128.2128"}, "ts": "2023-07-07 22:48:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02766", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:48:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BK80-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:48:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BK80-1"}, "ts": "2023-07-07 22:48:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14894.93.93"}, "ts": "2023-07-07 22:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14894", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:49:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96AJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:49:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96AJ1"}, "ts": "2023-07-07 22:49:58 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q64240"}, "ts": "2023-07-07 22:50:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P21581", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:50:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:50:56 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G00875VP"}, "ts": "2023-07-07 22:50:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G00875VP", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:50:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9D051"}, "ts": "2023-07-07 22:50:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9D051", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:51:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G70323CJ", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q04671"}, "ts": "2023-07-07 22:51:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5QD07"}, "ts": "2023-07-07 22:51:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5QD07", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:51:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01222"}, "ts": "2023-07-07 22:51:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "94699", "type": "PubMed"}, "ts": "2023-07-07 22:51:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3YVJ1"}, "ts": "2023-07-07 22:51:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3YVJ1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "94699", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:51:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P14649", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:51:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P41047-1"}, "ts": "2023-07-07 22:51:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P14649"}, "ts": "2023-07-07 22:51:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P41047-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:52:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14670962", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:52:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14670962", "type": "PubMed"}, "ts": "2023-07-07 22:52:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G40702WU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:52:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G69032HY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:52:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P31749-1"}, "ts": "2023-07-07 22:52:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P31749-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:53:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "32852799", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:53:03 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "32852799", "type": "PubMed"}, "ts": "2023-07-07 22:53:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G60542VK", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 22:53:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O08721", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:53:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01903", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:54:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P01903"}, "ts": "2023-07-07 22:54:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q674X7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:54:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q674X7"}, "ts": "2023-07-07 22:54:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "26942288", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:54:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "26942288", "type": "PubMed"}, "ts": "2023-07-07 22:54:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9NZQ7"}, "ts": "2023-07-07 22:55:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q15942"}, "ts": "2023-07-07 22:55:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BWQ8-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:56:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BWQ8-1"}, "ts": "2023-07-07 22:56:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15178"}, "ts": "2023-07-07 22:56:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P23975.379.379"}, "ts": "2023-07-07 22:57:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P23975", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:57:06 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "A0A0G2K2T1"}, "ts": "2023-07-07 22:57:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "A0A0G2K2T1", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 22:57:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BTD8", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:58:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9BTD8.293.293"}, "ts": "2023-07-07 22:58:22 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IUK5.451.451"}, "ts": "2023-07-07 22:58:35 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IUK5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 22:58:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92734"}, "ts": "2023-07-07 22:58:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92734", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:58:40 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5XI13-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:58:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5XI13-1"}, "ts": "2023-07-07 22:58:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04001"}, "ts": "2023-07-07 22:59:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04001", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 22:59:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12393545", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 22:59:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12393545", "type": "PubMed"}, "ts": "2023-07-07 22:59:59 EDT-0400"}, {"api": "/glycan/search/", "req": {"glycan_identifier": {"glycan_id": "G17689DH"}}, "ts": "2023-07-07 23:00:01 EDT-0400"}, {"api": "/glycan/list/", "req": {"limit": 1, "id": "2316faab272e5ecd9522d547f67c9d82"}, "ts": "2023-07-07 23:00:02 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G17689DH"}, "ts": "2023-07-07 23:00:02 EDT-0400"}, {"api": "/protein/search/", "req": {"uniprot_canonical_ac": "P12314"}, "ts": "2023-07-07 23:00:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H1Y3", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:00:03 EDT-0400"}, {"api": "/protein/list/", "req": {"limit": 1, "id": "13c8348dcbfb67d596c28eb917bcce97"}, "ts": "2023-07-07 23:00:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H1Y3.92.92"}, "ts": "2023-07-07 23:00:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z2W7"}, "ts": "2023-07-07 23:00:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12314-1"}, "ts": "2023-07-07 23:00:06 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P20138", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:00:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P20138"}, "ts": "2023-07-07 23:00:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "global_search_result.html", "message": "page access"}, "ts": "2023-07-07 23:00:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q7Z624", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:00:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q7Z624"}, "ts": "2023-07-07 23:00:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P38571.103.103"}, "ts": "2023-07-07 23:00:24 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G01055IS"}, "ts": "2023-07-07 23:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P38571", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:00:24 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "19389355", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:00:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "19389355", "type": "PubMed"}, "ts": "2023-07-07 23:00:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "14976185", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:00:39 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "14976185", "type": "PubMed"}, "ts": "2023-07-07 23:00:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P10599"}, "ts": "2023-07-07 23:01:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P53985", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:01:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P53985"}, "ts": "2023-07-07 23:01:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVC4", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:02:03 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IVC4"}, "ts": "2023-07-07 23:02:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12601144", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:02:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12601144", "type": "PubMed"}, "ts": "2023-07-07 23:02:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:02:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IU99-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:04:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8IU99-1"}, "ts": "2023-07-07 23:04:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 23:04:38 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 23:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 23:04:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96S19", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:04:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96S19"}, "ts": "2023-07-07 23:04:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12356718", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:05:08 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12356718", "type": "PubMed"}, "ts": "2023-07-07 23:05:09 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15908954", "type": "PubMed"}, "ts": "2023-07-07 23:05:17 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15908954", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:05:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "22278061", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:05:28 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "22278061", "type": "PubMed"}, "ts": "2023-07-07 23:05:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2S6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:06:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2S6"}, "ts": "2023-07-07 23:06:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WUA6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:06:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WUA6"}, "ts": "2023-07-07 23:06:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H841.10.10"}, "ts": "2023-07-07 23:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H841", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:06:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q64240", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:06:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q04671", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:07:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01222", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:07:17 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9QYY0.388.388"}, "ts": "2023-07-07 23:08:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9QYY0", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:08:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:08:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16391297", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:08:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16391297", "type": "PubMed"}, "ts": "2023-07-07 23:08:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55287", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:09:24 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P55287.488.488"}, "ts": "2023-07-07 23:09:24 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZDR9-1"}, "ts": "2023-07-07 23:10:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZDR9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:10:16 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P48542-1"}, "ts": "2023-07-07 23:10:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P48542-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:10:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96GE5"}, "ts": "2023-07-07 23:10:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96GE5", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:11:04 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:11:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9NZR2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:11:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9NZR2.988.988"}, "ts": "2023-07-07 23:11:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96A32", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:11:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96A32"}, "ts": "2023-07-07 23:11:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q15942", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:11:30 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P56857-1"}, "ts": "2023-07-07 23:11:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P56857-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:11:41 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G13003UU"}, "ts": "2023-07-07 23:12:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 23:12:36 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H269", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 23:12:37 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "Q9H269", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 23:12:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75914", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:12:41 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75914.177.177"}, "ts": "2023-07-07 23:12:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15178", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:12:47 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P24593.123.123"}, "ts": "2023-07-07 23:12:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P24593", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:12:52 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6XZB0"}, "ts": "2023-07-07 23:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6XZB0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:12:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q61361", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:13:03 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q61361.413.413"}, "ts": "2023-07-07 23:13:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9WV41"}, "ts": "2023-07-07 23:13:15 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9WV41", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:13:19 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G07262RR"}, "ts": "2023-07-07 23:13:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07262RR", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 23:13:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13546"}, "ts": "2023-07-07 23:13:44 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G27025MB"}, "ts": "2023-07-07 23:13:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P52756", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:14:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P52756"}, "ts": "2023-07-07 23:14:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:14:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17023523", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:14:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17023523", "type": "PubMed"}, "ts": "2023-07-07 23:14:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZW59", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:15:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZW59"}, "ts": "2023-07-07 23:15:15 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P17927.1046.1046"}, "ts": "2023-07-07 23:15:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P17927", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:15:20 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q3UQ41-1"}, "ts": "2023-07-07 23:15:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y536", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:15:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y536.37.37"}, "ts": "2023-07-07 23:15:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q3UQ41-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:15:32 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35367.230.230"}, "ts": "2023-07-07 23:15:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35367", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:15:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B4DX44", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:15:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B4DX44"}, "ts": "2023-07-07 23:15:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P06858"}, "ts": "2023-07-07 23:17:36 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q96PB7.33.33"}, "ts": "2023-07-07 23:17:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96PB7", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:17:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8NDA2", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:18:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8NDA2"}, "ts": "2023-07-07 23:18:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06865", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:18:54 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P06865.21.21"}, "ts": "2023-07-07 23:18:54 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33306827", "type": "PubMed"}, "ts": "2023-07-07 23:18:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33306827", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33306827", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 23:18:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "10777491", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:18:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "10777491", "type": "PubMed"}, "ts": "2023-07-07 23:18:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G07392QY", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 23:19:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P22695", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:19:51 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P22695.367.367"}, "ts": "2023-07-07 23:19:51 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8IVW6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:19:59 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8IVW6.89.89"}, "ts": "2023-07-07 23:20:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 23:20:05 EDT-0400"}, {"api": "/pages/home_init/", "req": {}, "ts": "2023-07-07 23:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "home", "message": "page access"}, "ts": "2023-07-07 23:20:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5H943", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:20:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5U1V9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:21:27 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:21:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P43694", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:21:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P43694"}, "ts": "2023-07-07 23:21:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13929", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:22:33 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P13929.176.176"}, "ts": "2023-07-07 23:22:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "18541534", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:22:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "18541534", "type": "PubMed"}, "ts": "2023-07-07 23:22:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19793"}, "ts": "2023-07-07 23:22:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19793", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:22:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q12913", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:23:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q12913"}, "ts": "2023-07-07 23:23:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q13501"}, "ts": "2023-07-07 23:23:07 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q8VE95"}, "ts": "2023-07-07 23:23:19 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8VE95", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:23:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P35610"}, "ts": "2023-07-07 23:23:23 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35610", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:23:25 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07900"}, "ts": "2023-07-07 23:23:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07900", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:23:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:23:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O15394", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:23:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O15394"}, "ts": "2023-07-07 23:23:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94831VI", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 23:23:35 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94831VI"}, "ts": "2023-07-07 23:23:35 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P55157"}, "ts": "2023-07-07 23:23:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UNX4"}, "ts": "2023-07-07 23:23:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UNX4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:23:51 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P78324"}, "ts": "2023-07-07 23:24:07 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P78324", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:24:08 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P02788-1"}, "ts": "2023-07-07 23:24:18 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P02788-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:24:23 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07711"}, "ts": "2023-07-07 23:24:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96EG1"}, "ts": "2023-07-07 23:24:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96EG1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:24:34 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11967127", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:24:41 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11967127", "type": "PubMed"}, "ts": "2023-07-07 23:24:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UKS6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:24:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2001396", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:24:53 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2001396", "type": "PubMed"}, "ts": "2023-07-07 23:24:54 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9UKS6"}, "ts": "2023-07-07 23:24:54 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "24860427", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:25:34 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P16860"}, "ts": "2023-07-07 23:25:36 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "24860427", "type": "PubMed"}, "ts": "2023-07-07 23:25:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830"}, "ts": "2023-07-07 23:25:50 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16034420", "type": "PubMed"}, "ts": "2023-07-07 23:25:53 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P12830"}, "ts": "2023-07-07 23:25:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16034420", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:25:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "2777793", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:26:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "2777793", "type": "PubMed"}, "ts": "2023-07-07 23:26:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y6N5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:26:56 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9Y6N5.264.264"}, "ts": "2023-07-07 23:26:56 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "20208530", "type": "PubMed"}, "ts": "2023-07-07 23:27:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "20208530", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:27:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:27:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07910", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:27:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27119146", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:27:45 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27119146", "type": "PubMed"}, "ts": "2023-07-07 23:27:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P08572.774.774"}, "ts": "2023-07-07 23:28:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08572", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:28:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P0X4", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:28:09 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9P0X4"}, "ts": "2023-07-07 23:28:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "15282548", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:29:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "15282548", "type": "PubMed"}, "ts": "2023-07-07 23:29:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O43663", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:29:36 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O43663"}, "ts": "2023-07-07 23:29:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13546", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:29:40 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92626"}, "ts": "2023-07-07 23:29:46 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92626", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:29:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9JK54", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9JK54"}, "ts": "2023-07-07 23:29:50 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q00796"}, "ts": "2023-07-07 23:30:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q00796", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:30:05 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q99541.413.413"}, "ts": "2023-07-07 23:30:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99541", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:30:20 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11140637", "type": "PubMed"}, "ts": "2023-07-07 23:30:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11140637", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:30:49 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q63538-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:31:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UGM5.136.136"}, "ts": "2023-07-07 23:31:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UGM5", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:31:13 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q63538-1"}, "ts": "2023-07-07 23:31:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P11597", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:31:45 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P11597.358.358"}, "ts": "2023-07-07 23:31:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "F1M4E1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:31:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "F1M4E1"}, "ts": "2023-07-07 23:31:59 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H2E6"}, "ts": "2023-07-07 23:32:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H2E6", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:32:51 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12464182", "type": "PubMed"}, "ts": "2023-07-07 23:33:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12464182", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:33:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P06858", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:33:31 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04899-1"}, "ts": "2023-07-07 23:33:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04899-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:34:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "12032142", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:34:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9Y4L1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:34:29 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9Y4L1"}, "ts": "2023-07-07 23:34:29 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "12032142", "type": "PubMed"}, "ts": "2023-07-07 23:34:38 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P19878-1"}, "ts": "2023-07-07 23:34:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P19878-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:34:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6Q0C1"}, "ts": "2023-07-07 23:35:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6Q0C1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:35:26 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "GGM.000090"}, "ts": "2023-07-07 23:35:28 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:35:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9H7L9"}, "ts": "2023-07-07 23:35:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H7L9", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:35:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75179", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:35:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "O75179.2379.2379"}, "ts": "2023-07-07 23:35:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P13612", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:36:05 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P13612"}, "ts": "2023-07-07 23:36:05 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "23088915", "type": "PubMed"}, "ts": "2023-07-07 23:36:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "23088915", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:36:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q80ZD9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:36:48 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q80ZD9"}, "ts": "2023-07-07 23:36:48 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:36:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P54289"}, "ts": "2023-07-07 23:36:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P54289", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:36:56 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G52527GH"}, "ts": "2023-07-07 23:37:04 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G43089EG"}, "ts": "2023-07-07 23:37:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G00912UN"}, "ts": "2023-07-07 23:37:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G06247RL"}, "ts": "2023-07-07 23:37:05 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G55412XP"}, "ts": "2023-07-07 23:37:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G23010ZW"}, "ts": "2023-07-07 23:37:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G75983OB"}, "ts": "2023-07-07 23:37:06 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G47518TP"}, "ts": "2023-07-07 23:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G34730YF"}, "ts": "2023-07-07 23:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G33791AF"}, "ts": "2023-07-07 23:37:07 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G81263BG"}, "ts": "2023-07-07 23:37:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G11870QZ"}, "ts": "2023-07-07 23:37:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G22310AV"}, "ts": "2023-07-07 23:37:08 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G56784JY"}, "ts": "2023-07-07 23:37:09 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G86795LJ"}, "ts": "2023-07-07 23:37:09 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9P2Q2.872.872"}, "ts": "2023-07-07 23:37:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9P2Q2", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:37:45 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "27863227", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:37:52 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "27863227", "type": "PubMed"}, "ts": "2023-07-07 23:37:52 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G94232LU"}, "ts": "2023-07-07 23:37:53 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G94232LU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 23:37:54 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P28653-1", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 23:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653-1", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 23:37:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 23:37:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P28653-1", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Linux; Android 6.0.1; Nexus 5X Build/MMB29P) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/114.0.5735.179 Mobile Safari/537.36 (compatible; Googlebot/2.1;  http://www.google.com/bot.html)"}, "ts": "2023-07-07 23:37:56 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O00308"}, "ts": "2023-07-07 23:37:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O00308", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:38:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P07141"}, "ts": "2023-07-07 23:38:37 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5BJS7"}, "ts": "2023-07-07 23:38:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5BJS7", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:38:46 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O95897"}, "ts": "2023-07-07 23:38:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O95897", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:39:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q13501", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:39:06 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "34390329", "type": "PubMed"}, "ts": "2023-07-07 23:39:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "34390329", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:39:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P55157", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:39:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9H324", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:40:20 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9H324.1096.1096"}, "ts": "2023-07-07 23:40:21 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:40:38 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6PJG9-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:40:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6PJG9-1"}, "ts": "2023-07-07 23:40:39 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P29459"}, "ts": "2023-07-07 23:40:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:40:49 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04217"}, "ts": "2023-07-07 23:40:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04217", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:40:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P16860", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:41:32 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6AXR8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:41:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6AXR8"}, "ts": "2023-07-07 23:41:42 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P12830", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:41:48 EDT-0400"}, {"api": "/glycan/image/", "req": {"glytoucan_ac": "G57321FI"}, "ts": "2023-07-07 23:42:15 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P61073"}, "ts": "2023-07-07 23:42:18 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q92560"}, "ts": "2023-07-07 23:42:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q92560", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:43:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P04196", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:43:22 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P04196"}, "ts": "2023-07-07 23:43:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6V1X1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:43:26 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q6V1X1"}, "ts": "2023-07-07 23:43:27 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q99K10"}, "ts": "2023-07-07 23:43:33 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q99K10", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:43:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G65635AB", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 23:43:57 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G65635AB"}, "ts": "2023-07-07 23:43:57 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:43:58 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "PubMed", "type": "16148104"}, "ts": "2023-07-07 23:43:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "PubMed", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 23:43:59 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q8N264", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:44:21 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q8N264.135.135"}, "ts": "2023-07-07 23:44:22 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "4352834", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:45:13 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "4352834", "type": "PubMed"}, "ts": "2023-07-07 23:45:14 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D4A7Q9"}, "ts": "2023-07-07 23:45:29 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D4A7Q9", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:45:34 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "16841166", "type": "PubMed"}, "ts": "2023-07-07 23:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "16841166", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:46:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P01831", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:46:06 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P01831.118.118"}, "ts": "2023-07-07 23:46:07 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q16602.203.203"}, "ts": "2023-07-07 23:46:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q16602", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:46:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P08883"}, "ts": "2023-07-07 23:46:16 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P08883", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:46:20 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96J94", "user": "Undecided", "type": "user", "page": "protVista", "message": "page access"}, "ts": "2023-07-07 23:46:44 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96J94"}, "ts": "2023-07-07 23:46:45 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "P49327"}, "ts": "2023-07-07 23:46:50 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P49327", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:46:52 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33766215", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:47:10 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33766215", "type": "PubMed"}, "ts": "2023-07-07 23:47:11 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q86WK6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:47:12 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q86WK6.317.317"}, "ts": "2023-07-07 23:47:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "try-me", "message": "page access"}, "ts": "2023-07-07 23:47:13 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UIF9.507.507"}, "ts": "2023-07-07 23:47:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UIF9", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:47:26 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q5JUK3", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:47:41 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q5JUK3"}, "ts": "2023-07-07 23:47:41 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:47:44 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q14498", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:47:46 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q14498.15.15"}, "ts": "2023-07-07 23:47:47 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "17210646", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:48:24 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "17210646", "type": "PubMed"}, "ts": "2023-07-07 23:48:25 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "3182818", "type": "PubMed"}, "ts": "2023-07-07 23:48:30 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q9UMS6.37.37"}, "ts": "2023-07-07 23:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9UMS6", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:49:30 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "D3ZTJ7-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:51:02 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "D3ZTJ7-1"}, "ts": "2023-07-07 23:51:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33554397", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:51:11 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "33554397", "type": "PubMed"}, "ts": "2023-07-07 23:51:12 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "33554397", "user": "Undecided", "type": "error", "page": "publication", "message": "Network error. Publication api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 23:51:12 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q96K21"}, "ts": "2023-07-07 23:52:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q96K21", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:52:10 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "G3V928.1646.1646"}, "ts": "2023-07-07 23:52:14 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G3V928", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:52:15 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "11790298", "type": "PubMed"}, "ts": "2023-07-07 23:52:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "11790298", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:52:25 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39654", "user": "Undecided", "type": "user", "page": "alignment", "message": "page access"}, "ts": "2023-07-07 23:53:55 EDT-0400"}, {"api": "/protein/alignment/", "req": {"uniprot_canonical_ac": "P39654", "cluster_type": "isoformset.uniprotkb"}, "ts": "2023-07-07 23:53:55 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P39654", "user": "Undecided", "type": "error", "page": "alignment", "message": "Network error. Alignment api call. Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_5) AppleWebKit/605.1.15 (KHTML, like Gecko) Version/13.1.1 Safari/605.1.15 (Applebot/0.1;  http://www.apple.com/go/applebot)"}, "ts": "2023-07-07 23:53:56 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "B3VQM3-1", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:53:57 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "B3VQM3-1"}, "ts": "2023-07-07 23:53:58 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P26368", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:54:02 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P26368.79.79"}, "ts": "2023-07-07 23:54:02 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P07141", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:54:28 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9ESL0"}, "ts": "2023-07-07 23:54:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9ESL0", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:54:43 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "O75445", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:54:43 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "O75445"}, "ts": "2023-07-07 23:54:43 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "30579780", "type": "PubMed"}, "ts": "2023-07-07 23:55:00 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "30579780", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:55:01 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "21574960", "user": "Undecided", "type": "user", "page": "publication", "message": "page access"}, "ts": "2023-07-07 23:55:57 EDT-0400"}, {"api": "/publication/detail/", "req": {"id": "21574960", "type": "PubMed"}, "ts": "2023-07-07 23:55:57 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "Q6MZT1.153.153"}, "ts": "2023-07-07 23:56:03 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q6MZT1", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:56:04 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q06186"}, "ts": "2023-07-07 23:56:05 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q06186", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:56:10 EDT-0400"}, {"api": "/protein/detail/", "req": {"uniprot_canonical_ac": "Q9BRP8"}, "ts": "2023-07-07 23:56:10 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "Q9BRP8", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:56:13 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P35968", "user": "Undecided", "type": "user", "page": "Siteview", "message": "page access"}, "ts": "2023-07-07 23:56:37 EDT-0400"}, {"api": "/site/detail/", "req": {"site_id": "P35968.997.997"}, "ts": "2023-07-07 23:56:37 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P29459", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:56:39 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 23:58:08 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "G82858KU", "user": "Undecided", "type": "user", "page": "glycan", "message": "page access"}, "ts": "2023-07-07 23:58:09 EDT-0400"}, {"api": "/glycan/detail/", "req": {"glytoucan_ac": "G82858KU"}, "ts": "2023-07-07 23:58:09 EDT-0400"}, {"api": "/log/logging/", "req": {"id": "P61073", "user": "Undecided", "type": "user", "page": "protein", "message": "page access"}, "ts": "2023-07-07 23:58:12 EDT-0400"}]